--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:38:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0070/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -355.71 -359.01
2 -355.70 -358.80
--------------------------------------
TOTAL -355.71 -358.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890212 0.089446 0.345066 1.460665 0.863421 1228.97 1364.98 1.000
r(A<->C){all} 0.168078 0.018478 0.000106 0.436838 0.135642 153.01 310.56 1.002
r(A<->G){all} 0.164927 0.018634 0.000115 0.434387 0.129447 214.40 355.97 1.000
r(A<->T){all} 0.159762 0.018094 0.000057 0.429445 0.123165 167.55 336.84 1.003
r(C<->G){all} 0.164053 0.017280 0.000009 0.420027 0.133845 81.32 194.81 1.000
r(C<->T){all} 0.168728 0.019384 0.000009 0.444398 0.134371 159.53 224.15 1.001
r(G<->T){all} 0.174452 0.020392 0.000162 0.467088 0.139204 198.25 208.57 1.003
pi(A){all} 0.207108 0.000603 0.162462 0.256980 0.206667 1390.16 1445.58 1.001
pi(C){all} 0.287183 0.000784 0.234554 0.344478 0.286797 1254.92 1287.24 1.000
pi(G){all} 0.328208 0.000804 0.274782 0.385195 0.327692 1090.62 1121.08 1.000
pi(T){all} 0.177500 0.000560 0.132879 0.224912 0.176445 1114.20 1150.05 1.000
alpha{1,2} 0.419531 0.236215 0.000128 1.418861 0.242153 1206.43 1279.04 1.000
alpha{3} 0.480050 0.259433 0.000148 1.509187 0.311323 1246.58 1373.79 1.000
pinvar{all} 0.993780 0.000055 0.980224 0.999999 0.996111 1368.90 1434.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -343.73801
Model 2: PositiveSelection -343.737983
Model 0: one-ratio -343.737985
Model 7: beta -343.738003
Model 8: beta&w>1 -343.737972
Model 0 vs 1 4.999999998744897E-5
Model 2 vs 1 5.3999999977349944E-5
Model 8 vs 7 6.199999995715189E-5
>C1
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C2
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C3
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C4
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C5
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C6
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87
C1 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C2 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C3 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C4 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C5 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C6 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
**************************************************
C1 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C2 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C3 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C4 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C5 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C6 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 87 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 87 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2610]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2610]--->[2610]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.440 Mb, Max= 30.599 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C2 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C3 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C4 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C5 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C6 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
**************************************************
C1 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C2 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C3 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C4 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C5 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C6 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C2 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C3 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C4 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C5 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C6 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
**************************************************
C1 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C2 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C3 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C4 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C5 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C6 TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
**************************************************
C1 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C2 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C3 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C4 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C5 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C6 CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
**************************************************
C1 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C2 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C3 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C4 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C5 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C6 CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
**************************************************
C1 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C2 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C3 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C4 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C5 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C6 GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
**************************************************
C1 CCCACAGGGAG
C2 CCCACAGGGAG
C3 CCCACAGGGAG
C4 CCCACAGGGAG
C5 CCCACAGGGAG
C6 CCCACAGGGAG
***********
>C1
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C2
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C3
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C4
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C5
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C6
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C1
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C2
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C3
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C4
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C5
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C6
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 261 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790234
Setting output file names to "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1563810649
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0172622997
Seed = 1730934762
Swapseed = 1579790234
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -584.130424 -- -24.965149
Chain 2 -- -584.130513 -- -24.965149
Chain 3 -- -584.130479 -- -24.965149
Chain 4 -- -584.130513 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -584.130513 -- -24.965149
Chain 2 -- -584.130479 -- -24.965149
Chain 3 -- -584.130513 -- -24.965149
Chain 4 -- -584.130513 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-584.130] (-584.131) (-584.130) (-584.131) * [-584.131] (-584.130) (-584.131) (-584.131)
500 -- (-370.700) (-362.204) [-369.786] (-372.531) * (-363.486) [-367.491] (-372.134) (-368.438) -- 0:00:00
1000 -- [-368.764] (-363.964) (-363.247) (-374.419) * (-361.278) [-362.716] (-371.194) (-361.540) -- 0:00:00
1500 -- (-361.526) (-361.243) (-361.520) [-376.189] * (-364.312) [-367.332] (-374.770) (-363.319) -- 0:00:00
2000 -- (-364.783) [-364.477] (-368.822) (-365.671) * (-364.567) (-368.058) (-367.103) [-363.166] -- 0:00:00
2500 -- [-361.364] (-363.519) (-362.282) (-362.718) * (-360.173) [-365.707] (-361.415) (-361.218) -- 0:00:00
3000 -- [-368.067] (-380.257) (-366.197) (-371.340) * [-358.340] (-364.721) (-363.117) (-368.101) -- 0:00:00
3500 -- (-362.187) [-362.623] (-370.163) (-368.593) * (-362.360) (-368.455) [-359.370] (-374.298) -- 0:00:00
4000 -- (-362.509) (-363.209) [-365.588] (-369.082) * (-369.102) (-361.538) (-362.465) [-368.596] -- 0:00:00
4500 -- (-363.617) (-368.999) (-373.753) [-364.622] * (-367.244) (-362.462) [-368.977] (-367.417) -- 0:00:00
5000 -- [-370.052] (-367.768) (-379.436) (-368.735) * (-372.033) (-376.191) (-369.259) [-361.012] -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- [-366.079] (-364.429) (-368.251) (-372.080) * (-370.466) [-365.122] (-364.878) (-365.502) -- 0:00:00
6000 -- (-367.779) (-367.117) (-361.606) [-363.701] * (-371.496) [-360.366] (-360.446) (-377.985) -- 0:00:00
6500 -- [-356.056] (-361.394) (-373.526) (-363.488) * (-366.243) (-367.275) [-363.836] (-364.734) -- 0:00:00
7000 -- (-357.736) (-364.288) (-364.914) [-364.359] * (-377.011) (-368.609) [-365.614] (-364.997) -- 0:00:00
7500 -- (-355.742) (-370.469) (-362.212) [-363.967] * (-362.123) [-366.682] (-371.315) (-370.297) -- 0:00:00
8000 -- (-355.541) (-363.891) (-365.837) [-362.936] * (-363.404) (-381.700) [-366.226] (-361.149) -- 0:00:00
8500 -- (-356.096) (-374.122) (-365.253) [-365.128] * [-360.918] (-362.952) (-370.898) (-366.747) -- 0:00:00
9000 -- (-357.215) (-381.875) (-363.783) [-373.983] * (-365.554) (-364.989) [-360.674] (-366.894) -- 0:01:50
9500 -- (-355.603) (-370.440) (-369.231) [-361.353] * (-362.825) (-359.096) (-368.463) [-367.283] -- 0:01:44
10000 -- (-356.629) (-365.174) (-363.774) [-366.638] * (-362.291) [-355.660] (-364.748) (-369.738) -- 0:01:39
Average standard deviation of split frequencies: 0.072920
10500 -- (-355.004) (-375.611) (-364.491) [-373.296] * (-370.779) (-357.194) [-364.444] (-368.304) -- 0:01:34
11000 -- (-355.851) [-364.514] (-364.842) (-373.123) * (-371.217) (-359.664) (-365.194) [-368.894] -- 0:01:29
11500 -- [-355.865] (-364.534) (-364.250) (-364.245) * (-372.578) [-354.688] (-366.093) (-370.148) -- 0:01:25
12000 -- [-356.996] (-366.026) (-364.701) (-369.434) * (-367.556) (-357.851) (-364.682) [-366.314] -- 0:01:22
12500 -- (-354.850) [-366.613] (-362.753) (-371.442) * [-364.006] (-356.564) (-370.589) (-367.671) -- 0:01:19
13000 -- (-355.200) (-363.657) [-367.329] (-362.039) * (-367.226) (-355.045) [-364.630] (-366.059) -- 0:01:15
13500 -- (-357.249) (-365.144) [-367.171] (-361.617) * (-369.599) (-355.808) [-365.438] (-363.302) -- 0:01:13
14000 -- (-358.742) (-364.534) [-362.393] (-366.033) * (-365.970) (-356.029) (-365.590) [-364.976] -- 0:01:10
14500 -- [-354.769] (-365.926) (-369.011) (-367.825) * (-362.523) [-354.709] (-369.280) (-365.610) -- 0:01:07
15000 -- (-355.458) (-363.493) [-361.795] (-365.578) * (-361.289) (-356.972) [-362.776] (-371.288) -- 0:01:05
Average standard deviation of split frequencies: 0.049622
15500 -- (-357.414) [-367.841] (-373.366) (-371.929) * (-364.122) (-355.130) [-363.771] (-359.928) -- 0:01:03
16000 -- (-363.407) (-368.505) [-366.204] (-360.714) * [-360.610] (-358.871) (-363.241) (-369.277) -- 0:01:01
16500 -- (-358.648) (-368.204) (-366.960) [-362.251] * [-358.807] (-359.645) (-377.381) (-371.567) -- 0:00:59
17000 -- [-356.562] (-363.664) (-367.567) (-364.668) * (-355.710) [-358.009] (-360.034) (-364.994) -- 0:00:57
17500 -- [-358.287] (-365.117) (-370.517) (-363.843) * (-360.123) (-355.391) (-368.683) [-357.666] -- 0:00:56
18000 -- (-356.725) (-370.673) [-363.082] (-370.952) * (-362.396) (-356.640) [-368.394] (-355.816) -- 0:00:54
18500 -- (-362.294) (-368.868) [-368.238] (-364.683) * (-360.997) [-355.628] (-364.405) (-357.623) -- 0:00:53
19000 -- (-358.571) (-376.659) [-372.851] (-363.130) * (-358.095) (-356.924) [-364.024] (-356.876) -- 0:00:51
19500 -- [-355.248] (-365.872) (-371.466) (-361.469) * (-354.750) (-354.459) (-369.397) [-358.277] -- 0:00:50
20000 -- (-357.301) (-365.795) [-365.187] (-365.253) * (-363.914) (-357.890) [-362.171] (-356.977) -- 0:00:49
Average standard deviation of split frequencies: 0.053223
20500 -- [-356.249] (-364.077) (-365.777) (-359.941) * (-358.796) (-359.429) (-371.127) [-355.003] -- 0:00:47
21000 -- (-356.331) (-373.527) [-363.869] (-362.842) * [-359.459] (-359.318) (-365.544) (-355.089) -- 0:00:46
21500 -- (-355.420) [-359.242] (-375.221) (-365.172) * [-356.090] (-357.264) (-369.290) (-356.299) -- 0:00:45
22000 -- (-356.771) [-362.786] (-365.585) (-373.634) * [-355.299] (-356.727) (-372.435) (-355.473) -- 0:01:28
22500 -- [-354.126] (-360.689) (-366.908) (-370.557) * (-357.911) [-358.822] (-363.785) (-354.642) -- 0:01:26
23000 -- (-354.377) (-372.080) [-373.101] (-370.468) * [-355.569] (-354.882) (-367.208) (-357.303) -- 0:01:24
23500 -- (-355.378) [-366.376] (-366.178) (-372.554) * (-356.684) [-357.442] (-365.256) (-355.593) -- 0:01:23
24000 -- [-355.520] (-363.306) (-374.232) (-362.407) * [-355.854] (-357.986) (-371.017) (-354.507) -- 0:01:21
24500 -- [-354.914] (-366.427) (-371.342) (-368.692) * (-354.990) (-357.009) (-366.590) [-355.957] -- 0:01:19
25000 -- [-356.723] (-366.630) (-364.549) (-366.168) * (-355.274) (-354.731) [-367.340] (-358.442) -- 0:01:18
Average standard deviation of split frequencies: 0.029669
25500 -- [-355.819] (-364.702) (-373.457) (-371.951) * (-355.613) [-357.217] (-369.977) (-359.213) -- 0:01:16
26000 -- (-356.869) (-371.538) [-364.887] (-365.819) * (-355.517) (-356.174) (-364.815) [-356.702] -- 0:01:14
26500 -- (-355.806) [-363.824] (-361.682) (-370.836) * (-357.228) (-359.387) [-368.946] (-355.280) -- 0:01:13
27000 -- (-355.662) [-366.045] (-366.255) (-365.674) * (-355.863) [-357.491] (-373.447) (-355.720) -- 0:01:12
27500 -- (-356.937) (-361.986) [-366.873] (-366.846) * (-358.845) [-356.631] (-367.177) (-356.109) -- 0:01:10
28000 -- [-357.775] (-372.404) (-365.386) (-360.102) * [-356.020] (-356.941) (-365.768) (-360.673) -- 0:01:09
28500 -- (-356.869) [-364.511] (-367.569) (-368.073) * [-355.777] (-355.588) (-370.706) (-365.626) -- 0:01:08
29000 -- (-354.386) (-385.528) [-363.488] (-367.477) * (-357.044) [-356.248] (-362.738) (-362.836) -- 0:01:06
29500 -- [-356.340] (-355.239) (-365.793) (-366.665) * [-356.998] (-354.672) (-358.721) (-357.012) -- 0:01:05
30000 -- [-357.311] (-355.855) (-379.270) (-366.793) * [-355.038] (-355.175) (-362.358) (-355.184) -- 0:01:04
Average standard deviation of split frequencies: 0.027949
30500 -- (-359.819) [-355.184] (-374.281) (-362.458) * (-354.501) (-355.228) (-357.335) [-355.525] -- 0:01:03
31000 -- (-358.573) [-356.961] (-358.818) (-363.488) * (-358.572) (-354.733) (-356.950) [-354.962] -- 0:01:02
31500 -- (-354.195) (-356.825) (-357.220) [-359.607] * (-357.148) [-356.184] (-361.737) (-355.177) -- 0:01:01
32000 -- (-354.037) (-357.199) [-356.580] (-363.040) * [-357.858] (-355.936) (-357.466) (-354.808) -- 0:01:00
32500 -- (-354.922) [-357.948] (-357.151) (-373.089) * (-357.317) (-359.245) [-355.604] (-359.233) -- 0:00:59
33000 -- (-357.126) [-354.801] (-359.216) (-367.325) * (-357.995) (-359.910) (-356.797) [-356.635] -- 0:00:58
33500 -- (-357.323) [-356.930] (-357.816) (-363.353) * [-355.880] (-361.245) (-355.292) (-357.713) -- 0:00:57
34000 -- (-355.825) (-357.680) [-355.514] (-370.250) * [-356.661] (-356.555) (-356.350) (-356.195) -- 0:00:56
34500 -- (-358.359) [-358.475] (-355.933) (-367.827) * (-360.301) [-354.728] (-359.635) (-354.694) -- 0:00:55
35000 -- (-355.088) [-354.930] (-355.544) (-370.817) * (-355.476) (-356.820) [-356.543] (-356.665) -- 0:00:55
Average standard deviation of split frequencies: 0.029635
35500 -- (-360.942) [-359.569] (-356.320) (-371.592) * (-356.441) (-357.733) (-357.520) [-355.944] -- 0:00:54
36000 -- (-359.756) [-356.409] (-355.938) (-364.015) * (-356.509) (-356.976) (-355.010) [-354.854] -- 0:00:53
36500 -- (-356.123) (-355.726) [-356.540] (-375.019) * [-356.462] (-355.966) (-355.545) (-355.573) -- 0:00:52
37000 -- [-355.833] (-357.924) (-357.997) (-371.630) * [-355.413] (-356.688) (-359.768) (-354.823) -- 0:00:52
37500 -- (-355.799) [-356.327] (-355.198) (-355.987) * (-357.019) (-358.878) (-358.953) [-356.369] -- 0:00:51
38000 -- (-357.885) [-355.842] (-355.684) (-356.219) * (-355.349) (-354.832) [-355.274] (-358.908) -- 0:01:15
38500 -- [-358.752] (-355.081) (-355.132) (-357.925) * (-355.575) (-354.293) [-359.224] (-357.480) -- 0:01:14
39000 -- (-355.902) (-365.125) [-355.906] (-354.813) * (-354.859) (-357.711) (-356.783) [-355.800] -- 0:01:13
39500 -- (-356.668) (-358.444) (-356.652) [-355.971] * [-356.055] (-358.119) (-359.282) (-357.869) -- 0:01:12
40000 -- [-354.497] (-358.808) (-357.072) (-357.750) * (-356.447) (-355.840) [-356.880] (-358.094) -- 0:01:12
Average standard deviation of split frequencies: 0.032844
40500 -- [-358.637] (-358.243) (-358.526) (-356.370) * (-356.456) (-356.831) [-359.159] (-356.061) -- 0:01:11
41000 -- (-356.002) (-356.796) [-354.554] (-358.056) * (-356.829) [-354.332] (-359.144) (-355.564) -- 0:01:10
41500 -- (-354.674) (-355.641) (-357.195) [-356.295] * (-354.615) [-355.164] (-360.354) (-356.384) -- 0:01:09
42000 -- [-357.228] (-358.399) (-357.101) (-358.776) * (-358.399) (-357.800) [-355.480] (-357.897) -- 0:01:08
42500 -- (-359.014) [-355.265] (-360.931) (-358.781) * (-356.381) (-354.329) (-363.147) [-355.584] -- 0:01:07
43000 -- (-359.183) (-355.317) (-359.920) [-357.377] * (-355.683) (-354.108) (-358.111) [-356.801] -- 0:01:06
43500 -- [-355.024] (-355.499) (-358.226) (-358.718) * (-355.836) (-356.919) [-356.688] (-354.188) -- 0:01:05
44000 -- (-356.239) (-356.858) (-355.543) [-355.600] * (-356.373) [-358.401] (-359.939) (-354.874) -- 0:01:05
44500 -- (-359.473) (-355.761) [-355.218] (-357.949) * (-355.805) (-360.333) [-360.283] (-356.181) -- 0:01:04
45000 -- [-357.227] (-354.688) (-355.977) (-359.100) * [-354.634] (-357.019) (-360.760) (-356.045) -- 0:01:03
Average standard deviation of split frequencies: 0.030231
45500 -- [-355.887] (-358.681) (-355.405) (-355.103) * (-355.544) (-357.607) [-354.632] (-356.293) -- 0:01:02
46000 -- (-355.235) (-358.320) (-355.126) [-355.235] * [-357.822] (-354.128) (-355.697) (-358.719) -- 0:01:02
46500 -- (-354.304) (-355.305) [-354.599] (-354.976) * (-364.238) (-357.918) (-358.428) [-355.096] -- 0:01:01
47000 -- (-357.174) [-356.738] (-354.873) (-356.405) * (-356.238) (-359.896) (-356.190) [-356.244] -- 0:01:00
47500 -- (-356.295) [-355.687] (-355.345) (-357.861) * (-360.169) [-357.604] (-355.343) (-358.052) -- 0:01:00
48000 -- (-355.840) [-355.976] (-356.309) (-356.812) * (-355.451) (-356.566) (-359.433) [-356.072] -- 0:00:59
48500 -- [-354.892] (-358.706) (-358.725) (-354.795) * [-354.984] (-355.279) (-357.840) (-357.175) -- 0:00:58
49000 -- (-357.350) (-358.723) [-354.768] (-355.892) * (-358.041) (-360.653) (-358.106) [-355.929] -- 0:00:58
49500 -- (-355.625) [-356.483] (-355.183) (-356.956) * (-359.083) (-357.524) [-354.998] (-354.732) -- 0:00:57
50000 -- (-356.720) (-359.889) [-357.578] (-357.659) * (-356.464) (-357.201) [-357.289] (-359.613) -- 0:00:57
Average standard deviation of split frequencies: 0.030850
50500 -- [-356.023] (-360.642) (-356.491) (-355.052) * (-355.934) (-357.673) [-354.962] (-355.121) -- 0:00:56
51000 -- (-356.935) (-362.346) [-354.650] (-356.745) * (-355.387) [-355.554] (-356.773) (-356.009) -- 0:00:55
51500 -- [-357.272] (-357.391) (-355.948) (-356.634) * (-357.823) (-355.938) [-356.687] (-355.650) -- 0:00:55
52000 -- (-355.561) (-356.433) (-358.360) [-354.883] * [-357.586] (-355.247) (-357.837) (-356.880) -- 0:00:54
52500 -- (-361.968) (-359.806) [-357.315] (-355.291) * (-357.059) (-356.985) [-356.544] (-356.580) -- 0:00:54
53000 -- (-354.795) (-355.768) (-357.660) [-355.980] * (-357.852) (-357.655) [-356.456] (-355.516) -- 0:00:53
53500 -- (-355.090) [-356.922] (-360.651) (-358.790) * (-356.260) (-356.401) (-361.780) [-356.425] -- 0:00:53
54000 -- (-355.697) [-356.711] (-357.850) (-359.491) * [-356.727] (-356.069) (-358.564) (-357.241) -- 0:00:52
54500 -- [-355.002] (-355.442) (-356.131) (-361.803) * (-359.914) (-356.176) [-355.969] (-357.412) -- 0:00:52
55000 -- (-357.631) (-355.178) (-356.277) [-355.006] * [-357.134] (-358.700) (-355.046) (-354.991) -- 0:00:51
Average standard deviation of split frequencies: 0.025721
55500 -- (-357.866) (-355.572) [-357.320] (-357.614) * [-355.375] (-357.908) (-356.126) (-358.558) -- 0:01:08
56000 -- (-354.812) (-356.287) [-354.293] (-355.646) * [-355.458] (-355.712) (-357.008) (-359.676) -- 0:01:07
56500 -- (-356.247) [-354.930] (-356.991) (-355.993) * [-357.647] (-355.445) (-358.443) (-354.244) -- 0:01:06
57000 -- (-355.471) (-355.891) [-355.832] (-355.746) * [-357.830] (-355.193) (-357.992) (-356.739) -- 0:01:06
57500 -- (-355.929) (-358.176) (-358.271) [-355.061] * (-354.737) (-355.282) [-359.319] (-356.194) -- 0:01:05
58000 -- (-356.127) (-359.791) (-359.807) [-354.614] * (-359.277) (-355.878) (-357.207) [-357.535] -- 0:01:04
58500 -- (-355.033) (-360.022) [-357.357] (-355.627) * [-355.815] (-354.491) (-356.356) (-355.485) -- 0:01:04
59000 -- (-359.433) [-355.669] (-355.562) (-356.845) * (-358.778) [-355.525] (-355.423) (-355.589) -- 0:01:03
59500 -- (-357.844) (-355.808) [-355.930] (-355.335) * (-355.519) [-356.236] (-356.272) (-356.316) -- 0:01:03
60000 -- (-355.380) (-358.311) [-357.754] (-355.649) * (-355.052) (-354.615) [-356.684] (-356.511) -- 0:01:02
Average standard deviation of split frequencies: 0.028491
60500 -- (-356.420) (-356.788) (-354.729) [-357.923] * (-354.107) [-356.531] (-356.074) (-358.653) -- 0:01:02
61000 -- [-356.666] (-360.273) (-361.673) (-356.267) * (-358.615) (-355.497) [-356.092] (-358.742) -- 0:01:01
61500 -- [-357.885] (-355.952) (-356.799) (-355.137) * (-358.179) (-361.316) [-356.932] (-354.728) -- 0:01:01
62000 -- [-354.768] (-355.656) (-356.601) (-359.367) * (-359.723) (-359.872) [-355.261] (-356.086) -- 0:01:00
62500 -- (-356.877) [-360.654] (-357.600) (-359.515) * (-355.658) (-360.536) [-354.973] (-354.959) -- 0:01:00
63000 -- [-358.408] (-355.680) (-358.805) (-359.757) * [-355.494] (-357.868) (-359.244) (-354.161) -- 0:00:59
63500 -- [-354.789] (-356.349) (-358.001) (-357.055) * [-354.941] (-362.849) (-360.713) (-355.504) -- 0:00:58
64000 -- (-354.714) [-356.813] (-357.555) (-357.073) * [-357.072] (-354.790) (-356.924) (-355.640) -- 0:00:58
64500 -- (-354.931) [-354.377] (-360.218) (-358.876) * (-354.048) [-354.778] (-355.202) (-354.704) -- 0:00:58
65000 -- [-354.485] (-357.614) (-361.125) (-356.847) * (-354.249) (-356.429) (-355.427) [-356.743] -- 0:00:57
Average standard deviation of split frequencies: 0.031201
65500 -- [-354.262] (-355.600) (-355.295) (-359.115) * [-355.066] (-354.932) (-356.073) (-358.662) -- 0:00:57
66000 -- (-358.558) (-355.741) [-356.315] (-362.086) * (-360.159) (-358.651) (-354.608) [-357.874] -- 0:00:56
66500 -- (-358.872) [-356.339] (-358.494) (-361.133) * (-354.950) [-354.860] (-355.451) (-360.999) -- 0:00:56
67000 -- (-357.004) [-356.837] (-357.228) (-357.942) * (-354.405) (-355.930) (-361.271) [-355.295] -- 0:00:55
67500 -- (-357.568) (-354.936) (-361.326) [-356.176] * (-354.727) (-356.469) [-356.987] (-356.568) -- 0:00:55
68000 -- (-358.225) (-357.543) [-354.843] (-354.871) * (-357.368) [-355.940] (-356.176) (-358.754) -- 0:00:54
68500 -- (-364.177) [-356.371] (-356.247) (-358.264) * [-356.989] (-355.451) (-355.932) (-355.793) -- 0:00:54
69000 -- (-360.574) (-356.854) (-357.507) [-355.145] * (-354.512) (-354.923) [-357.513] (-355.556) -- 0:00:53
69500 -- (-358.752) (-355.642) [-355.266] (-358.147) * (-356.233) (-355.257) (-360.039) [-355.819] -- 0:00:53
70000 -- [-356.327] (-356.541) (-354.246) (-354.775) * (-354.871) [-354.833] (-359.050) (-358.072) -- 0:00:53
Average standard deviation of split frequencies: 0.032652
70500 -- (-354.978) (-355.149) [-355.579] (-358.121) * (-354.534) [-358.561] (-355.206) (-355.756) -- 0:00:52
71000 -- (-354.570) (-360.475) [-354.042] (-355.439) * [-355.969] (-356.863) (-354.906) (-356.062) -- 0:00:52
71500 -- (-356.454) (-356.174) (-358.186) [-357.913] * [-357.948] (-358.322) (-355.001) (-362.529) -- 0:00:51
72000 -- (-354.579) (-354.181) [-356.497] (-358.774) * (-360.428) [-355.955] (-356.865) (-360.331) -- 0:01:04
72500 -- (-356.428) (-360.827) [-355.824] (-359.444) * (-361.088) (-358.083) [-359.367] (-355.936) -- 0:01:03
73000 -- (-355.621) [-355.710] (-354.200) (-355.358) * (-357.815) (-357.923) [-360.027] (-355.540) -- 0:01:03
73500 -- [-356.416] (-356.914) (-354.887) (-357.807) * (-356.514) (-360.850) [-357.961] (-355.761) -- 0:01:03
74000 -- [-355.304] (-357.621) (-354.309) (-356.487) * (-356.905) (-359.907) (-356.004) [-357.425] -- 0:01:02
74500 -- [-359.731] (-355.816) (-355.635) (-356.131) * (-354.972) (-355.161) [-358.661] (-356.789) -- 0:01:02
75000 -- (-359.398) [-355.458] (-356.467) (-355.553) * (-357.006) [-358.811] (-355.719) (-354.841) -- 0:01:01
Average standard deviation of split frequencies: 0.028257
75500 -- [-357.252] (-358.068) (-354.629) (-355.607) * (-356.518) [-355.668] (-358.317) (-355.904) -- 0:01:01
76000 -- [-357.352] (-358.187) (-355.052) (-357.717) * (-355.535) [-356.777] (-357.253) (-355.116) -- 0:01:00
76500 -- (-359.554) (-356.185) [-356.523] (-356.688) * (-355.476) [-355.198] (-359.795) (-359.983) -- 0:01:00
77000 -- (-356.891) (-356.914) [-354.840] (-357.773) * (-354.833) (-355.166) [-355.337] (-357.658) -- 0:00:59
77500 -- (-355.753) (-356.278) [-356.297] (-360.124) * [-355.284] (-356.824) (-356.117) (-360.252) -- 0:00:59
78000 -- (-355.267) (-359.960) [-360.726] (-356.471) * (-358.559) (-356.094) [-357.025] (-355.868) -- 0:00:59
78500 -- (-353.946) [-355.312] (-358.012) (-360.366) * (-355.350) [-357.030] (-356.409) (-355.955) -- 0:00:58
79000 -- (-357.652) (-355.402) (-355.526) [-358.550] * [-354.918] (-359.596) (-357.172) (-359.059) -- 0:00:58
79500 -- (-356.708) (-356.924) (-354.701) [-359.674] * (-355.323) (-356.530) (-355.039) [-358.105] -- 0:00:57
80000 -- (-355.340) (-355.753) [-356.233] (-356.067) * (-354.807) (-355.040) [-357.491] (-358.653) -- 0:00:57
Average standard deviation of split frequencies: 0.026947
80500 -- (-354.889) (-355.439) [-357.959] (-356.529) * (-356.229) (-355.884) [-355.400] (-355.002) -- 0:00:57
81000 -- (-355.024) (-354.750) (-355.888) [-356.806] * (-355.158) [-358.550] (-355.207) (-356.649) -- 0:00:56
81500 -- (-356.658) [-356.457] (-355.827) (-357.537) * (-354.901) (-359.687) [-355.306] (-356.065) -- 0:00:56
82000 -- (-356.053) [-356.409] (-359.711) (-355.639) * (-355.307) [-361.233] (-356.561) (-356.434) -- 0:00:55
82500 -- [-355.623] (-356.652) (-358.327) (-356.449) * (-354.465) [-363.447] (-354.643) (-354.897) -- 0:00:55
83000 -- (-358.142) (-356.343) [-355.831] (-356.528) * [-357.600] (-356.254) (-355.604) (-354.933) -- 0:00:55
83500 -- (-358.352) (-357.399) [-356.160] (-356.104) * [-354.983] (-359.544) (-354.400) (-355.631) -- 0:00:54
84000 -- (-357.690) (-359.368) (-359.962) [-354.563] * (-355.687) (-354.985) (-356.891) [-355.984] -- 0:00:54
84500 -- [-355.778] (-358.832) (-357.343) (-356.040) * (-357.353) (-355.363) [-355.290] (-356.433) -- 0:00:54
85000 -- (-357.191) (-355.420) (-363.418) [-354.862] * (-356.304) (-355.253) (-356.580) [-357.086] -- 0:00:53
Average standard deviation of split frequencies: 0.029600
85500 -- (-358.555) (-359.213) [-355.774] (-354.896) * (-357.238) (-357.469) (-355.571) [-354.681] -- 0:00:53
86000 -- (-363.073) (-355.307) (-356.369) [-354.618] * (-355.806) (-356.210) [-358.012] (-356.258) -- 0:00:53
86500 -- (-360.166) [-355.595] (-358.198) (-356.860) * [-356.740] (-358.350) (-359.520) (-355.768) -- 0:00:52
87000 -- (-356.833) [-358.415] (-355.784) (-354.870) * [-358.219] (-355.366) (-356.163) (-356.321) -- 0:00:52
87500 -- (-361.278) (-360.317) (-356.887) [-355.198] * (-363.243) [-357.117] (-355.639) (-356.203) -- 0:00:52
88000 -- (-355.769) (-358.107) (-356.577) [-357.063] * (-362.979) [-359.237] (-357.200) (-355.397) -- 0:00:51
88500 -- (-355.170) (-356.641) (-355.032) [-356.762] * (-358.080) (-355.080) (-356.687) [-357.428] -- 0:00:51
89000 -- (-356.443) (-356.253) (-354.796) [-354.403] * (-356.423) [-355.278] (-363.197) (-357.738) -- 0:00:51
89500 -- [-359.171] (-355.019) (-357.914) (-356.628) * (-355.322) (-357.818) [-357.445] (-356.558) -- 0:01:01
90000 -- (-359.974) (-356.005) (-354.899) [-355.305] * [-357.183] (-357.865) (-355.135) (-356.007) -- 0:01:00
Average standard deviation of split frequencies: 0.024355
90500 -- [-356.451] (-358.370) (-357.687) (-357.766) * (-355.471) [-356.961] (-356.733) (-358.166) -- 0:01:00
91000 -- (-361.322) (-356.205) (-355.885) [-355.617] * (-355.509) (-355.943) (-357.015) [-355.625] -- 0:00:59
91500 -- [-354.937] (-363.580) (-355.273) (-354.911) * [-356.264] (-360.512) (-355.580) (-355.635) -- 0:00:59
92000 -- (-355.868) (-356.759) [-356.389] (-356.737) * [-359.331] (-358.426) (-355.698) (-356.924) -- 0:00:59
92500 -- (-355.163) (-355.890) [-355.499] (-355.288) * (-355.236) [-355.432] (-356.840) (-356.075) -- 0:00:58
93000 -- (-360.470) [-359.361] (-355.128) (-358.051) * [-357.012] (-356.084) (-355.586) (-354.933) -- 0:00:58
93500 -- (-355.167) (-355.289) [-355.652] (-355.181) * (-355.680) (-357.375) [-355.619] (-356.180) -- 0:00:58
94000 -- (-354.818) (-356.792) (-357.437) [-355.147] * (-354.985) (-354.355) [-355.244] (-354.540) -- 0:00:57
94500 -- [-356.519] (-355.351) (-357.138) (-358.541) * (-355.679) (-354.715) [-355.834] (-357.020) -- 0:00:57
95000 -- [-355.505] (-356.555) (-362.252) (-354.798) * (-355.067) [-355.017] (-355.800) (-358.266) -- 0:00:57
Average standard deviation of split frequencies: 0.022485
95500 -- (-368.537) (-358.237) (-361.367) [-358.439] * (-355.704) [-354.174] (-359.251) (-356.488) -- 0:00:56
96000 -- (-365.098) (-358.427) (-365.415) [-357.531] * [-355.543] (-354.583) (-360.675) (-355.374) -- 0:00:56
96500 -- [-363.596] (-355.748) (-357.792) (-355.537) * (-358.504) (-360.292) (-364.023) [-354.716] -- 0:00:56
97000 -- [-354.918] (-357.717) (-358.689) (-355.452) * (-354.551) (-354.351) (-357.496) [-354.954] -- 0:00:55
97500 -- (-356.863) (-357.201) [-355.556] (-356.581) * (-356.336) (-356.367) (-355.949) [-354.974] -- 0:00:55
98000 -- (-357.620) [-356.870] (-358.049) (-355.904) * (-358.377) (-354.621) [-354.730] (-357.349) -- 0:00:55
98500 -- (-356.971) [-355.246] (-356.415) (-358.181) * (-361.285) [-356.095] (-360.889) (-357.446) -- 0:00:54
99000 -- (-355.348) [-356.264] (-356.005) (-358.498) * (-360.418) (-358.262) (-356.087) [-354.567] -- 0:00:54
99500 -- [-356.634] (-354.756) (-356.216) (-356.799) * (-358.445) (-359.527) [-355.842] (-355.298) -- 0:00:54
100000 -- [-355.696] (-356.404) (-356.900) (-355.897) * (-357.597) [-354.350] (-356.116) (-357.510) -- 0:00:54
Average standard deviation of split frequencies: 0.023414
100500 -- (-355.181) (-356.684) [-355.088] (-355.349) * (-357.784) [-355.200] (-357.923) (-356.663) -- 0:00:53
101000 -- [-355.290] (-356.960) (-354.320) (-355.232) * (-357.460) (-358.551) (-363.190) [-357.275] -- 0:00:53
101500 -- (-357.423) (-356.390) (-355.299) [-356.618] * (-360.159) (-358.362) (-359.790) [-355.495] -- 0:00:53
102000 -- [-355.241] (-357.062) (-355.152) (-357.570) * [-355.941] (-358.047) (-356.198) (-356.126) -- 0:00:52
102500 -- [-357.270] (-356.543) (-355.727) (-357.039) * (-355.980) (-358.567) [-354.475] (-357.137) -- 0:00:52
103000 -- (-355.235) [-355.819] (-357.063) (-355.920) * (-359.714) (-356.843) (-356.561) [-355.842] -- 0:00:52
103500 -- (-356.569) (-355.989) (-356.552) [-356.118] * (-356.057) (-357.555) (-356.340) [-359.172] -- 0:00:51
104000 -- (-360.004) (-356.115) (-356.707) [-356.388] * (-354.477) (-358.276) (-355.105) [-355.686] -- 0:00:51
104500 -- [-355.736] (-355.513) (-355.185) (-356.556) * (-359.456) [-357.011] (-356.534) (-356.262) -- 0:00:51
105000 -- (-360.344) (-355.067) [-355.066] (-358.562) * (-358.419) [-357.002] (-357.770) (-355.328) -- 0:00:51
Average standard deviation of split frequencies: 0.022002
105500 -- (-357.489) (-356.944) [-355.487] (-355.231) * (-355.710) [-356.262] (-359.867) (-359.256) -- 0:00:50
106000 -- [-355.153] (-356.480) (-355.535) (-354.638) * (-358.803) [-356.793] (-355.570) (-355.512) -- 0:00:59
106500 -- (-355.739) (-354.543) [-357.637] (-356.858) * [-358.512] (-359.118) (-356.159) (-356.749) -- 0:00:58
107000 -- (-357.265) (-355.772) (-357.101) [-358.530] * (-354.978) (-355.488) [-357.097] (-356.253) -- 0:00:58
107500 -- (-359.020) (-356.508) (-356.730) [-360.278] * (-354.276) [-355.372] (-355.762) (-357.208) -- 0:00:58
108000 -- (-356.143) (-357.180) (-359.157) [-357.094] * (-357.300) (-358.890) [-356.716] (-358.678) -- 0:00:57
108500 -- (-355.015) [-356.509] (-355.044) (-357.903) * (-354.695) (-355.276) (-354.862) [-355.488] -- 0:00:57
109000 -- [-355.391] (-356.424) (-358.732) (-358.165) * [-360.166] (-354.636) (-354.714) (-355.691) -- 0:00:57
109500 -- (-355.139) [-358.836] (-357.162) (-357.806) * (-358.505) (-355.183) [-354.548] (-357.970) -- 0:00:56
110000 -- [-356.353] (-356.957) (-356.279) (-356.957) * (-357.559) [-355.822] (-355.814) (-357.183) -- 0:00:56
Average standard deviation of split frequencies: 0.021523
110500 -- (-356.121) (-356.889) [-354.899] (-356.916) * (-358.641) [-355.350] (-359.458) (-356.245) -- 0:00:56
111000 -- (-355.096) [-355.424] (-355.078) (-355.811) * (-354.539) (-358.286) (-355.628) [-356.433] -- 0:00:56
111500 -- (-357.931) (-355.839) (-355.151) [-356.239] * [-356.796] (-359.024) (-355.606) (-356.142) -- 0:00:55
112000 -- (-355.363) [-357.231] (-356.833) (-358.358) * [-355.258] (-358.714) (-357.500) (-356.604) -- 0:00:55
112500 -- (-356.548) (-356.245) (-356.834) [-355.011] * [-356.373] (-356.429) (-355.498) (-357.100) -- 0:00:55
113000 -- [-354.921] (-356.329) (-358.191) (-357.487) * (-357.921) [-357.907] (-359.503) (-354.512) -- 0:00:54
113500 -- (-355.497) [-355.954] (-359.972) (-357.319) * (-356.969) (-358.652) [-355.747] (-360.373) -- 0:00:54
114000 -- (-358.241) [-355.852] (-357.641) (-355.976) * (-356.615) (-356.856) [-354.568] (-357.268) -- 0:00:54
114500 -- (-358.329) (-356.026) (-356.337) [-359.366] * (-356.067) (-356.014) [-355.251] (-356.268) -- 0:00:54
115000 -- (-357.797) (-355.710) (-355.564) [-354.592] * [-358.462] (-355.007) (-356.078) (-355.585) -- 0:00:53
Average standard deviation of split frequencies: 0.020961
115500 -- (-354.866) [-354.972] (-355.394) (-356.588) * (-359.445) [-354.936] (-359.668) (-358.080) -- 0:00:53
116000 -- [-357.134] (-355.995) (-356.717) (-358.415) * (-358.426) (-354.986) (-363.332) [-356.026] -- 0:00:53
116500 -- (-357.418) [-355.810] (-360.362) (-362.398) * (-361.929) (-357.762) (-357.861) [-356.508] -- 0:00:53
117000 -- (-361.031) (-363.917) [-357.280] (-366.604) * (-360.653) (-356.589) (-358.240) [-355.048] -- 0:00:52
117500 -- (-356.235) (-357.360) (-355.310) [-362.217] * (-356.691) (-357.906) [-356.317] (-355.697) -- 0:00:52
118000 -- (-354.761) (-357.018) [-357.490] (-356.777) * (-355.050) (-356.616) [-355.076] (-355.229) -- 0:00:52
118500 -- [-357.593] (-355.975) (-355.653) (-356.844) * (-354.692) (-354.828) (-355.128) [-355.663] -- 0:00:52
119000 -- [-357.132] (-358.985) (-355.152) (-355.556) * [-355.096] (-355.566) (-356.049) (-356.204) -- 0:00:51
119500 -- (-358.369) (-356.689) [-356.045] (-357.462) * [-355.430] (-355.050) (-355.034) (-357.470) -- 0:00:51
120000 -- (-360.311) (-355.978) (-354.943) [-356.924] * (-356.287) (-357.992) [-356.436] (-355.857) -- 0:00:51
Average standard deviation of split frequencies: 0.018711
120500 -- (-360.432) [-355.772] (-356.592) (-355.344) * (-356.751) (-355.757) [-355.298] (-354.952) -- 0:00:51
121000 -- (-357.036) (-357.005) (-357.603) [-355.341] * (-356.028) [-356.690] (-356.173) (-359.236) -- 0:00:50
121500 -- (-355.752) (-355.253) (-354.953) [-356.053] * (-354.891) [-357.716] (-361.438) (-355.630) -- 0:00:50
122000 -- (-359.389) (-354.163) (-358.867) [-356.329] * (-354.581) (-354.536) [-356.550] (-356.691) -- 0:00:50
122500 -- (-355.411) (-354.619) (-359.710) [-355.357] * (-355.091) (-360.044) [-354.105] (-355.569) -- 0:00:50
123000 -- (-357.137) [-355.270] (-357.178) (-354.125) * (-356.425) (-357.518) [-355.100] (-356.488) -- 0:00:57
123500 -- (-355.049) (-354.884) [-355.546] (-356.277) * (-355.954) (-363.811) [-354.975] (-359.656) -- 0:00:56
124000 -- [-358.951] (-356.840) (-357.041) (-355.619) * (-356.182) (-357.499) (-354.112) [-355.304] -- 0:00:56
124500 -- [-356.258] (-354.774) (-357.012) (-361.767) * (-356.753) (-359.045) (-356.754) [-356.968] -- 0:00:56
125000 -- (-357.633) (-358.207) (-357.074) [-359.869] * (-357.213) (-357.628) [-356.841] (-357.022) -- 0:00:56
Average standard deviation of split frequencies: 0.017584
125500 -- (-356.117) [-363.134] (-357.861) (-363.915) * (-356.502) (-360.420) (-357.062) [-357.457] -- 0:00:55
126000 -- [-355.418] (-354.519) (-355.570) (-356.282) * (-356.631) (-356.258) (-356.660) [-358.322] -- 0:00:55
126500 -- (-356.921) (-356.270) (-357.359) [-358.963] * [-355.711] (-359.203) (-355.971) (-356.262) -- 0:00:55
127000 -- (-357.394) [-355.184] (-355.719) (-356.305) * (-355.079) (-355.503) (-354.732) [-357.561] -- 0:00:54
127500 -- (-357.479) (-357.657) [-355.187] (-355.031) * (-356.825) [-356.785] (-355.195) (-358.183) -- 0:00:54
128000 -- [-356.409] (-354.740) (-357.305) (-356.337) * [-356.455] (-355.400) (-355.535) (-355.912) -- 0:00:54
128500 -- (-360.871) (-355.950) [-354.373] (-357.580) * (-355.794) (-355.550) (-357.410) [-354.559] -- 0:00:54
129000 -- (-357.658) [-355.791] (-359.094) (-357.614) * [-355.716] (-355.844) (-355.615) (-357.414) -- 0:00:54
129500 -- (-358.001) [-356.490] (-359.606) (-356.984) * (-356.642) (-355.782) (-355.272) [-354.564] -- 0:00:53
130000 -- (-357.727) (-368.678) (-354.817) [-354.442] * (-362.023) (-357.866) (-354.688) [-356.575] -- 0:00:53
Average standard deviation of split frequencies: 0.014972
130500 -- (-356.786) (-366.191) [-356.284] (-357.363) * (-356.444) (-360.189) [-357.025] (-354.707) -- 0:00:53
131000 -- (-357.193) (-354.938) (-355.984) [-355.764] * (-356.814) [-355.847] (-355.954) (-355.449) -- 0:00:53
131500 -- (-356.593) (-358.200) (-356.314) [-355.591] * (-358.541) [-355.044] (-355.786) (-357.400) -- 0:00:52
132000 -- (-357.014) (-355.229) (-357.383) [-356.583] * (-356.360) (-354.530) [-357.656] (-356.564) -- 0:00:52
132500 -- (-356.728) (-356.671) (-355.909) [-358.052] * (-356.522) [-354.956] (-356.827) (-359.569) -- 0:00:52
133000 -- [-360.199] (-358.327) (-356.376) (-357.941) * (-357.655) [-354.929] (-354.342) (-354.736) -- 0:00:52
133500 -- (-358.597) (-357.860) (-356.429) [-356.465] * (-354.530) (-358.202) (-354.876) [-355.118] -- 0:00:51
134000 -- [-358.269] (-357.764) (-355.830) (-354.827) * [-356.502] (-358.332) (-358.791) (-355.964) -- 0:00:51
134500 -- (-356.249) (-361.499) (-355.371) [-356.543] * (-359.958) [-358.161] (-357.828) (-355.190) -- 0:00:51
135000 -- (-355.234) (-357.935) (-361.995) [-356.748] * [-357.232] (-355.611) (-357.042) (-358.908) -- 0:00:51
Average standard deviation of split frequencies: 0.013518
135500 -- (-358.401) (-355.571) [-362.526] (-359.320) * (-359.081) [-357.000] (-357.516) (-360.068) -- 0:00:51
136000 -- [-359.002] (-356.010) (-357.985) (-355.439) * (-354.689) (-356.156) (-354.383) [-355.315] -- 0:00:50
136500 -- (-358.075) [-357.256] (-355.733) (-357.925) * [-355.983] (-355.057) (-355.337) (-356.902) -- 0:00:50
137000 -- [-356.816] (-357.513) (-359.932) (-362.556) * (-356.422) (-354.989) (-355.094) [-356.125] -- 0:00:50
137500 -- (-358.968) [-360.868] (-358.597) (-355.508) * [-354.553] (-357.856) (-355.652) (-358.986) -- 0:00:50
138000 -- [-354.895] (-357.155) (-355.772) (-356.661) * (-358.089) [-360.501] (-355.130) (-357.130) -- 0:00:49
138500 -- [-354.740] (-361.341) (-360.026) (-357.882) * (-361.435) (-356.470) [-357.061] (-355.911) -- 0:00:49
139000 -- (-357.822) [-355.884] (-355.864) (-359.646) * [-358.025] (-356.282) (-359.057) (-357.291) -- 0:00:49
139500 -- (-354.930) (-355.005) [-355.081] (-358.410) * (-357.954) [-356.262] (-357.190) (-354.934) -- 0:00:49
140000 -- (-356.636) (-355.584) [-354.817] (-356.640) * (-355.474) [-355.972] (-355.985) (-357.674) -- 0:00:55
Average standard deviation of split frequencies: 0.011227
140500 -- (-356.914) (-357.145) [-356.192] (-356.011) * (-356.976) (-356.548) (-355.274) [-355.115] -- 0:00:55
141000 -- (-356.831) [-354.726] (-359.607) (-358.861) * [-360.373] (-358.068) (-356.552) (-354.938) -- 0:00:54
141500 -- (-357.206) [-358.967] (-358.774) (-356.735) * (-359.680) (-357.536) [-354.335] (-354.990) -- 0:00:54
142000 -- (-355.658) (-354.719) [-355.295] (-354.505) * (-358.115) (-360.215) [-357.954] (-356.009) -- 0:00:54
142500 -- (-355.724) [-354.511] (-358.135) (-361.244) * [-355.657] (-357.363) (-356.723) (-356.793) -- 0:00:54
143000 -- (-356.971) (-354.845) [-354.488] (-360.316) * (-354.700) (-356.385) [-354.243] (-359.444) -- 0:00:53
143500 -- (-355.066) [-357.038] (-356.520) (-357.429) * (-355.472) (-357.316) [-356.865] (-354.852) -- 0:00:53
144000 -- (-355.469) (-355.802) (-354.370) [-354.644] * (-356.629) [-357.120] (-358.696) (-357.324) -- 0:00:53
144500 -- (-356.358) [-357.581] (-354.534) (-355.193) * (-357.142) (-356.930) [-355.160] (-355.122) -- 0:00:53
145000 -- (-356.573) (-360.322) (-356.006) [-355.438] * (-356.592) [-355.377] (-355.669) (-355.493) -- 0:00:53
Average standard deviation of split frequencies: 0.011947
145500 -- (-355.967) (-357.235) [-354.405] (-360.590) * (-355.568) (-357.079) [-354.857] (-354.910) -- 0:00:52
146000 -- (-354.807) [-356.712] (-354.762) (-357.521) * (-358.153) (-356.186) (-356.101) [-356.007] -- 0:00:52
146500 -- (-355.650) (-356.890) (-356.069) [-357.102] * (-354.286) (-354.783) (-355.148) [-356.173] -- 0:00:52
147000 -- (-357.465) [-354.136] (-356.598) (-356.815) * (-358.504) [-357.928] (-363.160) (-362.083) -- 0:00:52
147500 -- [-355.188] (-355.097) (-354.646) (-354.508) * (-359.756) (-356.685) [-360.025] (-357.031) -- 0:00:52
148000 -- (-358.226) [-354.599] (-355.137) (-354.786) * [-358.955] (-360.013) (-355.663) (-357.288) -- 0:00:51
148500 -- (-357.800) (-354.596) (-355.817) [-355.626] * (-357.403) (-357.871) (-361.843) [-355.965] -- 0:00:51
149000 -- [-357.648] (-357.120) (-355.230) (-356.354) * (-357.022) (-358.831) [-356.679] (-355.289) -- 0:00:51
149500 -- (-357.423) [-356.929] (-358.534) (-358.258) * (-356.663) [-354.224] (-354.516) (-358.625) -- 0:00:51
150000 -- (-355.340) (-354.645) (-358.309) [-361.712] * (-355.977) (-354.581) (-358.192) [-358.275] -- 0:00:51
Average standard deviation of split frequencies: 0.012845
150500 -- (-355.679) (-356.300) [-355.432] (-358.342) * (-356.296) [-355.958] (-355.333) (-355.579) -- 0:00:50
151000 -- (-354.679) [-357.275] (-355.400) (-358.831) * [-357.094] (-356.569) (-357.951) (-356.262) -- 0:00:50
151500 -- (-357.037) (-358.840) (-355.168) [-356.515] * (-356.413) (-356.658) [-355.102] (-357.400) -- 0:00:50
152000 -- (-357.560) (-356.043) (-356.261) [-355.495] * (-354.990) (-355.491) [-355.614] (-355.301) -- 0:00:50
152500 -- (-355.810) [-355.469] (-358.567) (-356.064) * (-359.242) (-363.029) [-357.903] (-356.768) -- 0:00:50
153000 -- (-358.572) (-354.688) (-355.567) [-355.830] * [-357.626] (-358.459) (-356.497) (-355.472) -- 0:00:49
153500 -- [-355.725] (-357.277) (-357.313) (-357.786) * (-359.173) (-360.051) [-357.595] (-357.053) -- 0:00:49
154000 -- (-358.163) (-356.406) [-356.210] (-356.904) * [-355.586] (-356.712) (-354.944) (-358.091) -- 0:00:49
154500 -- (-355.280) [-355.714] (-359.519) (-355.098) * [-356.695] (-361.165) (-362.425) (-357.683) -- 0:00:49
155000 -- (-358.189) [-354.645] (-361.547) (-357.170) * (-355.675) (-358.375) (-358.751) [-357.819] -- 0:00:49
Average standard deviation of split frequencies: 0.012927
155500 -- (-362.751) (-357.316) (-356.488) [-357.290] * (-356.314) (-356.638) (-357.613) [-360.331] -- 0:00:48
156000 -- (-355.099) (-355.766) (-358.118) [-357.123] * (-358.337) (-357.275) [-355.198] (-356.035) -- 0:00:48
156500 -- (-358.957) (-355.809) (-357.368) [-354.409] * (-357.592) (-356.873) [-358.010] (-359.751) -- 0:00:48
157000 -- (-355.033) [-355.207] (-355.897) (-354.950) * [-358.014] (-358.354) (-356.292) (-355.473) -- 0:00:48
157500 -- (-354.822) (-354.970) (-356.575) [-355.645] * (-356.470) (-358.672) (-355.637) [-355.083] -- 0:00:53
158000 -- (-358.046) [-360.271] (-359.081) (-356.611) * (-355.096) (-355.998) (-357.374) [-355.961] -- 0:00:53
158500 -- (-355.821) (-354.622) (-355.987) [-356.146] * (-354.221) (-354.810) (-354.453) [-356.916] -- 0:00:53
159000 -- [-355.820] (-356.435) (-355.238) (-358.318) * (-357.960) (-354.671) (-356.912) [-357.145] -- 0:00:52
159500 -- [-357.081] (-355.055) (-354.451) (-357.096) * (-358.241) (-355.796) (-360.355) [-358.166] -- 0:00:52
160000 -- [-360.486] (-354.973) (-356.418) (-356.479) * (-357.772) [-356.404] (-357.859) (-358.146) -- 0:00:52
Average standard deviation of split frequencies: 0.013280
160500 -- (-361.949) [-356.526] (-357.063) (-355.700) * (-357.653) [-356.575] (-354.729) (-356.248) -- 0:00:52
161000 -- [-356.115] (-358.581) (-357.174) (-355.872) * (-358.616) (-357.102) [-354.685] (-355.325) -- 0:00:52
161500 -- [-356.540] (-359.484) (-355.683) (-360.922) * (-357.658) (-357.285) (-356.076) [-355.201] -- 0:00:51
162000 -- (-358.031) [-355.582] (-354.352) (-356.143) * (-356.879) (-357.784) (-355.894) [-356.946] -- 0:00:51
162500 -- [-355.937] (-359.313) (-360.289) (-360.694) * [-355.070] (-358.226) (-355.340) (-355.925) -- 0:00:51
163000 -- (-355.385) [-357.792] (-355.183) (-356.504) * [-357.866] (-356.653) (-360.880) (-355.350) -- 0:00:51
163500 -- (-357.618) (-354.918) (-358.099) [-355.422] * (-355.108) [-355.277] (-356.420) (-354.691) -- 0:00:51
164000 -- (-354.357) (-354.066) [-357.556] (-355.039) * (-354.472) (-358.629) [-355.791] (-355.097) -- 0:00:50
164500 -- (-354.753) [-355.085] (-358.261) (-356.184) * [-354.806] (-357.933) (-356.221) (-357.587) -- 0:00:50
165000 -- (-357.658) [-355.548] (-360.530) (-355.799) * [-356.551] (-355.715) (-355.672) (-355.989) -- 0:00:50
Average standard deviation of split frequencies: 0.012621
165500 -- (-357.472) (-356.145) (-359.672) [-357.379] * [-354.401] (-355.408) (-356.750) (-356.973) -- 0:00:50
166000 -- (-358.149) (-356.280) (-357.361) [-354.534] * (-355.911) (-355.387) [-355.030] (-357.299) -- 0:00:50
166500 -- [-358.863] (-356.065) (-356.076) (-354.826) * [-359.443] (-356.052) (-357.416) (-356.409) -- 0:00:50
167000 -- (-356.074) (-357.757) [-357.810] (-356.062) * (-358.319) [-356.150] (-358.213) (-355.477) -- 0:00:49
167500 -- (-359.106) [-357.327] (-355.703) (-355.868) * (-355.872) (-357.427) [-356.999] (-355.138) -- 0:00:49
168000 -- (-356.935) (-354.263) [-355.681] (-357.428) * (-355.811) [-354.537] (-356.495) (-355.029) -- 0:00:49
168500 -- (-354.712) (-355.192) [-356.514] (-358.309) * (-354.938) (-358.411) [-355.619] (-357.205) -- 0:00:49
169000 -- (-356.204) (-356.903) [-357.833] (-359.979) * (-354.766) [-356.880] (-357.000) (-355.665) -- 0:00:49
169500 -- (-356.631) (-359.874) (-355.153) [-355.526] * (-358.812) (-356.177) [-355.269] (-355.760) -- 0:00:48
170000 -- (-357.629) (-355.963) [-354.597] (-356.356) * (-356.798) [-357.426] (-356.319) (-357.984) -- 0:00:48
Average standard deviation of split frequencies: 0.010724
170500 -- (-356.190) (-355.677) (-354.627) [-356.937] * (-355.627) [-356.601] (-356.093) (-362.001) -- 0:00:48
171000 -- (-355.823) (-356.220) [-355.922] (-355.976) * (-356.907) (-355.581) [-356.888] (-364.133) -- 0:00:48
171500 -- [-355.957] (-358.125) (-357.053) (-355.180) * [-355.245] (-354.877) (-357.125) (-357.466) -- 0:00:48
172000 -- [-355.404] (-358.194) (-355.058) (-356.275) * [-356.143] (-355.929) (-361.657) (-362.115) -- 0:00:48
172500 -- (-355.547) (-360.336) (-357.190) [-357.314] * (-357.079) (-357.138) (-356.717) [-355.569] -- 0:00:47
173000 -- (-355.073) (-358.181) [-356.991] (-354.832) * [-355.131] (-354.852) (-359.445) (-355.607) -- 0:00:47
173500 -- (-358.338) (-356.887) [-355.002] (-358.452) * (-356.593) (-358.481) (-358.252) [-356.059] -- 0:00:47
174000 -- (-356.199) (-357.892) (-358.552) [-355.988] * (-355.202) (-357.109) [-357.926] (-357.920) -- 0:00:47
174500 -- (-357.625) (-361.898) (-354.914) [-356.382] * [-357.215] (-359.847) (-357.180) (-356.484) -- 0:00:47
175000 -- [-355.200] (-355.328) (-354.888) (-357.173) * (-355.097) (-356.332) [-357.322] (-355.017) -- 0:00:51
Average standard deviation of split frequencies: 0.011502
175500 -- (-357.328) (-354.680) (-356.886) [-359.744] * (-355.591) (-355.959) (-358.743) [-354.324] -- 0:00:51
176000 -- (-354.809) (-361.793) [-354.050] (-355.349) * [-356.870] (-355.334) (-357.442) (-357.198) -- 0:00:51
176500 -- (-355.247) [-361.703] (-354.148) (-358.118) * [-357.807] (-355.412) (-355.179) (-358.414) -- 0:00:51
177000 -- (-357.287) (-355.358) (-359.561) [-355.327] * (-357.606) (-357.074) (-358.420) [-357.143] -- 0:00:51
177500 -- (-355.721) (-356.799) [-354.086] (-356.148) * (-360.236) [-354.880] (-354.956) (-356.163) -- 0:00:50
178000 -- (-358.041) [-355.728] (-355.791) (-358.543) * (-354.869) [-356.094] (-354.699) (-357.258) -- 0:00:50
178500 -- (-355.098) (-356.258) (-355.382) [-354.776] * (-355.323) [-354.703] (-357.570) (-357.870) -- 0:00:50
179000 -- [-358.679] (-356.966) (-354.737) (-355.823) * (-358.869) [-359.068] (-357.679) (-354.513) -- 0:00:50
179500 -- (-355.042) (-354.755) [-355.212] (-357.843) * (-355.908) (-355.294) [-355.285] (-355.968) -- 0:00:50
180000 -- [-355.702] (-354.948) (-355.242) (-357.865) * (-358.145) (-357.787) [-355.238] (-356.949) -- 0:00:50
Average standard deviation of split frequencies: 0.012125
180500 -- [-359.277] (-361.275) (-357.733) (-357.292) * (-356.583) (-361.523) (-359.544) [-356.000] -- 0:00:49
181000 -- [-357.351] (-354.624) (-356.743) (-356.785) * [-358.799] (-361.836) (-355.583) (-355.004) -- 0:00:49
181500 -- (-354.810) (-354.811) (-357.878) [-356.556] * (-357.357) (-357.716) [-355.760] (-357.581) -- 0:00:49
182000 -- (-356.478) (-356.092) [-355.426] (-359.058) * (-357.776) [-354.979] (-355.288) (-357.146) -- 0:00:49
182500 -- (-356.235) (-357.691) (-356.197) [-363.892] * (-356.673) [-356.998] (-360.076) (-354.628) -- 0:00:49
183000 -- (-357.380) [-356.350] (-356.464) (-358.128) * [-357.891] (-361.417) (-355.476) (-354.738) -- 0:00:49
183500 -- (-354.765) (-356.387) [-358.543] (-361.557) * (-355.288) [-358.145] (-354.921) (-354.836) -- 0:00:48
184000 -- (-355.430) [-356.075] (-355.224) (-355.793) * [-357.737] (-356.002) (-356.825) (-358.860) -- 0:00:48
184500 -- (-356.449) (-356.270) (-355.213) [-356.624] * (-357.258) [-355.827] (-361.177) (-354.876) -- 0:00:48
185000 -- [-356.231] (-355.026) (-357.290) (-355.854) * (-356.656) [-356.185] (-355.745) (-357.724) -- 0:00:48
Average standard deviation of split frequencies: 0.011629
185500 -- [-355.119] (-358.402) (-361.197) (-358.972) * (-365.598) [-357.459] (-357.856) (-359.321) -- 0:00:48
186000 -- [-358.143] (-356.404) (-355.967) (-357.020) * (-359.530) (-356.503) (-361.260) [-358.319] -- 0:00:48
186500 -- [-356.329] (-361.361) (-356.717) (-357.216) * [-354.559] (-354.296) (-360.327) (-357.172) -- 0:00:47
187000 -- (-355.764) (-361.107) (-357.023) [-354.539] * [-355.936] (-356.330) (-359.514) (-356.843) -- 0:00:47
187500 -- (-357.005) (-356.304) (-356.438) [-356.389] * (-357.905) (-356.898) [-356.385] (-355.265) -- 0:00:47
188000 -- [-354.791] (-356.808) (-354.649) (-354.213) * (-355.205) (-355.895) (-358.381) [-356.846] -- 0:00:47
188500 -- (-358.537) (-358.956) [-354.730] (-356.348) * [-357.493] (-357.622) (-357.342) (-355.247) -- 0:00:47
189000 -- (-359.098) (-356.205) [-355.430] (-356.842) * (-357.179) (-357.488) [-354.715] (-355.850) -- 0:00:47
189500 -- (-355.928) (-355.839) [-356.442] (-361.334) * [-355.746] (-355.993) (-356.253) (-355.103) -- 0:00:47
190000 -- (-355.132) (-356.288) [-355.393] (-359.626) * (-357.029) (-359.291) [-358.283] (-357.292) -- 0:00:46
Average standard deviation of split frequencies: 0.011635
190500 -- (-360.439) (-356.271) [-359.750] (-359.291) * (-360.420) (-363.985) [-363.091] (-356.076) -- 0:00:46
191000 -- (-355.175) (-356.665) (-359.747) [-355.785] * [-356.100] (-366.817) (-359.924) (-354.607) -- 0:00:46
191500 -- (-356.384) [-355.050] (-355.758) (-358.673) * (-357.405) (-364.868) (-355.573) [-357.865] -- 0:00:50
192000 -- (-355.107) (-354.959) (-358.172) [-354.269] * (-356.799) (-362.481) [-355.489] (-355.289) -- 0:00:50
192500 -- (-358.344) [-356.715] (-354.942) (-355.054) * (-356.342) (-356.453) (-356.958) [-359.622] -- 0:00:50
193000 -- (-360.213) (-354.361) [-354.381] (-356.861) * (-357.558) (-356.541) (-355.925) [-356.720] -- 0:00:50
193500 -- (-355.712) (-355.004) (-354.657) [-355.750] * (-357.985) (-356.249) [-356.765] (-357.331) -- 0:00:50
194000 -- (-355.957) [-356.816] (-356.574) (-356.786) * (-356.589) [-357.100] (-358.427) (-355.815) -- 0:00:49
194500 -- [-356.949] (-356.087) (-355.394) (-356.412) * [-354.810] (-360.607) (-358.506) (-356.669) -- 0:00:49
195000 -- (-356.911) [-355.778] (-356.041) (-356.437) * (-354.433) (-360.540) [-356.298] (-355.522) -- 0:00:49
Average standard deviation of split frequencies: 0.011384
195500 -- (-359.337) (-355.639) (-355.511) [-356.647] * (-355.781) [-357.980] (-356.318) (-355.451) -- 0:00:49
196000 -- (-362.015) (-355.582) (-354.731) [-356.156] * (-356.118) (-357.220) (-356.241) [-356.124] -- 0:00:49
196500 -- (-368.994) (-355.456) (-357.587) [-357.469] * [-358.599] (-354.587) (-355.657) (-355.930) -- 0:00:49
197000 -- [-355.249] (-356.757) (-357.717) (-357.114) * (-356.906) (-354.987) (-355.957) [-356.550] -- 0:00:48
197500 -- [-355.257] (-354.867) (-356.199) (-355.623) * (-361.586) [-355.362] (-355.386) (-360.686) -- 0:00:48
198000 -- (-361.929) (-356.264) (-357.357) [-358.321] * (-358.197) (-357.086) (-357.813) [-354.292] -- 0:00:48
198500 -- (-357.609) (-357.398) (-356.896) [-356.452] * (-356.386) (-360.276) [-357.132] (-357.048) -- 0:00:48
199000 -- (-356.521) [-357.681] (-357.800) (-357.250) * (-356.938) (-358.911) (-355.780) [-364.222] -- 0:00:48
199500 -- (-354.611) (-354.684) [-356.185] (-355.697) * (-356.556) [-355.488] (-355.428) (-359.971) -- 0:00:48
200000 -- (-356.840) (-357.925) [-354.420] (-356.439) * (-358.884) [-354.850] (-357.023) (-359.058) -- 0:00:48
Average standard deviation of split frequencies: 0.012774
200500 -- [-355.754] (-354.878) (-354.493) (-354.787) * (-356.652) (-356.623) (-354.913) [-355.950] -- 0:00:47
201000 -- [-354.923] (-356.785) (-354.689) (-354.743) * (-356.390) [-356.488] (-356.568) (-357.368) -- 0:00:47
201500 -- [-354.283] (-354.970) (-355.539) (-355.507) * (-354.875) [-355.972] (-358.239) (-357.502) -- 0:00:47
202000 -- [-354.464] (-356.783) (-357.503) (-359.435) * [-354.411] (-356.082) (-355.312) (-357.384) -- 0:00:47
202500 -- (-356.488) (-355.450) (-356.347) [-356.737] * (-358.947) (-357.402) [-356.927] (-361.146) -- 0:00:47
203000 -- (-356.116) [-356.062] (-356.821) (-359.612) * [-354.863] (-355.810) (-358.392) (-356.870) -- 0:00:47
203500 -- [-357.159] (-358.146) (-354.829) (-355.146) * (-357.138) [-354.849] (-355.584) (-357.292) -- 0:00:46
204000 -- (-355.808) [-359.099] (-356.218) (-360.799) * [-357.070] (-356.180) (-359.072) (-354.655) -- 0:00:46
204500 -- (-356.282) [-358.054] (-358.206) (-359.636) * (-358.024) (-358.559) (-361.318) [-354.891] -- 0:00:46
205000 -- [-355.245] (-355.837) (-356.435) (-355.217) * (-356.612) (-354.630) [-355.795] (-357.752) -- 0:00:46
Average standard deviation of split frequencies: 0.012250
205500 -- (-355.173) (-357.804) [-355.397] (-355.126) * (-356.119) [-355.050] (-356.009) (-355.506) -- 0:00:46
206000 -- (-356.768) (-358.430) (-357.450) [-355.032] * (-355.130) (-356.287) (-354.969) [-354.872] -- 0:00:46
206500 -- (-357.338) [-354.866] (-355.363) (-357.695) * (-358.565) [-357.875] (-360.101) (-355.181) -- 0:00:46
207000 -- (-361.352) (-356.685) [-355.091] (-360.081) * (-361.336) (-355.438) [-357.957] (-354.964) -- 0:00:45
207500 -- (-355.972) (-355.431) [-355.520] (-358.226) * (-354.917) (-354.460) (-359.263) [-356.927] -- 0:00:45
208000 -- (-356.286) (-359.468) (-358.801) [-358.543] * (-359.275) [-354.890] (-356.556) (-357.328) -- 0:00:45
208500 -- (-357.686) [-354.589] (-356.574) (-357.506) * (-358.976) [-360.277] (-357.418) (-358.867) -- 0:00:49
209000 -- [-359.939] (-354.709) (-359.160) (-355.832) * (-356.937) (-357.628) [-356.738] (-354.914) -- 0:00:49
209500 -- (-355.356) [-354.849] (-354.663) (-359.299) * (-357.452) [-355.653] (-357.451) (-354.772) -- 0:00:49
210000 -- [-356.512] (-354.504) (-356.993) (-356.925) * (-356.905) [-354.579] (-357.541) (-357.081) -- 0:00:48
Average standard deviation of split frequencies: 0.014296
210500 -- [-357.840] (-355.818) (-357.442) (-357.156) * (-356.798) (-355.098) [-357.045] (-355.208) -- 0:00:48
211000 -- (-357.935) (-354.847) [-355.516] (-355.704) * [-354.502] (-357.374) (-356.677) (-360.093) -- 0:00:48
211500 -- (-357.053) (-357.149) [-354.459] (-354.938) * [-356.095] (-357.337) (-355.980) (-355.909) -- 0:00:48
212000 -- (-358.345) [-354.902] (-355.623) (-357.651) * (-355.284) [-356.852] (-356.211) (-360.037) -- 0:00:48
212500 -- (-356.793) (-354.489) [-357.591] (-357.713) * (-355.813) (-357.017) (-358.458) [-357.163] -- 0:00:48
213000 -- (-355.521) (-354.710) [-359.457] (-357.109) * [-357.386] (-356.321) (-357.480) (-355.820) -- 0:00:48
213500 -- [-355.438] (-355.804) (-361.109) (-358.543) * (-355.774) [-354.782] (-357.251) (-358.526) -- 0:00:47
214000 -- (-354.071) [-355.473] (-361.622) (-354.908) * [-356.776] (-355.574) (-356.495) (-356.327) -- 0:00:47
214500 -- (-354.534) (-356.712) (-357.464) [-356.446] * (-355.964) (-359.510) [-356.397] (-356.417) -- 0:00:47
215000 -- (-355.457) (-357.463) [-356.342] (-357.903) * [-358.336] (-356.174) (-359.367) (-356.887) -- 0:00:47
Average standard deviation of split frequencies: 0.015791
215500 -- [-359.489] (-355.366) (-356.925) (-359.041) * (-355.314) [-357.427] (-355.582) (-355.486) -- 0:00:47
216000 -- (-356.724) [-354.925] (-354.916) (-358.313) * (-362.449) [-355.419] (-355.842) (-356.099) -- 0:00:47
216500 -- (-354.574) (-355.636) [-355.084] (-355.681) * (-357.782) [-360.263] (-360.266) (-363.857) -- 0:00:47
217000 -- (-358.365) [-357.473] (-357.513) (-356.727) * (-355.582) (-357.879) [-355.825] (-357.658) -- 0:00:46
217500 -- (-354.688) (-355.634) [-355.260] (-355.551) * [-355.897] (-360.517) (-354.834) (-354.237) -- 0:00:46
218000 -- (-354.639) [-354.265] (-357.122) (-355.977) * [-356.172] (-360.385) (-356.517) (-356.329) -- 0:00:46
218500 -- [-356.013] (-354.363) (-357.281) (-358.249) * (-357.310) [-357.490] (-360.202) (-357.836) -- 0:00:46
219000 -- (-354.742) [-356.001] (-356.501) (-356.992) * (-355.631) [-354.681] (-358.797) (-355.012) -- 0:00:46
219500 -- [-357.379] (-356.573) (-355.206) (-357.166) * (-359.494) (-355.855) (-354.950) [-354.896] -- 0:00:46
220000 -- (-356.795) (-355.616) (-356.547) [-354.560] * (-358.434) [-356.363] (-355.835) (-358.560) -- 0:00:46
Average standard deviation of split frequencies: 0.014954
220500 -- (-358.160) [-355.706] (-355.552) (-357.574) * (-357.777) (-355.633) [-361.831] (-361.717) -- 0:00:45
221000 -- (-358.770) [-356.529] (-356.699) (-356.661) * [-355.661] (-356.217) (-356.487) (-355.925) -- 0:00:45
221500 -- (-357.076) (-354.878) (-359.181) [-356.311] * (-354.495) (-356.253) [-354.843] (-355.963) -- 0:00:45
222000 -- (-354.551) [-357.268] (-355.697) (-358.965) * (-356.544) [-356.954] (-356.981) (-359.553) -- 0:00:45
222500 -- (-354.470) (-357.831) (-354.475) [-354.698] * (-355.801) (-356.338) (-356.095) [-355.163] -- 0:00:45
223000 -- (-357.364) [-359.198] (-355.798) (-355.280) * [-360.227] (-355.989) (-354.889) (-355.685) -- 0:00:45
223500 -- [-355.980] (-356.957) (-356.755) (-356.557) * [-359.114] (-355.688) (-355.417) (-356.119) -- 0:00:45
224000 -- (-362.972) (-356.286) [-356.341] (-356.766) * (-355.361) (-355.780) (-355.771) [-355.278] -- 0:00:45
224500 -- (-356.289) (-357.152) [-357.432] (-359.910) * [-354.331] (-356.264) (-355.666) (-356.362) -- 0:00:44
225000 -- (-358.260) (-357.171) (-357.246) [-363.393] * [-355.628] (-356.212) (-354.871) (-358.366) -- 0:00:44
Average standard deviation of split frequencies: 0.014110
225500 -- (-357.735) (-364.500) [-358.002] (-355.422) * (-357.242) (-358.300) [-361.272] (-355.796) -- 0:00:44
226000 -- [-357.976] (-357.494) (-360.204) (-359.229) * (-357.614) (-358.428) [-356.441] (-356.245) -- 0:00:44
226500 -- (-355.925) [-354.617] (-359.202) (-356.152) * (-354.504) (-355.052) (-357.520) [-360.592] -- 0:00:47
227000 -- (-357.680) (-354.663) (-358.071) [-355.743] * [-356.539] (-354.386) (-355.727) (-355.253) -- 0:00:47
227500 -- (-356.290) [-356.976] (-361.566) (-354.174) * (-356.376) [-354.325] (-355.849) (-357.310) -- 0:00:47
228000 -- (-354.551) (-357.313) (-364.355) [-354.407] * (-355.711) (-355.721) [-358.104] (-357.408) -- 0:00:47
228500 -- (-354.355) [-356.346] (-361.520) (-357.377) * (-354.895) (-355.533) [-357.629] (-358.258) -- 0:00:47
229000 -- [-355.454] (-359.935) (-357.666) (-356.769) * (-356.900) [-356.007] (-358.784) (-355.990) -- 0:00:47
229500 -- (-356.205) (-356.071) (-355.904) [-355.128] * (-358.236) (-356.437) [-358.467] (-355.777) -- 0:00:47
230000 -- (-356.544) (-357.100) (-356.597) [-356.415] * (-355.588) (-356.746) (-358.004) [-356.036] -- 0:00:46
Average standard deviation of split frequencies: 0.013539
230500 -- (-357.021) [-357.982] (-357.230) (-356.190) * (-358.119) (-355.689) (-359.973) [-354.265] -- 0:00:46
231000 -- [-356.290] (-355.790) (-359.093) (-356.390) * (-355.793) (-356.172) (-358.734) [-355.138] -- 0:00:46
231500 -- (-364.056) [-354.565] (-358.522) (-356.716) * (-356.166) (-355.367) [-355.852] (-356.379) -- 0:00:46
232000 -- [-356.891] (-355.004) (-356.309) (-359.274) * [-354.453] (-359.372) (-357.838) (-356.759) -- 0:00:46
232500 -- [-358.817] (-362.018) (-356.398) (-355.165) * [-358.012] (-356.427) (-358.792) (-355.730) -- 0:00:46
233000 -- (-361.038) (-357.991) (-357.401) [-355.484] * (-355.766) (-358.038) (-362.806) [-355.098] -- 0:00:46
233500 -- (-356.171) (-358.056) (-356.763) [-355.648] * [-357.433] (-356.687) (-357.110) (-355.134) -- 0:00:45
234000 -- (-356.178) [-355.607] (-356.956) (-356.284) * (-357.782) [-355.749] (-356.299) (-356.463) -- 0:00:45
234500 -- (-358.573) [-356.558] (-354.885) (-358.210) * (-358.151) (-355.804) [-355.970] (-357.067) -- 0:00:45
235000 -- (-363.483) (-354.889) [-355.767] (-355.930) * (-355.769) (-357.801) (-354.585) [-355.888] -- 0:00:45
Average standard deviation of split frequencies: 0.014731
235500 -- (-357.214) (-357.968) (-368.994) [-356.446] * (-357.285) (-354.968) (-355.617) [-354.886] -- 0:00:45
236000 -- [-354.683] (-358.728) (-355.359) (-355.057) * (-357.599) (-355.759) (-355.310) [-354.794] -- 0:00:45
236500 -- (-360.009) (-354.443) [-356.696] (-356.901) * (-355.678) (-354.746) [-355.482] (-357.455) -- 0:00:45
237000 -- (-359.619) (-355.248) [-357.487] (-357.197) * (-355.549) [-354.200] (-360.061) (-354.438) -- 0:00:45
237500 -- (-354.188) (-356.536) [-357.186] (-355.267) * (-359.934) (-356.605) (-357.122) [-357.446] -- 0:00:44
238000 -- (-356.683) (-355.580) [-355.532] (-355.483) * (-360.043) [-356.490] (-357.198) (-358.357) -- 0:00:44
238500 -- (-356.470) [-356.251] (-355.504) (-355.663) * (-356.077) (-356.068) (-357.067) [-356.038] -- 0:00:44
239000 -- (-356.275) (-357.289) [-356.747] (-355.616) * (-356.280) [-355.605] (-357.273) (-354.915) -- 0:00:44
239500 -- (-355.389) [-357.866] (-356.752) (-357.725) * [-355.175] (-357.911) (-354.987) (-356.171) -- 0:00:44
240000 -- (-355.171) (-359.907) (-356.298) [-358.267] * (-356.332) (-359.753) (-354.297) [-355.633] -- 0:00:44
Average standard deviation of split frequencies: 0.013344
240500 -- (-354.570) [-359.424] (-355.310) (-358.897) * (-355.483) [-357.785] (-355.527) (-355.424) -- 0:00:44
241000 -- [-355.295] (-354.337) (-356.630) (-357.459) * [-355.122] (-356.893) (-355.806) (-358.543) -- 0:00:44
241500 -- (-355.357) (-357.209) (-357.702) [-358.753] * (-356.471) [-355.105] (-354.967) (-357.183) -- 0:00:43
242000 -- [-356.196] (-355.835) (-358.869) (-357.404) * (-355.124) [-356.742] (-357.777) (-355.874) -- 0:00:43
242500 -- (-359.677) (-354.947) [-357.789] (-360.455) * [-355.460] (-359.183) (-357.146) (-354.466) -- 0:00:43
243000 -- (-357.892) (-355.594) [-355.860] (-358.871) * (-354.609) (-355.390) [-354.263] (-355.114) -- 0:00:43
243500 -- (-356.606) (-355.727) [-355.174] (-359.564) * (-358.939) (-355.054) (-356.310) [-356.874] -- 0:00:46
244000 -- (-355.130) [-354.893] (-356.679) (-355.489) * (-355.407) (-355.883) [-354.516] (-355.237) -- 0:00:46
244500 -- (-356.152) (-355.969) (-355.750) [-356.186] * (-363.957) (-356.592) [-356.769] (-357.066) -- 0:00:46
245000 -- [-357.346] (-357.909) (-355.300) (-357.860) * (-360.682) [-355.500] (-355.377) (-355.057) -- 0:00:46
Average standard deviation of split frequencies: 0.014252
245500 -- [-355.013] (-359.904) (-357.707) (-356.442) * (-358.020) (-364.531) (-355.065) [-357.941] -- 0:00:46
246000 -- (-357.414) (-356.070) [-355.244] (-355.921) * (-355.730) (-361.109) (-357.362) [-356.929] -- 0:00:45
246500 -- (-359.460) (-359.766) [-354.835] (-355.767) * (-357.661) (-360.751) (-362.070) [-356.939] -- 0:00:45
247000 -- (-361.285) (-360.078) (-356.223) [-357.566] * (-355.937) (-354.861) [-358.551] (-358.525) -- 0:00:45
247500 -- (-354.678) (-355.436) [-355.756] (-354.874) * (-361.976) (-355.167) (-355.850) [-358.139] -- 0:00:45
248000 -- [-354.296] (-356.660) (-357.344) (-355.509) * (-357.158) (-355.261) (-356.209) [-354.750] -- 0:00:45
248500 -- (-355.937) [-355.221] (-357.149) (-354.698) * (-363.340) (-360.195) [-355.894] (-354.880) -- 0:00:45
249000 -- [-356.882] (-356.728) (-354.806) (-357.677) * [-356.730] (-358.258) (-357.218) (-355.354) -- 0:00:45
249500 -- (-361.241) (-357.641) (-355.242) [-357.005] * (-358.055) (-355.854) [-356.963] (-356.726) -- 0:00:45
250000 -- [-363.799] (-354.933) (-360.674) (-355.310) * (-354.651) [-356.443] (-354.947) (-356.086) -- 0:00:45
Average standard deviation of split frequencies: 0.014340
250500 -- (-355.392) (-355.565) (-358.280) [-358.678] * [-355.764] (-356.491) (-354.520) (-359.452) -- 0:00:44
251000 -- [-358.437] (-360.482) (-357.676) (-357.644) * (-356.664) [-355.097] (-354.367) (-356.340) -- 0:00:44
251500 -- (-359.792) (-355.831) (-354.845) [-356.817] * [-358.792] (-356.912) (-355.781) (-354.175) -- 0:00:44
252000 -- (-361.318) (-356.467) [-356.383] (-357.291) * (-354.960) [-357.697] (-358.503) (-354.708) -- 0:00:44
252500 -- (-358.068) (-355.607) [-356.848] (-362.193) * [-356.637] (-363.203) (-354.839) (-358.881) -- 0:00:44
253000 -- [-356.677] (-356.454) (-355.383) (-359.495) * [-355.705] (-356.572) (-354.360) (-360.830) -- 0:00:44
253500 -- (-355.900) (-358.258) (-354.950) [-358.641] * (-355.432) [-355.498] (-354.522) (-356.325) -- 0:00:44
254000 -- [-355.324] (-358.540) (-357.653) (-357.677) * (-357.850) (-355.963) [-358.276] (-357.593) -- 0:00:44
254500 -- (-359.243) [-355.442] (-355.395) (-362.349) * [-358.737] (-356.771) (-359.525) (-355.855) -- 0:00:43
255000 -- [-357.452] (-355.080) (-362.118) (-358.037) * (-360.834) (-354.376) (-361.256) [-357.702] -- 0:00:43
Average standard deviation of split frequencies: 0.012890
255500 -- [-354.690] (-356.926) (-360.228) (-363.014) * (-359.828) [-357.692] (-355.772) (-355.791) -- 0:00:43
256000 -- (-354.794) (-356.750) [-354.829] (-357.528) * (-358.303) [-355.630] (-358.545) (-358.193) -- 0:00:43
256500 -- [-356.233] (-354.824) (-357.035) (-356.853) * (-356.932) (-355.319) [-361.542] (-355.193) -- 0:00:43
257000 -- (-356.815) (-355.124) (-358.532) [-355.568] * (-357.441) [-357.188] (-356.171) (-354.450) -- 0:00:43
257500 -- (-358.787) (-355.572) (-356.804) [-356.972] * (-355.260) [-355.303] (-355.455) (-355.185) -- 0:00:43
258000 -- (-354.926) (-356.562) [-355.347] (-355.780) * [-355.726] (-358.535) (-355.418) (-355.133) -- 0:00:43
258500 -- [-356.107] (-354.954) (-357.158) (-356.709) * (-356.867) (-354.668) (-354.770) [-357.917] -- 0:00:43
259000 -- (-356.727) [-357.044] (-355.033) (-365.662) * [-356.974] (-356.259) (-358.922) (-355.735) -- 0:00:42
259500 -- [-354.366] (-356.412) (-357.578) (-359.820) * (-356.903) [-356.058] (-355.688) (-355.506) -- 0:00:42
260000 -- [-357.898] (-356.259) (-355.478) (-361.413) * (-357.884) [-358.443] (-356.111) (-356.526) -- 0:00:42
Average standard deviation of split frequencies: 0.010964
260500 -- (-359.844) (-358.000) [-355.370] (-358.358) * [-356.734] (-359.588) (-356.833) (-355.015) -- 0:00:42
261000 -- (-357.076) (-356.330) (-356.710) [-357.334] * (-358.695) (-355.741) (-359.374) [-354.947] -- 0:00:45
261500 -- (-358.331) (-355.380) (-356.934) [-357.278] * (-355.294) (-356.302) (-355.152) [-358.585] -- 0:00:45
262000 -- [-357.796] (-354.458) (-357.112) (-355.153) * (-358.013) (-357.028) [-354.720] (-355.590) -- 0:00:45
262500 -- (-360.075) (-358.497) (-354.374) [-355.037] * (-356.593) [-354.671] (-355.091) (-357.705) -- 0:00:44
263000 -- (-362.170) [-357.080] (-355.812) (-354.795) * (-356.270) [-355.296] (-358.897) (-356.087) -- 0:00:44
263500 -- (-358.114) (-357.860) (-355.249) [-354.716] * (-356.919) [-356.483] (-357.986) (-358.587) -- 0:00:44
264000 -- (-359.205) (-355.194) [-357.521] (-358.123) * (-356.518) (-355.879) [-354.581] (-357.503) -- 0:00:44
264500 -- (-359.625) (-356.942) [-355.677] (-357.826) * (-356.112) [-356.065] (-354.758) (-355.952) -- 0:00:44
265000 -- (-359.473) (-355.288) [-355.342] (-356.111) * (-358.807) (-359.388) [-356.116] (-354.563) -- 0:00:44
Average standard deviation of split frequencies: 0.011741
265500 -- (-356.585) (-360.182) (-356.708) [-355.048] * (-356.466) (-355.805) [-355.755] (-356.123) -- 0:00:44
266000 -- (-358.590) (-356.555) [-354.711] (-354.182) * (-355.458) (-356.627) (-361.158) [-355.752] -- 0:00:44
266500 -- (-357.097) [-356.072] (-356.149) (-357.324) * (-356.630) (-356.245) [-357.634] (-360.327) -- 0:00:44
267000 -- [-355.222] (-356.915) (-359.830) (-358.848) * (-357.992) (-354.357) (-359.855) [-354.955] -- 0:00:43
267500 -- (-361.826) (-354.424) (-357.580) [-359.743] * (-354.590) (-355.285) (-357.346) [-357.243] -- 0:00:43
268000 -- (-357.999) [-355.665] (-356.046) (-355.439) * (-356.865) (-356.637) (-358.942) [-356.997] -- 0:00:43
268500 -- [-357.984] (-355.922) (-359.968) (-355.584) * (-355.681) (-359.552) [-356.362] (-358.474) -- 0:00:43
269000 -- (-359.758) [-356.650] (-356.792) (-355.981) * (-357.868) (-363.538) (-359.539) [-358.002] -- 0:00:43
269500 -- (-355.815) [-355.167] (-360.981) (-354.766) * [-355.090] (-358.710) (-355.606) (-358.990) -- 0:00:43
270000 -- (-356.254) [-356.885] (-358.115) (-356.874) * (-355.618) (-358.910) (-357.743) [-355.556] -- 0:00:43
Average standard deviation of split frequencies: 0.011756
270500 -- [-356.182] (-354.740) (-356.687) (-356.246) * (-356.353) (-358.598) [-356.796] (-355.305) -- 0:00:43
271000 -- (-354.922) (-359.197) [-356.616] (-355.635) * [-355.429] (-356.951) (-355.829) (-358.009) -- 0:00:43
271500 -- [-357.804] (-359.165) (-355.113) (-357.903) * [-355.442] (-354.777) (-355.118) (-357.749) -- 0:00:42
272000 -- [-355.205] (-357.394) (-359.157) (-355.834) * (-357.484) (-355.718) [-354.876] (-357.718) -- 0:00:42
272500 -- (-355.845) (-359.725) [-359.107] (-355.610) * [-357.489] (-356.283) (-356.899) (-356.185) -- 0:00:42
273000 -- (-356.366) (-358.021) (-356.814) [-355.210] * (-356.560) (-354.214) [-355.880] (-357.044) -- 0:00:42
273500 -- [-355.491] (-357.607) (-356.765) (-354.660) * (-355.477) (-355.492) (-359.350) [-356.337] -- 0:00:42
274000 -- (-354.788) (-357.798) (-355.438) [-362.548] * (-358.077) (-354.905) [-356.949] (-354.871) -- 0:00:42
274500 -- (-354.849) (-359.773) [-356.095] (-359.031) * (-358.709) (-356.662) [-355.176] (-357.218) -- 0:00:42
275000 -- [-355.006] (-354.485) (-357.655) (-354.793) * (-360.770) (-358.695) [-355.773] (-355.121) -- 0:00:42
Average standard deviation of split frequencies: 0.011209
275500 -- [-356.993] (-355.595) (-356.430) (-356.294) * [-357.578] (-358.584) (-355.011) (-358.018) -- 0:00:42
276000 -- (-358.108) [-356.710] (-356.794) (-357.567) * (-356.685) (-358.531) [-356.057] (-357.920) -- 0:00:41
276500 -- [-357.765] (-355.774) (-357.164) (-359.758) * (-356.362) (-356.569) [-356.817] (-355.943) -- 0:00:41
277000 -- (-354.811) (-357.586) [-354.705] (-356.442) * [-356.113] (-356.711) (-357.431) (-357.073) -- 0:00:41
277500 -- (-356.053) (-356.440) [-354.262] (-357.363) * (-362.114) (-355.155) [-357.092] (-357.131) -- 0:00:41
278000 -- (-355.730) (-354.862) [-356.156] (-354.643) * (-357.557) [-360.489] (-354.879) (-358.228) -- 0:00:44
278500 -- (-356.338) (-356.443) (-355.237) [-358.836] * (-356.708) [-356.913] (-355.319) (-356.480) -- 0:00:44
279000 -- (-357.696) (-356.361) (-357.167) [-356.103] * (-359.540) (-355.582) (-355.522) [-356.008] -- 0:00:43
279500 -- (-361.590) (-357.199) [-355.631] (-357.971) * (-356.222) (-361.253) [-358.464] (-355.759) -- 0:00:43
280000 -- (-359.743) (-356.867) (-355.173) [-356.901] * (-355.924) (-354.593) [-362.031] (-355.925) -- 0:00:43
Average standard deviation of split frequencies: 0.010707
280500 -- (-357.526) (-355.269) (-356.017) [-356.708] * (-356.426) (-354.811) (-359.701) [-356.689] -- 0:00:43
281000 -- [-355.896] (-355.619) (-357.160) (-360.501) * (-356.413) [-355.474] (-360.114) (-354.622) -- 0:00:43
281500 -- (-359.166) [-355.130] (-357.722) (-356.802) * (-357.106) [-356.708] (-363.111) (-358.611) -- 0:00:43
282000 -- [-355.362] (-358.275) (-357.583) (-357.290) * (-357.724) (-357.328) (-357.798) [-356.614] -- 0:00:43
282500 -- (-357.231) (-358.478) [-357.032] (-356.993) * [-357.369] (-355.841) (-358.304) (-356.834) -- 0:00:43
283000 -- (-355.012) [-356.715] (-356.821) (-356.770) * (-354.872) [-355.098] (-355.302) (-356.085) -- 0:00:43
283500 -- (-357.981) (-355.080) [-356.744] (-362.891) * [-356.501] (-357.702) (-355.765) (-357.612) -- 0:00:42
284000 -- (-357.030) (-359.055) (-356.057) [-355.495] * (-354.104) (-360.097) (-356.677) [-356.131] -- 0:00:42
284500 -- (-356.812) (-354.764) [-355.418] (-358.352) * (-356.261) (-356.279) (-356.092) [-359.632] -- 0:00:42
285000 -- (-356.115) (-355.555) [-355.924] (-354.756) * [-357.625] (-357.252) (-358.077) (-356.865) -- 0:00:42
Average standard deviation of split frequencies: 0.009890
285500 -- (-358.264) [-356.604] (-357.985) (-354.864) * (-357.737) [-356.363] (-358.811) (-359.249) -- 0:00:42
286000 -- [-356.410] (-355.548) (-356.470) (-354.309) * [-362.266] (-356.347) (-358.929) (-356.964) -- 0:00:42
286500 -- (-356.114) [-356.228] (-354.595) (-358.467) * [-358.325] (-358.161) (-361.020) (-356.443) -- 0:00:42
287000 -- (-361.589) (-355.259) [-356.419] (-355.459) * (-355.167) (-359.261) (-356.720) [-357.473] -- 0:00:42
287500 -- (-358.627) (-356.568) (-355.843) [-355.258] * (-358.272) [-359.800] (-355.979) (-361.201) -- 0:00:42
288000 -- (-357.738) [-356.585] (-356.156) (-357.004) * (-356.117) [-355.605] (-358.394) (-356.224) -- 0:00:42
288500 -- (-356.549) [-356.072] (-360.484) (-358.703) * (-355.685) (-356.025) (-354.791) [-354.533] -- 0:00:41
289000 -- (-354.976) [-355.954] (-355.627) (-355.118) * (-355.256) (-358.151) (-360.010) [-354.674] -- 0:00:41
289500 -- [-356.955] (-358.135) (-355.775) (-355.331) * (-356.868) [-356.434] (-355.002) (-354.755) -- 0:00:41
290000 -- [-357.119] (-357.625) (-357.068) (-355.934) * (-356.370) (-354.954) (-355.824) [-354.647] -- 0:00:41
Average standard deviation of split frequencies: 0.010542
290500 -- (-357.511) (-358.754) (-358.039) [-358.241] * (-358.289) [-355.407] (-355.228) (-360.878) -- 0:00:41
291000 -- (-356.530) (-356.427) (-355.537) [-356.650] * [-356.170] (-359.161) (-356.254) (-358.846) -- 0:00:41
291500 -- (-357.295) (-354.902) [-356.545] (-356.699) * [-354.441] (-356.972) (-354.750) (-355.846) -- 0:00:41
292000 -- (-355.836) (-358.097) (-356.755) [-354.959] * [-355.125] (-359.007) (-355.582) (-356.226) -- 0:00:41
292500 -- [-357.566] (-359.394) (-359.085) (-355.654) * (-356.610) (-364.483) [-355.890] (-357.579) -- 0:00:41
293000 -- (-355.507) [-355.526] (-358.923) (-355.872) * (-357.765) (-355.292) (-355.258) [-356.913] -- 0:00:41
293500 -- (-357.527) (-355.034) (-356.073) [-358.872] * [-356.007] (-357.095) (-356.840) (-355.786) -- 0:00:40
294000 -- [-357.088] (-355.874) (-355.575) (-356.001) * (-356.511) (-357.536) [-362.355] (-357.123) -- 0:00:40
294500 -- [-356.637] (-357.100) (-354.440) (-356.952) * (-359.005) (-357.840) [-355.836] (-356.143) -- 0:00:40
295000 -- (-354.288) (-358.870) [-356.052] (-356.839) * (-357.550) [-358.071] (-355.916) (-359.468) -- 0:00:40
Average standard deviation of split frequencies: 0.010949
295500 -- [-354.632] (-356.019) (-357.893) (-355.368) * (-354.784) (-357.864) [-358.271] (-357.238) -- 0:00:42
296000 -- [-354.795] (-355.816) (-357.308) (-357.172) * (-357.375) (-356.838) (-355.529) [-361.928] -- 0:00:42
296500 -- [-355.122] (-355.582) (-364.151) (-360.119) * (-358.387) [-355.371] (-355.142) (-357.922) -- 0:00:42
297000 -- (-356.675) [-355.662] (-356.520) (-357.417) * (-355.287) [-356.410] (-356.814) (-355.846) -- 0:00:42
297500 -- (-356.512) [-355.852] (-355.973) (-364.786) * [-355.619] (-355.072) (-356.680) (-355.535) -- 0:00:42
298000 -- (-354.122) (-356.930) (-356.480) [-357.374] * [-357.461] (-354.110) (-358.071) (-355.460) -- 0:00:42
298500 -- (-354.796) (-356.269) (-357.198) [-357.215] * [-356.603] (-357.392) (-356.925) (-355.953) -- 0:00:42
299000 -- (-358.769) [-356.110] (-360.403) (-356.742) * (-355.052) (-355.209) (-354.475) [-357.203] -- 0:00:42
299500 -- [-356.014] (-356.245) (-356.670) (-354.453) * (-355.796) (-357.105) (-355.990) [-358.788] -- 0:00:42
300000 -- [-356.828] (-356.297) (-355.314) (-354.846) * (-354.752) (-354.353) (-356.495) [-356.073] -- 0:00:42
Average standard deviation of split frequencies: 0.012249
300500 -- (-359.877) (-354.557) [-355.995] (-355.027) * (-357.690) (-355.139) (-360.551) [-354.178] -- 0:00:41
301000 -- (-356.390) (-354.612) (-358.687) [-355.671] * (-357.032) [-354.142] (-355.463) (-354.432) -- 0:00:41
301500 -- (-354.309) (-356.599) [-356.553] (-356.207) * (-354.932) [-354.099] (-357.682) (-355.677) -- 0:00:41
302000 -- [-354.422] (-354.978) (-357.543) (-356.207) * (-355.319) (-356.786) (-357.725) [-355.832] -- 0:00:41
302500 -- (-355.266) (-358.713) [-357.930] (-356.335) * [-355.085] (-357.646) (-358.492) (-354.777) -- 0:00:41
303000 -- (-356.765) [-359.637] (-355.393) (-358.549) * (-354.360) [-355.747] (-357.958) (-355.427) -- 0:00:41
303500 -- (-355.427) [-356.510] (-358.677) (-357.066) * [-354.718] (-358.014) (-355.553) (-358.100) -- 0:00:41
304000 -- (-355.305) (-360.621) (-355.402) [-354.575] * (-355.057) [-356.048] (-356.078) (-357.000) -- 0:00:41
304500 -- (-356.938) (-357.125) (-357.328) [-354.173] * (-355.950) (-356.862) [-355.694] (-357.116) -- 0:00:41
305000 -- (-357.728) (-355.262) [-354.951] (-357.402) * [-354.801] (-358.396) (-354.962) (-356.106) -- 0:00:41
Average standard deviation of split frequencies: 0.012517
305500 -- [-358.675] (-354.733) (-357.611) (-355.236) * [-355.501] (-356.760) (-354.864) (-357.631) -- 0:00:40
306000 -- (-359.834) [-356.002] (-357.327) (-355.116) * (-354.815) [-355.449] (-355.513) (-358.296) -- 0:00:40
306500 -- [-358.701] (-356.377) (-356.396) (-364.060) * [-356.212] (-360.351) (-359.131) (-359.516) -- 0:00:40
307000 -- [-355.041] (-355.160) (-357.250) (-355.490) * (-356.994) (-357.995) (-358.012) [-356.566] -- 0:00:40
307500 -- (-358.989) (-357.932) [-357.360] (-357.427) * (-355.049) (-355.553) [-356.589] (-356.582) -- 0:00:40
308000 -- [-357.528] (-362.856) (-357.929) (-356.236) * (-358.929) (-355.383) [-358.879] (-356.533) -- 0:00:40
308500 -- (-357.417) (-361.804) (-356.885) [-357.078] * (-355.849) (-356.663) (-359.081) [-354.672] -- 0:00:40
309000 -- (-355.023) [-356.787] (-356.839) (-356.612) * (-354.931) [-356.943] (-362.958) (-359.603) -- 0:00:40
309500 -- (-355.429) (-356.646) [-355.841] (-357.851) * [-354.773] (-357.042) (-354.733) (-357.516) -- 0:00:40
310000 -- (-356.416) (-357.951) [-355.448] (-356.964) * (-355.623) (-360.565) (-355.012) [-356.316] -- 0:00:40
Average standard deviation of split frequencies: 0.012519
310500 -- (-354.680) [-354.763] (-354.643) (-355.957) * (-355.347) (-358.592) (-359.401) [-360.987] -- 0:00:39
311000 -- (-358.005) [-355.725] (-355.991) (-354.791) * [-356.373] (-357.523) (-358.832) (-359.100) -- 0:00:39
311500 -- [-358.131] (-357.866) (-355.236) (-356.816) * (-356.268) (-356.136) (-354.579) [-355.839] -- 0:00:39
312000 -- (-360.374) (-362.596) (-355.542) [-354.353] * (-359.107) (-356.400) (-355.371) [-356.394] -- 0:00:41
312500 -- (-357.219) (-356.824) [-355.441] (-356.042) * (-358.288) (-361.088) [-355.188] (-356.888) -- 0:00:41
313000 -- (-356.528) (-360.680) [-356.452] (-358.249) * [-355.112] (-358.815) (-358.716) (-356.205) -- 0:00:41
313500 -- [-355.956] (-356.539) (-356.782) (-357.274) * (-357.041) [-356.752] (-358.583) (-357.266) -- 0:00:41
314000 -- [-354.650] (-361.758) (-357.755) (-357.949) * (-359.196) [-359.701] (-357.708) (-356.969) -- 0:00:41
314500 -- (-357.121) (-362.462) [-355.375] (-357.989) * (-360.051) (-359.415) (-358.194) [-358.374] -- 0:00:41
315000 -- (-355.730) [-356.576] (-355.521) (-354.901) * (-356.615) [-358.301] (-360.022) (-355.492) -- 0:00:41
Average standard deviation of split frequencies: 0.012494
315500 -- (-356.599) (-358.212) [-355.584] (-357.355) * (-355.987) (-358.566) [-355.000] (-356.465) -- 0:00:41
316000 -- (-355.808) [-354.686] (-358.743) (-356.702) * (-355.245) [-357.203] (-359.534) (-357.816) -- 0:00:41
316500 -- [-355.741] (-359.698) (-357.107) (-361.964) * (-355.473) (-357.724) (-356.869) [-357.569] -- 0:00:41
317000 -- (-357.495) [-360.358] (-358.785) (-357.861) * [-355.280] (-357.668) (-357.903) (-358.814) -- 0:00:40
317500 -- (-358.029) (-357.454) (-358.285) [-354.320] * [-356.827] (-356.640) (-362.544) (-356.494) -- 0:00:40
318000 -- (-355.429) [-355.662] (-355.507) (-355.700) * (-356.362) (-356.434) (-361.036) [-354.992] -- 0:00:40
318500 -- (-357.104) [-355.449] (-359.541) (-359.394) * (-356.383) (-359.792) [-357.124] (-355.851) -- 0:00:40
319000 -- [-356.505] (-358.104) (-359.249) (-360.417) * [-355.729] (-355.265) (-356.676) (-355.869) -- 0:00:40
319500 -- (-355.645) (-357.303) [-355.999] (-356.537) * (-356.906) [-358.619] (-357.150) (-358.763) -- 0:00:40
320000 -- [-356.723] (-356.074) (-358.038) (-354.658) * (-356.789) (-356.288) [-355.288] (-360.207) -- 0:00:40
Average standard deviation of split frequencies: 0.012404
320500 -- (-355.838) [-356.708] (-357.234) (-354.761) * [-354.706] (-356.218) (-354.424) (-357.244) -- 0:00:40
321000 -- [-356.090] (-358.040) (-356.001) (-356.900) * (-356.341) (-355.996) (-357.103) [-358.480] -- 0:00:40
321500 -- [-355.579] (-360.751) (-355.580) (-355.759) * [-358.670] (-355.615) (-357.744) (-356.584) -- 0:00:40
322000 -- [-355.726] (-355.867) (-356.851) (-358.913) * (-355.396) (-357.573) (-357.566) [-356.392] -- 0:00:40
322500 -- [-356.795] (-354.820) (-357.493) (-358.771) * (-355.724) (-357.923) (-357.106) [-358.034] -- 0:00:39
323000 -- (-355.675) (-357.781) (-358.282) [-356.693] * (-355.176) (-354.130) (-356.428) [-355.281] -- 0:00:39
323500 -- (-357.266) (-359.373) [-355.198] (-357.056) * [-354.986] (-356.178) (-359.691) (-355.605) -- 0:00:39
324000 -- (-355.888) [-357.225] (-354.717) (-355.756) * (-355.012) (-360.737) [-355.727] (-355.662) -- 0:00:39
324500 -- (-354.393) [-356.242] (-356.622) (-359.664) * (-355.210) (-359.096) (-355.003) [-356.554] -- 0:00:39
325000 -- (-359.539) (-355.235) (-355.505) [-355.863] * (-357.072) [-360.516] (-355.432) (-355.084) -- 0:00:39
Average standard deviation of split frequencies: 0.011659
325500 -- (-359.968) [-354.232] (-356.430) (-358.096) * [-357.151] (-361.146) (-357.333) (-365.380) -- 0:00:39
326000 -- (-355.731) (-356.337) (-354.866) [-358.670] * (-357.922) (-358.358) (-357.624) [-354.749] -- 0:00:39
326500 -- (-357.567) [-356.792] (-355.663) (-359.298) * (-361.043) [-356.176] (-355.146) (-357.374) -- 0:00:39
327000 -- (-360.041) (-356.812) [-356.903] (-360.091) * [-356.638] (-360.270) (-359.729) (-356.168) -- 0:00:39
327500 -- (-358.388) (-358.029) [-356.697] (-354.494) * (-360.764) (-360.056) (-355.495) [-356.198] -- 0:00:39
328000 -- (-357.970) [-356.248] (-355.723) (-356.383) * (-356.843) [-355.268] (-357.842) (-356.183) -- 0:00:38
328500 -- [-355.397] (-355.297) (-355.193) (-356.583) * [-356.115] (-355.858) (-355.777) (-356.164) -- 0:00:38
329000 -- [-355.075] (-355.112) (-357.016) (-356.752) * (-356.751) [-357.168] (-355.726) (-356.846) -- 0:00:38
329500 -- [-355.308] (-356.298) (-355.364) (-355.479) * (-355.378) [-356.135] (-358.086) (-355.471) -- 0:00:40
330000 -- (-355.142) [-355.227] (-355.754) (-358.570) * (-358.869) (-356.245) [-357.561] (-355.841) -- 0:00:40
Average standard deviation of split frequencies: 0.010603
330500 -- (-355.841) (-355.250) (-355.535) [-355.764] * [-358.744] (-355.502) (-355.261) (-356.291) -- 0:00:40
331000 -- (-356.638) (-357.347) (-358.073) [-357.434] * (-357.250) (-355.941) (-355.397) [-358.780] -- 0:00:40
331500 -- (-358.144) [-358.200] (-357.540) (-357.567) * (-358.372) [-355.634] (-357.949) (-355.996) -- 0:00:40
332000 -- [-356.434] (-357.325) (-357.621) (-357.581) * (-359.884) [-356.730] (-354.983) (-358.492) -- 0:00:40
332500 -- [-355.138] (-358.480) (-359.366) (-357.342) * (-357.004) [-354.912] (-357.469) (-355.466) -- 0:00:40
333000 -- (-356.173) [-356.075] (-357.305) (-356.108) * [-356.483] (-355.567) (-355.741) (-356.856) -- 0:00:40
333500 -- (-357.968) [-357.674] (-357.372) (-355.437) * (-355.135) (-358.210) (-358.348) [-357.681] -- 0:00:39
334000 -- (-354.731) (-356.859) (-356.390) [-355.290] * (-354.827) (-356.271) (-359.101) [-357.124] -- 0:00:39
334500 -- [-356.287] (-355.829) (-356.106) (-355.960) * [-354.244] (-355.588) (-356.137) (-354.325) -- 0:00:39
335000 -- (-355.904) (-358.844) [-363.162] (-357.657) * (-357.120) (-354.746) [-354.943] (-356.461) -- 0:00:39
Average standard deviation of split frequencies: 0.010961
335500 -- (-356.632) [-355.355] (-357.808) (-356.576) * [-358.807] (-356.007) (-356.166) (-354.822) -- 0:00:39
336000 -- (-356.401) (-356.826) (-355.825) [-356.439] * [-357.568] (-356.860) (-356.582) (-356.897) -- 0:00:39
336500 -- (-356.301) (-355.160) [-354.517] (-355.746) * (-355.715) [-358.593] (-355.203) (-355.173) -- 0:00:39
337000 -- (-356.104) (-354.535) [-354.638] (-357.451) * (-359.194) (-354.584) [-358.390] (-356.755) -- 0:00:39
337500 -- (-355.760) (-356.323) (-354.353) [-354.805] * (-358.614) (-356.217) (-357.720) [-358.445] -- 0:00:39
338000 -- (-356.807) (-358.987) [-356.109] (-355.429) * (-357.185) (-358.652) [-354.707] (-356.074) -- 0:00:39
338500 -- (-356.447) (-356.712) (-357.454) [-357.747] * (-355.829) [-358.859] (-357.855) (-357.381) -- 0:00:39
339000 -- (-357.953) (-356.475) (-357.071) [-355.930] * (-356.740) (-355.197) (-356.416) [-356.993] -- 0:00:38
339500 -- [-354.998] (-355.230) (-359.539) (-358.405) * [-361.438] (-357.815) (-356.448) (-358.644) -- 0:00:38
340000 -- (-355.676) (-354.142) [-356.241] (-356.813) * (-356.448) (-355.222) [-354.600] (-355.942) -- 0:00:38
Average standard deviation of split frequencies: 0.010978
340500 -- (-356.408) (-354.116) [-355.594] (-356.283) * (-361.255) [-354.885] (-357.097) (-355.424) -- 0:00:38
341000 -- (-354.425) (-361.009) [-361.008] (-355.699) * (-357.794) (-355.680) [-355.221] (-355.332) -- 0:00:38
341500 -- (-355.990) (-359.454) (-356.156) [-354.342] * (-356.654) [-356.976] (-356.117) (-355.795) -- 0:00:38
342000 -- [-355.418] (-358.149) (-356.127) (-356.059) * (-355.991) (-362.806) (-354.691) [-355.159] -- 0:00:38
342500 -- [-359.232] (-354.892) (-354.721) (-356.643) * (-354.300) (-358.180) [-358.451] (-355.919) -- 0:00:38
343000 -- (-357.401) (-358.365) (-357.014) [-357.126] * [-354.398] (-356.577) (-356.221) (-359.653) -- 0:00:38
343500 -- (-356.378) (-357.238) (-358.905) [-356.070] * (-356.882) [-358.008] (-355.466) (-355.236) -- 0:00:38
344000 -- (-358.114) (-356.173) (-356.669) [-355.021] * (-354.304) [-357.349] (-354.501) (-355.475) -- 0:00:38
344500 -- (-358.232) [-355.440] (-357.608) (-357.339) * (-355.535) (-356.364) (-355.236) [-355.273] -- 0:00:38
345000 -- (-360.230) (-354.769) (-356.258) [-356.107] * (-357.478) (-357.471) (-356.274) [-355.726] -- 0:00:37
Average standard deviation of split frequencies: 0.010173
345500 -- (-357.642) (-354.514) [-357.364] (-356.528) * (-360.330) (-356.840) [-356.564] (-354.667) -- 0:00:37
346000 -- (-358.864) (-356.287) (-358.412) [-358.380] * (-355.895) [-355.671] (-354.866) (-356.002) -- 0:00:37
346500 -- [-355.233] (-360.701) (-355.790) (-355.986) * (-355.227) (-356.245) [-355.869] (-355.066) -- 0:00:37
347000 -- [-355.406] (-355.512) (-355.379) (-359.223) * [-355.113] (-355.879) (-358.250) (-358.136) -- 0:00:39
347500 -- [-360.078] (-356.681) (-354.992) (-356.706) * (-357.124) (-360.957) [-356.462] (-355.024) -- 0:00:39
348000 -- (-355.812) [-356.182] (-355.187) (-356.124) * (-359.286) [-357.080] (-356.052) (-355.740) -- 0:00:39
348500 -- (-355.027) (-362.765) (-356.446) [-356.828] * (-354.451) (-357.231) [-356.563] (-356.314) -- 0:00:39
349000 -- (-357.213) [-356.248] (-357.066) (-358.165) * (-356.586) (-358.305) [-360.351] (-356.875) -- 0:00:39
349500 -- (-359.032) (-357.210) (-356.694) [-356.352] * (-356.033) [-356.049] (-358.813) (-357.381) -- 0:00:39
350000 -- (-355.727) (-358.534) (-357.428) [-354.548] * [-355.652] (-358.739) (-356.510) (-356.408) -- 0:00:39
Average standard deviation of split frequencies: 0.010396
350500 -- (-355.617) (-358.864) (-357.060) [-354.613] * (-355.573) (-355.475) [-355.827] (-356.269) -- 0:00:38
351000 -- (-355.799) (-363.466) [-356.213] (-356.323) * [-355.775] (-360.525) (-355.328) (-357.522) -- 0:00:38
351500 -- [-356.208] (-358.686) (-360.284) (-355.565) * (-356.802) (-363.195) [-355.690] (-359.506) -- 0:00:38
352000 -- (-354.812) (-356.244) [-360.621] (-354.668) * (-357.230) [-358.253] (-355.616) (-355.020) -- 0:00:38
352500 -- [-359.321] (-354.849) (-356.563) (-356.593) * (-355.802) (-354.524) (-360.766) [-355.627] -- 0:00:38
353000 -- (-356.291) (-358.619) (-357.124) [-354.555] * (-356.807) [-357.317] (-356.454) (-357.930) -- 0:00:38
353500 -- (-356.254) [-355.561] (-355.326) (-356.809) * (-356.657) [-356.746] (-358.787) (-355.037) -- 0:00:38
354000 -- (-354.487) (-355.211) [-356.443] (-357.689) * (-354.245) [-355.537] (-355.414) (-354.825) -- 0:00:38
354500 -- (-356.658) (-359.087) [-354.669] (-356.617) * [-356.992] (-354.819) (-354.489) (-357.888) -- 0:00:38
355000 -- (-360.046) (-357.343) [-355.285] (-355.966) * (-357.207) (-355.511) (-355.440) [-355.265] -- 0:00:38
Average standard deviation of split frequencies: 0.011476
355500 -- [-357.847] (-358.113) (-356.158) (-357.977) * (-359.717) (-354.714) (-354.524) [-356.177] -- 0:00:38
356000 -- (-356.771) (-355.890) [-359.998] (-356.023) * (-356.239) (-356.312) (-358.531) [-357.862] -- 0:00:37
356500 -- (-355.083) [-355.352] (-357.180) (-356.643) * (-357.696) [-356.205] (-355.586) (-357.022) -- 0:00:37
357000 -- [-355.310] (-358.453) (-357.253) (-357.672) * (-360.251) [-354.944] (-355.607) (-356.606) -- 0:00:37
357500 -- [-357.179] (-355.844) (-359.204) (-360.781) * (-356.816) (-356.769) (-357.560) [-356.036] -- 0:00:37
358000 -- [-356.374] (-357.331) (-357.528) (-357.555) * (-357.603) [-357.899] (-356.765) (-357.114) -- 0:00:37
358500 -- [-355.687] (-355.724) (-360.295) (-360.462) * (-357.611) [-355.153] (-357.222) (-355.822) -- 0:00:37
359000 -- [-355.848] (-357.561) (-358.225) (-357.014) * [-358.096] (-355.231) (-356.780) (-356.623) -- 0:00:37
359500 -- (-357.080) [-358.377] (-355.226) (-358.570) * [-356.149] (-361.536) (-355.965) (-360.108) -- 0:00:37
360000 -- [-359.430] (-354.985) (-355.358) (-355.182) * (-356.625) (-356.911) (-359.853) [-358.498] -- 0:00:37
Average standard deviation of split frequencies: 0.011502
360500 -- (-356.576) [-357.324] (-356.082) (-357.595) * (-355.909) (-355.829) (-355.689) [-355.818] -- 0:00:37
361000 -- (-359.709) (-355.775) (-357.853) [-355.359] * (-363.280) (-354.553) (-358.772) [-355.998] -- 0:00:37
361500 -- [-357.177] (-356.631) (-356.911) (-355.964) * (-359.015) (-360.275) [-354.877] (-356.854) -- 0:00:37
362000 -- (-357.747) (-357.999) (-356.451) [-355.903] * (-356.511) (-357.352) (-358.707) [-355.322] -- 0:00:37
362500 -- (-355.517) (-355.350) (-360.501) [-356.356] * (-355.405) (-354.783) [-360.778] (-360.599) -- 0:00:36
363000 -- (-354.575) (-354.770) [-357.687] (-355.504) * (-355.337) (-356.471) [-356.969] (-356.334) -- 0:00:36
363500 -- (-357.957) (-357.662) (-354.598) [-355.085] * (-355.763) (-355.957) (-356.103) [-356.037] -- 0:00:36
364000 -- (-357.484) (-360.282) (-356.471) [-355.835] * (-356.721) [-358.599] (-355.464) (-357.637) -- 0:00:38
364500 -- (-357.426) [-356.874] (-356.230) (-358.349) * (-356.455) (-356.409) [-357.097] (-355.932) -- 0:00:38
365000 -- (-357.812) (-358.849) [-354.670] (-356.960) * (-354.637) [-354.351] (-358.933) (-356.729) -- 0:00:38
Average standard deviation of split frequencies: 0.010787
365500 -- (-355.143) [-358.334] (-355.314) (-356.029) * (-356.931) (-354.615) [-358.086] (-357.910) -- 0:00:38
366000 -- (-358.110) (-365.318) [-355.779] (-357.757) * (-355.123) [-355.551] (-357.289) (-355.178) -- 0:00:38
366500 -- (-360.504) (-360.825) (-359.402) [-357.257] * (-354.329) [-356.249] (-356.294) (-361.667) -- 0:00:38
367000 -- (-358.705) (-355.314) (-357.511) [-357.433] * (-356.480) [-354.666] (-355.084) (-356.488) -- 0:00:37
367500 -- (-354.163) (-357.807) [-355.736] (-355.069) * (-360.060) [-355.308] (-358.881) (-358.217) -- 0:00:37
368000 -- (-354.958) (-356.469) [-356.306] (-356.723) * [-355.125] (-354.812) (-355.554) (-356.435) -- 0:00:37
368500 -- (-362.543) (-355.128) [-360.381] (-357.561) * (-358.963) (-357.156) [-356.493] (-355.186) -- 0:00:37
369000 -- (-355.765) (-356.163) [-354.861] (-354.830) * (-358.813) (-354.178) [-356.416] (-358.500) -- 0:00:37
369500 -- (-356.280) (-356.885) [-355.272] (-357.717) * (-356.960) [-357.203] (-354.425) (-362.920) -- 0:00:37
370000 -- (-356.476) [-354.452] (-356.132) (-356.739) * (-355.815) [-355.637] (-357.109) (-358.566) -- 0:00:37
Average standard deviation of split frequencies: 0.010731
370500 -- (-356.145) [-358.313] (-354.956) (-356.987) * [-354.920] (-360.107) (-357.720) (-355.648) -- 0:00:37
371000 -- (-355.715) [-355.654] (-360.256) (-357.187) * [-357.336] (-354.793) (-355.905) (-355.371) -- 0:00:37
371500 -- [-360.727] (-355.892) (-355.671) (-355.490) * (-358.922) [-354.198] (-356.502) (-356.425) -- 0:00:37
372000 -- (-356.678) (-355.520) [-361.416] (-358.089) * (-357.381) (-355.468) (-355.187) [-355.047] -- 0:00:37
372500 -- (-356.344) [-354.418] (-360.547) (-362.397) * (-359.149) (-354.536) (-356.370) [-356.696] -- 0:00:37
373000 -- (-356.633) (-355.011) [-354.628] (-359.067) * (-355.659) (-356.929) [-356.743] (-357.255) -- 0:00:36
373500 -- (-358.884) (-360.831) (-357.056) [-355.376] * (-355.636) (-357.931) (-357.188) [-357.996] -- 0:00:36
374000 -- [-355.224] (-356.204) (-359.247) (-356.045) * (-358.828) [-358.182] (-355.648) (-356.153) -- 0:00:36
374500 -- (-354.742) [-355.303] (-358.206) (-355.940) * (-358.037) [-355.654] (-357.316) (-359.371) -- 0:00:36
375000 -- (-354.768) [-358.351] (-357.199) (-354.558) * (-356.184) [-354.390] (-356.653) (-354.985) -- 0:00:36
Average standard deviation of split frequencies: 0.010892
375500 -- (-357.018) (-358.143) (-358.082) [-355.259] * (-359.173) (-355.656) [-357.585] (-355.810) -- 0:00:36
376000 -- [-354.156] (-354.316) (-359.591) (-356.130) * [-355.746] (-355.517) (-360.435) (-355.357) -- 0:00:36
376500 -- [-355.466] (-354.891) (-360.223) (-355.417) * (-355.727) [-357.179] (-355.700) (-358.243) -- 0:00:36
377000 -- (-355.596) (-355.913) (-361.076) [-354.612] * (-358.700) (-355.035) [-354.933] (-355.473) -- 0:00:36
377500 -- [-355.891] (-355.807) (-358.966) (-358.915) * (-355.547) (-355.489) [-354.349] (-354.370) -- 0:00:36
378000 -- (-360.747) (-360.386) (-358.228) [-356.116] * [-358.348] (-356.742) (-357.324) (-355.650) -- 0:00:36
378500 -- (-358.119) [-356.616] (-356.546) (-355.880) * (-361.936) (-356.808) (-357.457) [-358.663] -- 0:00:36
379000 -- (-356.751) [-356.918] (-358.105) (-356.781) * (-356.677) (-355.307) [-355.418] (-359.669) -- 0:00:36
379500 -- (-360.693) (-355.770) [-355.418] (-356.869) * [-355.805] (-357.469) (-356.100) (-357.713) -- 0:00:35
380000 -- (-361.632) (-357.113) (-356.667) [-357.522] * (-357.542) (-354.420) [-355.774] (-360.018) -- 0:00:35
Average standard deviation of split frequencies: 0.011764
380500 -- (-359.159) (-355.236) [-359.792] (-354.607) * (-356.971) [-361.116] (-357.523) (-354.593) -- 0:00:35
381000 -- (-356.170) [-358.065] (-355.672) (-360.650) * (-356.439) (-357.127) (-356.562) [-355.161] -- 0:00:35
381500 -- (-355.813) (-359.598) [-354.574] (-356.253) * (-354.769) (-356.716) [-357.145] (-355.964) -- 0:00:37
382000 -- (-354.724) (-358.804) [-355.657] (-355.635) * (-354.831) (-360.993) [-355.874] (-357.992) -- 0:00:37
382500 -- (-355.914) [-354.757] (-357.686) (-359.129) * (-354.464) (-357.971) [-358.190] (-355.755) -- 0:00:37
383000 -- (-355.535) (-357.183) (-355.735) [-356.513] * (-354.464) (-358.465) [-355.262] (-356.866) -- 0:00:37
383500 -- (-358.696) [-357.090] (-356.093) (-355.440) * [-357.182] (-354.845) (-356.482) (-356.090) -- 0:00:36
384000 -- [-354.737] (-355.806) (-355.636) (-358.966) * [-356.723] (-357.968) (-357.684) (-356.119) -- 0:00:36
384500 -- [-355.167] (-357.954) (-355.171) (-356.840) * (-356.471) (-355.897) [-354.569] (-357.621) -- 0:00:36
385000 -- (-355.671) (-354.575) [-355.234] (-356.277) * [-357.471] (-355.284) (-357.611) (-354.261) -- 0:00:36
Average standard deviation of split frequencies: 0.010839
385500 -- [-355.236] (-354.790) (-356.131) (-355.101) * (-361.375) (-356.835) (-355.318) [-357.749] -- 0:00:36
386000 -- [-356.177] (-356.019) (-355.648) (-354.783) * (-356.885) (-356.805) [-354.683] (-355.593) -- 0:00:36
386500 -- (-354.605) (-356.770) (-356.559) [-355.249] * [-355.929] (-358.104) (-356.535) (-356.540) -- 0:00:36
387000 -- (-360.169) (-354.557) (-355.259) [-358.166] * (-356.171) [-357.266] (-359.489) (-358.522) -- 0:00:36
387500 -- (-359.805) [-357.772] (-360.601) (-355.791) * [-358.196] (-355.831) (-362.483) (-355.920) -- 0:00:36
388000 -- (-355.722) (-355.043) (-363.442) [-357.196] * [-355.628] (-357.557) (-358.725) (-354.702) -- 0:00:36
388500 -- (-355.632) [-355.146] (-355.260) (-357.178) * (-359.673) (-358.804) (-355.769) [-354.970] -- 0:00:36
389000 -- [-354.853] (-357.572) (-355.810) (-356.208) * [-358.556] (-354.541) (-357.919) (-356.438) -- 0:00:36
389500 -- (-355.136) (-356.579) [-357.813] (-354.712) * (-356.389) (-357.619) [-356.151] (-358.589) -- 0:00:36
390000 -- (-356.206) (-357.157) (-357.649) [-355.183] * (-355.228) (-360.130) [-356.416] (-358.223) -- 0:00:35
Average standard deviation of split frequencies: 0.011825
390500 -- (-355.127) (-355.909) [-355.200] (-356.818) * (-358.969) (-360.743) [-354.611] (-356.564) -- 0:00:35
391000 -- (-357.552) (-355.376) (-355.748) [-357.879] * (-356.976) (-359.122) (-355.969) [-357.205] -- 0:00:35
391500 -- [-363.088] (-354.406) (-354.838) (-357.334) * (-356.164) (-354.684) [-355.207] (-359.712) -- 0:00:35
392000 -- (-354.711) (-358.552) [-357.423] (-358.614) * [-357.059] (-355.712) (-356.695) (-357.713) -- 0:00:35
392500 -- (-356.282) (-360.298) [-354.969] (-354.182) * [-356.621] (-354.303) (-358.655) (-355.183) -- 0:00:35
393000 -- (-357.671) (-355.368) [-357.846] (-354.833) * [-358.080] (-354.447) (-357.518) (-355.545) -- 0:00:35
393500 -- (-354.482) [-355.024] (-358.873) (-355.257) * (-354.628) (-355.978) (-359.019) [-358.461] -- 0:00:35
394000 -- (-355.617) (-357.411) (-356.756) [-357.915] * (-360.014) (-355.973) [-356.654] (-356.815) -- 0:00:35
394500 -- (-355.954) (-355.897) (-355.545) [-355.999] * (-358.308) [-354.541] (-355.254) (-357.178) -- 0:00:35
395000 -- (-363.872) (-356.896) [-355.334] (-355.869) * (-360.866) [-354.678] (-359.218) (-360.798) -- 0:00:35
Average standard deviation of split frequencies: 0.012460
395500 -- (-357.321) (-356.962) (-356.068) [-355.719] * [-358.100] (-355.182) (-360.468) (-357.252) -- 0:00:35
396000 -- (-356.671) [-355.056] (-359.738) (-354.603) * (-355.388) (-357.391) (-357.778) [-359.399] -- 0:00:35
396500 -- (-358.136) (-356.229) (-356.320) [-359.356] * [-355.713] (-356.981) (-355.575) (-357.784) -- 0:00:35
397000 -- (-358.526) [-357.306] (-355.307) (-356.075) * (-354.690) (-359.167) (-357.385) [-357.540] -- 0:00:34
397500 -- (-362.407) (-356.062) (-357.971) [-358.286] * [-355.920] (-357.420) (-354.967) (-355.191) -- 0:00:34
398000 -- (-356.848) (-356.458) (-356.649) [-355.170] * (-358.739) [-354.617] (-357.295) (-355.704) -- 0:00:34
398500 -- (-356.311) (-355.710) [-355.924] (-355.848) * (-359.663) [-356.091] (-355.763) (-359.316) -- 0:00:34
399000 -- (-355.508) [-356.191] (-359.691) (-355.320) * (-356.674) (-359.070) [-358.852] (-360.589) -- 0:00:36
399500 -- (-357.475) (-360.246) (-356.672) [-355.285] * (-355.820) (-356.646) (-356.925) [-356.144] -- 0:00:36
400000 -- [-356.444] (-357.581) (-355.513) (-355.897) * (-355.161) (-360.827) (-356.588) [-355.799] -- 0:00:36
Average standard deviation of split frequencies: 0.012795
400500 -- [-354.516] (-356.092) (-355.726) (-359.746) * (-355.059) (-361.422) (-357.073) [-356.498] -- 0:00:35
401000 -- (-354.849) (-354.675) [-356.064] (-355.364) * (-358.477) [-354.341] (-356.290) (-356.071) -- 0:00:35
401500 -- (-358.885) [-355.508] (-356.371) (-357.858) * (-358.925) [-358.850] (-356.245) (-355.713) -- 0:00:35
402000 -- (-358.290) [-354.987] (-356.777) (-358.656) * (-358.191) (-354.873) [-356.310] (-356.948) -- 0:00:35
402500 -- (-355.299) (-354.307) (-356.543) [-355.784] * (-362.482) (-354.773) (-356.440) [-354.677] -- 0:00:35
403000 -- (-357.685) [-355.566] (-355.714) (-356.357) * (-357.452) [-354.811] (-363.022) (-355.526) -- 0:00:35
403500 -- (-356.194) [-354.956] (-354.155) (-356.998) * (-357.712) [-354.598] (-360.343) (-354.248) -- 0:00:35
404000 -- (-356.581) (-356.652) [-354.231] (-359.823) * [-357.588] (-355.891) (-358.545) (-355.926) -- 0:00:35
404500 -- (-356.849) [-356.078] (-357.437) (-355.794) * (-354.850) (-355.193) (-356.775) [-358.687] -- 0:00:35
405000 -- (-355.791) [-356.209] (-357.750) (-356.029) * [-357.115] (-356.814) (-356.825) (-357.342) -- 0:00:35
Average standard deviation of split frequencies: 0.012046
405500 -- (-356.658) (-355.185) (-356.579) [-358.062] * (-357.557) [-356.338] (-357.335) (-355.036) -- 0:00:35
406000 -- [-355.448] (-355.039) (-356.373) (-360.079) * [-357.817] (-355.764) (-357.861) (-356.860) -- 0:00:35
406500 -- [-357.886] (-354.616) (-354.942) (-358.123) * (-356.094) [-355.559] (-355.772) (-358.758) -- 0:00:35
407000 -- (-363.255) (-354.498) [-355.240] (-359.184) * (-358.045) (-356.568) [-356.793] (-354.907) -- 0:00:34
407500 -- (-360.450) [-356.896] (-357.463) (-355.256) * [-360.561] (-356.843) (-356.802) (-355.085) -- 0:00:34
408000 -- (-357.434) (-356.443) (-357.567) [-356.686] * (-354.835) (-357.319) (-355.055) [-354.015] -- 0:00:34
408500 -- (-357.310) (-354.700) (-356.523) [-357.237] * (-358.406) (-355.881) (-354.948) [-356.290] -- 0:00:34
409000 -- (-360.546) (-358.923) [-356.209] (-357.419) * (-360.151) (-357.121) [-358.354] (-356.366) -- 0:00:34
409500 -- (-358.847) [-354.741] (-355.057) (-357.173) * (-356.527) (-357.244) (-357.823) [-357.003] -- 0:00:34
410000 -- (-356.741) [-354.642] (-361.049) (-355.317) * (-356.984) (-356.818) (-357.507) [-354.959] -- 0:00:34
Average standard deviation of split frequencies: 0.011336
410500 -- (-360.085) (-356.746) [-356.297] (-356.277) * [-356.133] (-359.808) (-359.989) (-358.216) -- 0:00:34
411000 -- (-357.894) [-358.591] (-355.925) (-359.703) * (-355.260) [-357.175] (-356.294) (-357.138) -- 0:00:34
411500 -- (-356.447) (-361.834) [-356.740] (-354.525) * (-355.591) (-355.970) (-355.566) [-356.784] -- 0:00:34
412000 -- (-354.629) [-358.805] (-356.694) (-355.007) * (-356.015) (-356.976) [-356.450] (-361.516) -- 0:00:34
412500 -- (-357.063) (-358.150) [-354.861] (-355.407) * [-357.055] (-361.402) (-356.327) (-355.848) -- 0:00:34
413000 -- (-363.020) (-357.386) [-358.134] (-358.127) * (-358.547) (-354.998) (-355.147) [-355.868] -- 0:00:34
413500 -- [-359.138] (-358.115) (-356.914) (-355.607) * [-357.090] (-356.259) (-356.098) (-354.645) -- 0:00:34
414000 -- (-355.407) [-355.893] (-356.525) (-354.486) * (-357.288) (-358.555) [-355.899] (-356.853) -- 0:00:33
414500 -- (-356.012) [-356.898] (-355.975) (-355.885) * [-354.545] (-355.596) (-356.168) (-362.125) -- 0:00:33
415000 -- [-354.884] (-358.715) (-356.397) (-355.445) * (-357.787) [-356.389] (-359.556) (-356.557) -- 0:00:33
Average standard deviation of split frequencies: 0.011181
415500 -- [-355.935] (-355.459) (-356.481) (-359.392) * (-356.671) (-354.314) [-356.463] (-354.739) -- 0:00:33
416000 -- (-355.073) (-356.114) [-355.882] (-356.901) * (-359.880) (-357.904) (-362.351) [-355.565] -- 0:00:35
416500 -- (-357.698) [-356.159] (-354.936) (-359.439) * [-355.057] (-357.811) (-355.278) (-355.593) -- 0:00:35
417000 -- (-358.036) (-357.173) [-356.946] (-354.356) * (-355.155) (-355.689) [-354.631] (-356.311) -- 0:00:34
417500 -- (-355.772) [-355.641] (-359.148) (-356.127) * (-356.543) (-357.402) [-354.959] (-354.517) -- 0:00:34
418000 -- (-356.758) (-361.774) [-355.127] (-355.522) * (-362.417) [-355.381] (-355.947) (-358.089) -- 0:00:34
418500 -- (-356.406) (-360.898) [-355.139] (-354.373) * (-358.960) (-356.030) (-356.087) [-355.232] -- 0:00:34
419000 -- (-354.865) (-357.427) [-356.934] (-355.026) * (-356.015) (-356.623) (-356.252) [-359.264] -- 0:00:34
419500 -- (-357.565) (-360.164) (-355.825) [-356.897] * (-356.067) [-355.544] (-355.387) (-358.065) -- 0:00:34
420000 -- (-355.008) (-364.571) [-356.870] (-355.074) * [-354.597] (-360.166) (-356.703) (-354.567) -- 0:00:34
Average standard deviation of split frequencies: 0.010907
420500 -- (-357.046) (-354.433) (-355.019) [-358.104] * [-357.582] (-355.651) (-363.027) (-356.845) -- 0:00:34
421000 -- [-357.054] (-356.734) (-356.114) (-355.972) * (-360.161) (-356.216) (-356.363) [-358.735] -- 0:00:34
421500 -- (-358.112) (-357.361) (-355.470) [-355.321] * (-360.596) (-354.438) [-355.359] (-361.211) -- 0:00:34
422000 -- (-355.902) (-356.534) (-360.239) [-355.142] * (-356.469) [-355.595] (-355.813) (-355.954) -- 0:00:34
422500 -- (-356.562) (-356.064) [-354.943] (-356.754) * [-355.903] (-355.739) (-357.487) (-356.985) -- 0:00:34
423000 -- (-355.737) (-359.853) [-355.015] (-357.551) * [-358.797] (-356.382) (-355.370) (-356.410) -- 0:00:34
423500 -- [-357.483] (-357.816) (-357.591) (-359.427) * [-357.686] (-357.523) (-354.597) (-356.565) -- 0:00:34
424000 -- [-356.803] (-362.009) (-355.293) (-358.649) * (-355.346) (-355.784) [-354.107] (-357.156) -- 0:00:33
424500 -- [-356.987] (-355.886) (-356.893) (-357.977) * [-355.520] (-357.793) (-354.715) (-359.425) -- 0:00:33
425000 -- (-355.175) (-356.014) (-356.364) [-356.261] * (-354.429) [-355.648] (-354.570) (-361.514) -- 0:00:33
Average standard deviation of split frequencies: 0.010720
425500 -- (-356.360) [-355.770] (-355.362) (-355.831) * [-354.900] (-357.218) (-355.132) (-359.286) -- 0:00:33
426000 -- [-358.634] (-360.861) (-357.340) (-356.212) * (-354.853) [-355.421] (-355.534) (-357.190) -- 0:00:33
426500 -- (-355.250) (-355.451) [-355.771] (-355.553) * (-354.535) [-355.074] (-357.407) (-355.826) -- 0:00:33
427000 -- (-356.455) [-357.886] (-356.601) (-355.939) * (-357.163) [-355.274] (-360.438) (-355.970) -- 0:00:33
427500 -- (-358.488) (-358.279) (-356.949) [-357.679] * (-359.642) [-358.615] (-357.006) (-355.343) -- 0:00:33
428000 -- (-355.204) [-358.396] (-356.181) (-356.365) * [-357.342] (-360.689) (-356.194) (-355.814) -- 0:00:33
428500 -- (-355.117) [-359.033] (-357.816) (-358.161) * [-355.438] (-356.658) (-357.219) (-355.417) -- 0:00:33
429000 -- (-354.495) [-355.547] (-356.106) (-362.905) * (-355.295) [-355.199] (-357.056) (-355.219) -- 0:00:33
429500 -- (-355.105) (-357.401) (-360.766) [-356.795] * [-355.416] (-356.656) (-358.574) (-355.774) -- 0:00:33
430000 -- (-354.988) (-354.805) (-357.146) [-356.276] * (-357.714) (-355.893) [-356.941] (-360.118) -- 0:00:33
Average standard deviation of split frequencies: 0.010672
430500 -- [-356.028] (-357.088) (-356.836) (-359.208) * (-355.705) (-357.911) [-357.396] (-356.205) -- 0:00:33
431000 -- (-358.623) (-355.424) [-355.330] (-356.582) * [-356.137] (-356.140) (-354.755) (-359.429) -- 0:00:33
431500 -- (-356.116) [-355.182] (-355.052) (-356.627) * (-357.355) (-355.449) [-359.494] (-355.894) -- 0:00:32
432000 -- [-357.313] (-356.591) (-357.582) (-354.750) * (-358.438) (-357.360) [-359.081] (-355.436) -- 0:00:32
432500 -- (-354.631) [-354.201] (-357.655) (-357.241) * (-356.076) (-359.145) [-355.486] (-355.143) -- 0:00:32
433000 -- (-358.572) (-354.326) [-358.389] (-355.619) * [-359.262] (-364.818) (-356.131) (-357.639) -- 0:00:32
433500 -- (-357.592) [-354.228] (-359.458) (-358.153) * [-355.343] (-357.599) (-354.354) (-357.356) -- 0:00:33
434000 -- (-361.663) [-358.510] (-354.901) (-357.515) * (-355.926) (-354.691) (-357.399) [-356.216] -- 0:00:33
434500 -- (-355.454) [-356.264] (-356.841) (-355.778) * [-357.555] (-358.266) (-355.947) (-357.288) -- 0:00:33
435000 -- (-355.908) [-356.970] (-357.332) (-357.317) * (-354.538) [-356.916] (-357.181) (-357.206) -- 0:00:33
Average standard deviation of split frequencies: 0.011015
435500 -- [-356.298] (-358.963) (-356.953) (-355.773) * (-356.778) (-368.876) (-355.482) [-356.654] -- 0:00:33
436000 -- (-356.527) [-357.268] (-359.046) (-356.473) * (-356.404) (-367.127) [-355.562] (-354.172) -- 0:00:33
436500 -- (-355.215) (-355.455) (-357.050) [-358.284] * (-356.963) [-356.707] (-356.125) (-354.704) -- 0:00:33
437000 -- (-357.562) (-356.412) [-358.257] (-356.050) * (-355.806) (-357.326) [-355.328] (-361.108) -- 0:00:33
437500 -- (-359.462) [-359.408] (-357.970) (-354.382) * (-354.792) [-355.429] (-358.398) (-359.211) -- 0:00:33
438000 -- (-361.206) (-359.487) (-356.065) [-356.148] * (-355.573) [-357.314] (-357.854) (-359.933) -- 0:00:33
438500 -- (-355.661) (-356.036) (-354.942) [-354.664] * (-355.433) (-355.663) (-356.847) [-357.093] -- 0:00:33
439000 -- (-356.609) (-354.695) [-356.819] (-356.442) * (-356.711) (-355.322) [-358.097] (-356.607) -- 0:00:33
439500 -- (-359.935) (-355.325) [-356.173] (-355.931) * [-355.520] (-356.705) (-358.552) (-357.036) -- 0:00:33
440000 -- [-357.628] (-355.605) (-354.743) (-355.789) * (-355.940) [-356.909] (-356.748) (-355.817) -- 0:00:33
Average standard deviation of split frequencies: 0.010698
440500 -- [-355.360] (-355.237) (-354.141) (-355.999) * [-360.180] (-356.093) (-356.883) (-355.700) -- 0:00:33
441000 -- [-355.269] (-355.608) (-355.395) (-356.542) * (-354.935) (-355.726) [-356.055] (-354.480) -- 0:00:32
441500 -- [-354.888] (-355.195) (-357.243) (-355.316) * (-355.943) (-359.911) [-354.773] (-357.411) -- 0:00:32
442000 -- (-355.883) (-356.310) [-356.261] (-355.661) * (-354.721) (-355.389) [-355.615] (-356.381) -- 0:00:32
442500 -- (-354.505) [-356.908] (-356.108) (-354.574) * (-358.004) (-355.082) [-359.520] (-357.162) -- 0:00:32
443000 -- [-355.977] (-358.171) (-355.716) (-354.864) * (-359.843) (-354.269) [-356.844] (-363.835) -- 0:00:32
443500 -- [-354.975] (-357.962) (-355.093) (-356.647) * (-356.224) [-358.001] (-356.051) (-358.121) -- 0:00:32
444000 -- (-357.040) (-356.309) (-357.496) [-357.034] * [-356.186] (-358.259) (-355.764) (-358.073) -- 0:00:32
444500 -- (-354.803) (-355.339) [-354.641] (-355.821) * (-355.977) [-356.969] (-357.109) (-358.369) -- 0:00:32
445000 -- (-356.445) (-356.503) (-357.548) [-356.493] * (-359.699) (-356.945) [-356.647] (-355.091) -- 0:00:32
Average standard deviation of split frequencies: 0.010768
445500 -- [-356.671] (-355.220) (-357.238) (-355.245) * [-357.872] (-357.173) (-358.239) (-357.380) -- 0:00:32
446000 -- (-355.346) (-356.238) (-354.754) [-354.676] * (-357.294) [-356.454] (-355.321) (-357.246) -- 0:00:32
446500 -- (-362.491) (-356.915) (-355.190) [-356.749] * [-354.965] (-355.317) (-359.647) (-356.292) -- 0:00:32
447000 -- (-356.818) (-357.249) (-355.694) [-355.103] * (-356.382) (-357.463) (-357.857) [-355.116] -- 0:00:32
447500 -- [-355.883] (-356.521) (-358.106) (-359.506) * (-356.653) [-355.692] (-356.531) (-357.548) -- 0:00:32
448000 -- (-356.419) (-358.009) (-357.825) [-356.627] * (-357.916) [-355.304] (-354.246) (-356.318) -- 0:00:32
448500 -- [-354.821] (-357.391) (-355.735) (-358.843) * [-356.570] (-355.631) (-356.753) (-357.733) -- 0:00:31
449000 -- (-358.502) (-355.580) (-360.561) [-355.509] * (-358.009) [-360.077] (-356.789) (-354.375) -- 0:00:31
449500 -- (-357.128) [-354.428] (-360.521) (-355.848) * (-355.258) (-357.023) [-355.452] (-356.392) -- 0:00:31
450000 -- [-357.207] (-357.468) (-356.715) (-358.430) * (-356.096) [-356.193] (-355.782) (-357.519) -- 0:00:31
Average standard deviation of split frequencies: 0.010983
450500 -- [-356.240] (-360.633) (-355.975) (-360.218) * [-356.797] (-357.186) (-355.225) (-356.829) -- 0:00:32
451000 -- (-357.714) (-358.892) [-355.238] (-357.132) * (-356.280) (-357.891) [-355.963] (-356.962) -- 0:00:32
451500 -- [-357.168] (-357.179) (-362.844) (-356.484) * (-355.527) (-356.089) [-355.463] (-356.622) -- 0:00:32
452000 -- [-355.480] (-357.726) (-356.897) (-361.121) * (-356.293) (-361.233) (-355.023) [-355.375] -- 0:00:32
452500 -- [-354.618] (-357.180) (-356.300) (-355.604) * (-355.786) (-361.629) [-355.960] (-355.351) -- 0:00:32
453000 -- [-356.314] (-357.248) (-355.452) (-355.856) * (-356.212) (-356.651) [-359.265] (-354.695) -- 0:00:32
453500 -- [-356.099] (-356.622) (-356.795) (-355.526) * (-354.913) (-356.635) [-356.116] (-354.965) -- 0:00:32
454000 -- (-354.693) (-356.226) (-357.017) [-358.316] * (-356.080) (-355.362) (-357.174) [-354.760] -- 0:00:32
454500 -- (-357.156) (-357.477) [-355.057] (-357.530) * (-358.761) (-358.552) [-356.266] (-355.548) -- 0:00:32
455000 -- (-357.663) (-355.058) [-354.380] (-354.814) * (-357.077) (-354.653) [-355.517] (-354.886) -- 0:00:32
Average standard deviation of split frequencies: 0.011630
455500 -- (-358.353) (-357.897) [-355.695] (-357.980) * (-357.401) [-355.981] (-354.786) (-356.723) -- 0:00:32
456000 -- (-357.137) (-357.077) (-358.222) [-357.129] * (-355.109) (-358.192) [-354.287] (-355.500) -- 0:00:32
456500 -- [-355.304] (-355.916) (-354.772) (-355.296) * (-358.266) (-355.579) (-356.817) [-355.526] -- 0:00:32
457000 -- (-363.336) (-355.218) (-355.561) [-354.884] * (-356.140) (-357.595) [-355.298] (-359.118) -- 0:00:32
457500 -- (-359.215) [-355.479] (-357.172) (-356.951) * (-355.974) (-355.574) (-358.244) [-357.642] -- 0:00:32
458000 -- (-355.368) [-360.168] (-354.899) (-354.796) * [-356.275] (-355.340) (-358.126) (-356.895) -- 0:00:31
458500 -- [-355.952] (-354.448) (-356.230) (-357.505) * (-360.103) [-355.235] (-355.822) (-355.465) -- 0:00:31
459000 -- (-355.087) [-357.029] (-355.293) (-359.388) * [-357.506] (-355.301) (-357.240) (-354.534) -- 0:00:31
459500 -- (-357.257) (-354.921) [-355.829] (-355.236) * (-356.698) [-354.844] (-355.682) (-354.886) -- 0:00:31
460000 -- (-357.858) (-355.692) (-357.662) [-354.211] * [-359.856] (-356.919) (-355.902) (-358.318) -- 0:00:31
Average standard deviation of split frequencies: 0.011960
460500 -- (-356.846) (-357.616) [-355.792] (-354.980) * (-356.432) [-356.161] (-356.594) (-356.343) -- 0:00:31
461000 -- (-356.640) (-355.228) [-355.773] (-355.958) * (-356.519) (-356.787) [-355.501] (-358.346) -- 0:00:31
461500 -- (-355.342) (-359.487) (-356.774) [-356.142] * (-355.519) (-354.930) (-355.597) [-355.981] -- 0:00:31
462000 -- (-355.113) (-355.209) [-355.159] (-359.190) * [-356.601] (-355.905) (-355.856) (-354.628) -- 0:00:31
462500 -- (-358.776) (-357.236) [-357.662] (-355.785) * [-357.498] (-357.704) (-357.608) (-354.312) -- 0:00:31
463000 -- (-358.077) (-358.632) (-358.132) [-355.129] * (-359.391) (-358.948) (-355.748) [-354.976] -- 0:00:31
463500 -- (-356.212) (-355.767) (-358.332) [-355.282] * (-358.665) (-356.382) (-358.408) [-355.780] -- 0:00:31
464000 -- (-358.540) [-356.466] (-356.590) (-354.010) * [-358.622] (-354.925) (-360.365) (-355.647) -- 0:00:31
464500 -- (-357.874) (-357.257) [-358.155] (-358.348) * (-359.436) (-354.802) (-355.978) [-356.391] -- 0:00:31
465000 -- (-359.653) [-354.687] (-356.158) (-357.613) * (-355.257) [-356.256] (-356.557) (-359.395) -- 0:00:31
Average standard deviation of split frequencies: 0.011901
465500 -- (-354.514) (-355.022) [-354.642] (-355.210) * (-357.489) (-356.054) (-355.065) [-355.143] -- 0:00:31
466000 -- (-355.695) (-356.136) [-354.952] (-354.919) * (-356.303) (-357.411) [-357.380] (-355.248) -- 0:00:30
466500 -- (-357.995) (-354.205) (-357.982) [-355.682] * [-355.943] (-355.623) (-355.595) (-355.424) -- 0:00:30
467000 -- [-356.169] (-359.464) (-357.674) (-355.937) * (-356.678) (-359.805) [-354.924] (-355.449) -- 0:00:30
467500 -- (-355.956) (-356.784) [-355.432] (-362.489) * (-356.494) [-355.169] (-355.900) (-355.433) -- 0:00:30
468000 -- (-356.040) [-358.149] (-357.175) (-362.534) * (-355.329) (-356.590) [-354.801] (-354.924) -- 0:00:31
468500 -- (-355.252) [-355.478] (-356.055) (-356.650) * (-357.212) (-357.918) [-354.457] (-354.868) -- 0:00:31
469000 -- [-357.822] (-357.310) (-356.772) (-356.156) * (-356.553) (-355.112) (-356.200) [-355.346] -- 0:00:31
469500 -- [-354.807] (-354.978) (-356.408) (-354.772) * [-355.914] (-356.598) (-358.739) (-356.046) -- 0:00:31
470000 -- (-355.291) (-356.655) [-356.423] (-357.600) * [-355.880] (-354.600) (-356.831) (-356.706) -- 0:00:31
Average standard deviation of split frequencies: 0.012457
470500 -- (-356.169) (-356.366) (-361.100) [-356.825] * (-357.089) [-355.486] (-358.368) (-356.464) -- 0:00:31
471000 -- (-359.480) (-356.512) [-357.780] (-354.450) * (-356.513) [-356.198] (-355.316) (-358.008) -- 0:00:31
471500 -- (-354.122) (-355.037) [-354.904] (-354.799) * [-362.279] (-359.011) (-355.364) (-356.800) -- 0:00:31
472000 -- (-359.260) [-356.893] (-357.832) (-357.693) * [-358.445] (-354.372) (-357.295) (-355.151) -- 0:00:31
472500 -- (-355.689) [-357.641] (-357.531) (-359.349) * (-355.459) (-356.630) [-358.637] (-355.901) -- 0:00:31
473000 -- (-359.395) [-355.632] (-358.914) (-355.334) * (-358.194) (-355.836) (-357.361) [-357.556] -- 0:00:31
473500 -- [-354.562] (-358.807) (-358.718) (-355.448) * (-362.579) (-356.179) (-354.592) [-355.445] -- 0:00:31
474000 -- (-356.242) [-354.892] (-354.309) (-355.380) * (-355.755) (-356.750) (-355.103) [-356.263] -- 0:00:31
474500 -- (-356.269) [-355.451] (-357.705) (-362.055) * [-355.215] (-358.546) (-354.945) (-354.522) -- 0:00:31
475000 -- (-355.882) (-357.540) (-355.627) [-356.225] * (-354.333) (-359.575) (-357.145) [-355.506] -- 0:00:30
Average standard deviation of split frequencies: 0.012256
475500 -- (-356.288) (-357.014) (-356.626) [-356.766] * (-354.518) (-355.712) [-356.432] (-355.695) -- 0:00:30
476000 -- (-356.772) (-357.871) [-354.739] (-358.709) * (-357.958) (-362.307) [-355.536] (-358.966) -- 0:00:30
476500 -- (-362.057) [-355.358] (-355.452) (-356.918) * (-356.724) (-365.131) (-356.325) [-355.983] -- 0:00:30
477000 -- [-357.547] (-358.047) (-355.485) (-358.047) * (-360.101) (-359.610) (-357.486) [-355.387] -- 0:00:30
477500 -- [-360.000] (-360.023) (-355.640) (-360.281) * (-355.960) (-355.434) [-358.538] (-355.384) -- 0:00:30
478000 -- (-358.066) [-361.441] (-355.964) (-357.545) * [-355.218] (-357.078) (-356.504) (-355.704) -- 0:00:30
478500 -- (-356.930) (-354.810) (-357.907) [-355.497] * (-357.358) (-355.854) [-355.828] (-359.751) -- 0:00:30
479000 -- (-354.347) (-355.489) (-357.947) [-356.567] * (-356.309) (-358.795) [-355.034] (-357.599) -- 0:00:30
479500 -- (-357.486) [-357.738] (-360.723) (-357.542) * (-356.817) (-356.395) (-355.605) [-356.756] -- 0:00:30
480000 -- (-363.046) (-357.519) [-357.999] (-355.590) * (-361.702) (-356.044) [-355.995] (-355.632) -- 0:00:30
Average standard deviation of split frequencies: 0.012137
480500 -- (-363.120) (-357.861) (-356.047) [-354.961] * (-354.894) [-354.327] (-356.118) (-356.479) -- 0:00:30
481000 -- (-356.669) (-356.672) (-358.176) [-358.029] * [-357.809] (-355.774) (-357.344) (-356.886) -- 0:00:30
481500 -- (-355.655) (-358.626) [-356.394] (-356.397) * (-361.031) [-355.828] (-357.251) (-358.866) -- 0:00:30
482000 -- (-357.890) [-357.716] (-358.502) (-359.460) * (-354.860) [-357.698] (-356.059) (-357.396) -- 0:00:30
482500 -- (-356.298) (-354.543) (-356.237) [-357.239] * (-356.199) (-355.508) (-356.515) [-357.287] -- 0:00:30
483000 -- [-355.670] (-356.240) (-356.387) (-358.856) * [-356.370] (-359.962) (-357.729) (-358.045) -- 0:00:29
483500 -- (-354.623) [-354.910] (-354.516) (-359.320) * (-356.071) (-356.640) (-358.172) [-356.044] -- 0:00:29
484000 -- (-354.828) (-355.800) [-354.976] (-355.146) * (-357.516) (-358.550) (-355.121) [-355.351] -- 0:00:29
484500 -- (-357.779) (-358.452) (-354.993) [-356.904] * (-359.718) (-357.170) (-354.648) [-355.155] -- 0:00:29
485000 -- (-355.283) (-356.755) (-356.636) [-358.884] * (-356.333) (-356.856) (-354.253) [-358.107] -- 0:00:29
Average standard deviation of split frequencies: 0.011821
485500 -- (-357.409) [-356.145] (-355.831) (-357.943) * (-355.123) (-356.174) [-354.654] (-357.924) -- 0:00:30
486000 -- (-355.897) (-358.436) [-358.161] (-359.726) * (-354.517) (-356.209) (-356.399) [-355.876] -- 0:00:30
486500 -- [-354.832] (-356.328) (-354.733) (-357.181) * (-354.887) (-359.323) (-357.412) [-356.502] -- 0:00:30
487000 -- (-357.518) (-357.997) (-359.318) [-355.029] * (-354.947) [-359.493] (-355.806) (-360.190) -- 0:00:30
487500 -- (-354.293) (-357.416) [-360.504] (-360.036) * (-354.437) [-356.566] (-357.766) (-361.925) -- 0:00:30
488000 -- (-354.823) (-356.657) [-359.393] (-357.343) * (-355.554) [-364.062] (-355.369) (-356.780) -- 0:00:30
488500 -- (-357.513) [-355.243] (-361.518) (-354.883) * (-355.454) (-361.054) [-354.972] (-355.740) -- 0:00:30
489000 -- (-357.287) (-355.364) [-359.693] (-363.208) * (-355.929) (-356.186) [-355.935] (-355.754) -- 0:00:30
489500 -- (-361.236) (-356.062) [-358.906] (-358.534) * [-355.422] (-354.752) (-357.138) (-356.709) -- 0:00:30
490000 -- (-354.483) (-354.977) [-357.474] (-356.854) * (-356.070) (-356.942) [-355.488] (-359.821) -- 0:00:30
Average standard deviation of split frequencies: 0.011709
490500 -- (-355.526) (-356.009) (-359.914) [-354.968] * (-356.687) (-355.624) [-357.164] (-356.899) -- 0:00:30
491000 -- [-354.248] (-355.694) (-358.335) (-356.668) * (-358.108) [-358.660] (-355.337) (-355.411) -- 0:00:30
491500 -- (-356.185) (-356.149) (-356.867) [-355.985] * (-358.345) (-360.706) (-355.977) [-354.912] -- 0:00:30
492000 -- [-354.345] (-356.360) (-357.244) (-355.003) * (-358.177) (-354.987) [-356.511] (-355.948) -- 0:00:29
492500 -- (-354.256) [-357.394] (-360.505) (-356.682) * (-357.090) [-355.603] (-359.740) (-355.076) -- 0:00:29
493000 -- (-355.662) [-359.493] (-357.260) (-355.579) * [-356.174] (-354.671) (-358.984) (-357.514) -- 0:00:29
493500 -- (-356.045) (-355.821) [-358.457] (-354.412) * [-354.494] (-355.869) (-354.923) (-355.409) -- 0:00:29
494000 -- [-355.694] (-358.963) (-354.454) (-356.166) * [-356.329] (-358.688) (-356.576) (-359.657) -- 0:00:29
494500 -- [-356.895] (-360.435) (-355.370) (-361.258) * (-357.802) (-356.850) [-357.437] (-359.958) -- 0:00:29
495000 -- (-355.745) (-358.397) [-357.916] (-361.436) * (-360.029) (-354.976) [-357.690] (-355.560) -- 0:00:29
Average standard deviation of split frequencies: 0.011293
495500 -- (-358.112) [-355.016] (-358.737) (-358.175) * (-354.805) (-358.568) (-357.836) [-355.826] -- 0:00:29
496000 -- (-362.051) (-354.645) (-357.519) [-358.383] * (-357.208) (-357.601) (-357.905) [-360.296] -- 0:00:29
496500 -- [-357.403] (-354.256) (-355.868) (-357.804) * (-358.843) (-356.669) [-358.674] (-360.122) -- 0:00:29
497000 -- (-355.040) [-354.187] (-356.495) (-356.252) * (-355.375) (-354.910) (-357.143) [-357.598] -- 0:00:29
497500 -- (-356.687) [-356.871] (-356.145) (-361.588) * [-355.628] (-357.614) (-358.897) (-356.246) -- 0:00:29
498000 -- (-355.448) (-356.949) (-354.690) [-356.109] * (-354.908) (-358.887) [-356.395] (-355.666) -- 0:00:29
498500 -- [-356.252] (-355.157) (-358.049) (-354.506) * [-357.870] (-355.396) (-356.690) (-356.615) -- 0:00:29
499000 -- (-354.815) (-359.044) [-355.598] (-355.140) * [-356.348] (-355.630) (-355.175) (-356.767) -- 0:00:29
499500 -- [-355.733] (-356.560) (-356.597) (-355.720) * (-360.501) (-357.539) [-354.856] (-356.793) -- 0:00:29
500000 -- (-354.587) [-361.829] (-356.196) (-355.377) * (-355.798) (-357.674) [-356.601] (-357.072) -- 0:00:29
Average standard deviation of split frequencies: 0.011534
500500 -- [-354.400] (-357.118) (-355.270) (-355.828) * (-359.049) [-354.940] (-356.130) (-356.590) -- 0:00:28
501000 -- (-355.465) (-356.997) [-359.028] (-355.077) * [-355.143] (-355.406) (-357.735) (-356.023) -- 0:00:28
501500 -- (-356.099) (-356.199) [-361.871] (-357.776) * (-360.795) (-357.032) (-359.782) [-356.196] -- 0:00:28
502000 -- (-355.532) (-357.757) [-359.355] (-359.104) * (-357.966) (-354.759) [-354.635] (-358.713) -- 0:00:28
502500 -- (-356.718) (-357.835) (-362.921) [-356.989] * (-361.528) (-361.728) (-358.859) [-355.888] -- 0:00:29
503000 -- (-356.429) (-356.286) (-362.563) [-357.925] * (-354.189) (-355.536) (-357.731) [-355.812] -- 0:00:29
503500 -- (-356.619) (-355.952) [-354.780] (-355.556) * (-355.243) (-360.200) (-356.120) [-358.113] -- 0:00:29
504000 -- (-356.997) [-356.048] (-357.635) (-355.339) * (-356.099) (-358.872) [-355.413] (-354.519) -- 0:00:29
504500 -- (-354.803) [-356.475] (-357.335) (-357.253) * (-356.533) (-358.507) (-356.750) [-354.829] -- 0:00:29
505000 -- (-354.974) (-361.257) [-358.230] (-356.739) * (-358.199) (-358.355) (-358.539) [-359.196] -- 0:00:29
Average standard deviation of split frequencies: 0.011471
505500 -- [-358.069] (-355.655) (-357.118) (-356.261) * (-357.857) [-354.046] (-356.852) (-358.417) -- 0:00:29
506000 -- (-355.751) [-354.835] (-355.518) (-361.449) * (-358.966) (-354.189) [-356.342] (-357.928) -- 0:00:29
506500 -- (-356.043) [-355.660] (-354.889) (-356.695) * (-356.199) (-357.415) (-355.858) [-356.972] -- 0:00:29
507000 -- (-356.053) [-359.802] (-356.863) (-357.025) * (-356.023) [-356.791] (-356.165) (-355.678) -- 0:00:29
507500 -- (-357.602) (-358.476) (-355.726) [-356.959] * (-357.333) (-355.944) [-355.750] (-355.475) -- 0:00:29
508000 -- (-358.879) (-358.125) (-356.428) [-357.249] * (-360.104) [-354.430] (-355.496) (-356.899) -- 0:00:29
508500 -- (-359.190) (-356.319) [-354.895] (-354.841) * (-355.481) (-355.106) (-355.000) [-357.304] -- 0:00:28
509000 -- [-354.903] (-357.751) (-359.114) (-358.338) * (-356.564) (-356.326) [-355.689] (-355.056) -- 0:00:28
509500 -- (-359.563) [-356.585] (-354.674) (-355.907) * (-356.018) (-356.070) (-355.951) [-355.207] -- 0:00:28
510000 -- [-355.411] (-354.853) (-355.602) (-356.395) * [-355.988] (-357.863) (-356.051) (-356.870) -- 0:00:28
Average standard deviation of split frequencies: 0.011366
510500 -- (-355.069) [-355.351] (-355.232) (-356.811) * [-358.694] (-358.637) (-357.651) (-357.312) -- 0:00:28
511000 -- (-355.907) [-354.417] (-355.435) (-355.480) * (-359.012) (-356.035) (-354.897) [-356.470] -- 0:00:28
511500 -- (-358.667) (-357.246) (-357.689) [-358.362] * [-357.959] (-356.601) (-363.686) (-355.555) -- 0:00:28
512000 -- [-356.536] (-356.224) (-355.878) (-354.625) * (-359.597) (-358.434) [-363.790] (-355.240) -- 0:00:28
512500 -- (-358.754) (-354.958) [-356.811] (-356.272) * [-359.321] (-356.488) (-355.886) (-356.189) -- 0:00:28
513000 -- (-359.274) [-360.414] (-361.564) (-354.533) * (-357.037) (-355.161) (-357.080) [-355.818] -- 0:00:28
513500 -- (-361.307) [-357.586] (-356.092) (-357.983) * [-356.104] (-355.840) (-355.469) (-359.438) -- 0:00:28
514000 -- (-357.652) (-354.011) (-354.806) [-354.634] * (-356.273) (-358.602) (-357.988) [-355.736] -- 0:00:28
514500 -- (-355.475) [-355.606] (-356.269) (-356.580) * (-355.804) [-355.810] (-356.664) (-355.358) -- 0:00:28
515000 -- (-356.077) (-363.009) [-357.550] (-354.552) * (-356.899) (-355.928) [-356.179] (-355.483) -- 0:00:28
Average standard deviation of split frequencies: 0.010392
515500 -- (-356.299) [-360.214] (-355.046) (-354.522) * [-357.417] (-355.632) (-357.513) (-356.128) -- 0:00:28
516000 -- (-357.897) [-358.411] (-355.779) (-357.632) * (-355.987) (-355.723) [-355.014] (-357.161) -- 0:00:28
516500 -- (-355.480) (-357.175) (-354.532) [-355.193] * (-354.470) (-355.275) [-356.345] (-355.834) -- 0:00:28
517000 -- [-354.543] (-356.281) (-354.647) (-355.119) * (-357.858) (-360.806) (-358.508) [-354.652] -- 0:00:28
517500 -- (-355.453) (-356.589) [-357.317] (-356.434) * (-358.050) (-356.455) (-354.668) [-354.886] -- 0:00:27
518000 -- (-354.826) [-356.246] (-355.874) (-356.796) * (-355.651) (-355.796) [-356.926] (-355.005) -- 0:00:27
518500 -- (-355.400) (-354.608) (-355.439) [-355.514] * [-356.779] (-355.059) (-356.647) (-354.769) -- 0:00:27
519000 -- (-357.044) [-356.481] (-355.183) (-355.952) * (-355.642) [-354.220] (-354.768) (-357.787) -- 0:00:27
519500 -- (-357.903) (-357.995) [-355.360] (-357.513) * (-356.775) (-354.571) [-359.722] (-360.242) -- 0:00:27
520000 -- [-356.864] (-355.853) (-357.552) (-358.941) * (-357.278) (-355.325) (-356.601) [-356.614] -- 0:00:28
Average standard deviation of split frequencies: 0.009959
520500 -- (-358.908) [-356.590] (-357.137) (-356.124) * (-358.466) [-359.184] (-357.319) (-360.852) -- 0:00:28
521000 -- [-356.480] (-355.265) (-357.053) (-356.337) * (-361.540) (-354.821) [-357.276] (-354.780) -- 0:00:28
521500 -- (-357.635) (-355.719) [-356.689] (-356.858) * (-354.649) [-354.605] (-358.089) (-355.843) -- 0:00:28
522000 -- [-364.951] (-356.299) (-355.052) (-354.656) * (-356.412) (-355.974) (-360.373) [-355.017] -- 0:00:28
522500 -- (-359.705) (-357.929) [-357.193] (-356.437) * [-356.906] (-356.131) (-359.616) (-358.371) -- 0:00:28
523000 -- (-355.398) (-357.158) (-354.674) [-355.655] * (-358.133) (-355.184) [-357.248] (-355.454) -- 0:00:28
523500 -- [-358.633] (-355.766) (-355.581) (-356.593) * (-356.675) (-355.373) (-354.889) [-355.185] -- 0:00:28
524000 -- (-357.062) (-354.513) [-355.914] (-358.688) * [-355.385] (-355.144) (-358.337) (-354.225) -- 0:00:28
524500 -- (-354.746) [-354.933] (-357.202) (-356.636) * (-355.764) [-354.785] (-355.554) (-355.225) -- 0:00:28
525000 -- (-354.970) (-358.549) [-356.663] (-363.372) * (-356.751) (-356.375) (-355.395) [-354.581] -- 0:00:28
Average standard deviation of split frequencies: 0.009354
525500 -- [-354.945] (-358.946) (-357.067) (-357.023) * (-357.323) [-357.002] (-365.157) (-354.167) -- 0:00:27
526000 -- (-356.281) (-355.391) (-355.942) [-356.716] * (-357.412) [-358.592] (-358.283) (-354.728) -- 0:00:27
526500 -- (-357.092) [-355.678] (-354.628) (-356.565) * (-360.301) (-356.213) (-356.294) [-355.153] -- 0:00:27
527000 -- [-358.163] (-355.382) (-354.160) (-356.426) * (-355.201) [-357.059] (-356.027) (-358.322) -- 0:00:27
527500 -- (-355.711) (-359.455) [-357.971] (-358.079) * (-355.468) (-357.106) (-355.143) [-355.013] -- 0:00:27
528000 -- (-358.855) [-357.349] (-355.055) (-354.547) * [-355.481] (-357.253) (-357.792) (-356.091) -- 0:00:27
528500 -- (-355.106) [-356.846] (-355.840) (-354.999) * [-355.229] (-359.157) (-360.108) (-355.614) -- 0:00:27
529000 -- (-356.068) (-355.662) (-355.815) [-356.700] * (-355.444) (-354.984) [-355.236] (-354.722) -- 0:00:27
529500 -- [-357.235] (-355.775) (-361.542) (-354.835) * (-355.938) (-356.183) [-357.259] (-354.238) -- 0:00:27
530000 -- (-357.879) [-356.894] (-358.458) (-355.918) * (-355.558) [-355.087] (-355.685) (-357.001) -- 0:00:27
Average standard deviation of split frequencies: 0.009605
530500 -- (-354.968) (-357.820) (-360.578) [-355.234] * (-356.785) (-357.721) [-355.276] (-354.627) -- 0:00:27
531000 -- (-357.753) [-356.790] (-357.098) (-355.262) * [-354.844] (-356.357) (-357.004) (-355.496) -- 0:00:27
531500 -- [-356.733] (-355.869) (-355.131) (-354.755) * (-356.118) (-354.739) (-355.972) [-355.187] -- 0:00:27
532000 -- (-357.166) [-358.761] (-356.114) (-356.835) * [-355.819] (-355.491) (-357.960) (-357.226) -- 0:00:27
532500 -- (-356.799) (-355.419) [-362.381] (-355.624) * (-355.936) (-355.369) (-354.696) [-354.693] -- 0:00:27
533000 -- (-355.926) (-355.419) (-358.272) [-356.037] * [-358.251] (-355.461) (-355.014) (-357.578) -- 0:00:27
533500 -- (-357.692) (-355.539) (-358.973) [-356.178] * [-361.134] (-356.695) (-357.528) (-356.676) -- 0:00:27
534000 -- [-355.288] (-356.813) (-359.770) (-356.503) * [-356.096] (-356.413) (-358.103) (-356.996) -- 0:00:27
534500 -- [-356.391] (-358.060) (-359.572) (-357.215) * (-355.397) (-355.326) (-354.975) [-359.196] -- 0:00:26
535000 -- [-358.492] (-354.985) (-358.826) (-356.912) * (-355.853) [-356.354] (-358.592) (-356.903) -- 0:00:26
Average standard deviation of split frequencies: 0.009205
535500 -- (-355.135) (-355.100) (-357.410) [-358.148] * (-360.080) (-356.269) (-355.504) [-355.138] -- 0:00:27
536000 -- (-359.661) (-355.378) [-358.141] (-356.720) * (-357.571) [-355.560] (-362.087) (-356.959) -- 0:00:27
536500 -- (-359.622) (-354.508) (-356.843) [-354.636] * [-356.378] (-354.805) (-357.192) (-356.612) -- 0:00:27
537000 -- [-357.707] (-355.390) (-355.624) (-355.496) * (-358.065) (-356.733) [-356.315] (-354.757) -- 0:00:27
537500 -- (-355.083) (-355.769) [-357.529] (-355.115) * [-354.748] (-358.917) (-356.791) (-355.329) -- 0:00:27
538000 -- (-355.184) (-359.566) [-355.744] (-355.303) * [-357.569] (-358.994) (-355.555) (-356.072) -- 0:00:27
538500 -- [-359.016] (-355.164) (-356.323) (-358.800) * (-356.142) [-358.650] (-356.204) (-356.480) -- 0:00:27
539000 -- (-357.161) (-355.174) (-360.443) [-355.077] * [-354.118] (-358.111) (-356.451) (-355.494) -- 0:00:27
539500 -- [-354.353] (-354.898) (-357.760) (-357.845) * (-357.487) [-357.926] (-355.019) (-355.078) -- 0:00:27
540000 -- (-356.930) (-354.943) [-359.669] (-359.734) * [-357.037] (-355.012) (-356.068) (-359.575) -- 0:00:27
Average standard deviation of split frequencies: 0.008991
540500 -- (-358.402) [-358.272] (-362.043) (-357.598) * [-354.797] (-358.414) (-354.539) (-358.704) -- 0:00:27
541000 -- (-356.569) (-355.816) (-355.336) [-354.968] * (-354.243) [-356.638] (-354.602) (-355.877) -- 0:00:27
541500 -- (-357.492) [-355.001] (-358.346) (-356.217) * [-357.410] (-358.920) (-357.602) (-356.650) -- 0:00:27
542000 -- [-355.162] (-365.254) (-356.613) (-356.406) * [-356.600] (-356.913) (-354.985) (-358.859) -- 0:00:27
542500 -- (-354.761) [-355.984] (-357.229) (-355.085) * (-355.286) (-355.416) (-355.133) [-356.172] -- 0:00:26
543000 -- [-357.469] (-355.596) (-356.042) (-356.415) * (-355.158) (-354.827) [-358.224] (-356.001) -- 0:00:26
543500 -- (-355.990) (-357.755) [-357.162] (-358.597) * [-354.986] (-355.629) (-355.383) (-362.073) -- 0:00:26
544000 -- (-355.397) [-355.544] (-357.932) (-356.708) * [-354.439] (-355.195) (-355.600) (-354.242) -- 0:00:26
544500 -- [-358.223] (-357.193) (-357.377) (-357.837) * (-356.347) (-357.019) (-356.944) [-355.919] -- 0:00:26
545000 -- (-356.432) [-356.999] (-356.337) (-355.176) * (-356.995) (-357.527) (-355.532) [-357.857] -- 0:00:26
Average standard deviation of split frequencies: 0.009497
545500 -- (-356.306) (-356.395) (-358.060) [-356.056] * [-354.697] (-357.460) (-358.029) (-356.839) -- 0:00:26
546000 -- [-357.110] (-355.843) (-359.627) (-354.964) * [-354.788] (-356.385) (-355.904) (-355.543) -- 0:00:26
546500 -- [-357.511] (-356.543) (-358.072) (-354.976) * (-354.588) (-358.550) (-355.711) [-356.591] -- 0:00:26
547000 -- (-360.913) (-356.730) [-357.724] (-357.379) * (-355.666) (-355.906) (-355.438) [-358.840] -- 0:00:26
547500 -- (-358.591) (-356.762) [-357.261] (-358.101) * (-357.557) (-354.393) (-355.697) [-356.438] -- 0:00:26
548000 -- [-355.375] (-355.663) (-356.492) (-362.656) * [-355.119] (-356.263) (-356.376) (-360.604) -- 0:00:26
548500 -- (-365.451) [-357.649] (-356.652) (-357.670) * [-354.701] (-358.965) (-354.268) (-357.395) -- 0:00:26
549000 -- (-355.711) [-354.588] (-359.384) (-357.766) * (-357.667) (-356.954) [-356.729] (-355.581) -- 0:00:26
549500 -- (-355.329) [-356.107] (-355.616) (-354.040) * (-357.258) (-357.488) (-356.921) [-355.075] -- 0:00:26
550000 -- (-354.933) [-354.986] (-355.944) (-356.786) * (-355.320) (-355.706) (-364.500) [-355.795] -- 0:00:26
Average standard deviation of split frequencies: 0.009930
550500 -- (-360.680) [-356.868] (-356.023) (-356.265) * (-354.527) [-356.362] (-354.934) (-357.072) -- 0:00:26
551000 -- (-354.827) (-357.270) (-359.153) [-358.359] * (-355.378) (-357.759) (-355.406) [-355.924] -- 0:00:26
551500 -- (-357.036) (-356.290) [-355.722] (-354.733) * [-354.850] (-360.361) (-354.885) (-354.506) -- 0:00:26
552000 -- (-357.327) [-355.953] (-358.253) (-355.465) * (-358.530) (-354.080) [-357.390] (-356.528) -- 0:00:25
552500 -- (-358.982) (-356.768) (-357.953) [-354.545] * (-354.640) (-357.632) (-356.461) [-356.843] -- 0:00:26
553000 -- (-357.907) (-361.040) (-360.019) [-356.961] * (-357.948) (-358.091) (-355.275) [-355.899] -- 0:00:26
553500 -- (-357.499) (-354.442) (-357.547) [-358.897] * (-355.944) [-359.471] (-355.897) (-359.331) -- 0:00:26
554000 -- [-358.288] (-355.016) (-357.394) (-358.391) * [-356.113] (-360.918) (-359.714) (-355.737) -- 0:00:26
554500 -- [-354.965] (-357.862) (-356.222) (-354.475) * (-358.518) (-359.618) [-357.818] (-355.721) -- 0:00:26
555000 -- (-355.947) (-357.306) [-358.492] (-355.765) * (-357.830) (-356.009) (-355.638) [-356.077] -- 0:00:26
Average standard deviation of split frequencies: 0.009892
555500 -- [-356.870] (-355.163) (-356.282) (-355.721) * [-355.705] (-354.535) (-358.679) (-360.152) -- 0:00:26
556000 -- (-354.950) (-356.631) (-355.711) [-355.217] * (-355.425) [-356.752] (-356.308) (-357.124) -- 0:00:26
556500 -- (-356.348) (-357.076) [-355.129] (-355.714) * (-356.440) (-356.642) [-355.662] (-354.649) -- 0:00:26
557000 -- (-358.743) (-356.769) (-356.663) [-358.382] * (-359.380) [-360.139] (-356.424) (-356.986) -- 0:00:26
557500 -- (-356.176) [-354.811] (-355.443) (-356.978) * (-356.195) (-354.121) (-358.277) [-355.380] -- 0:00:26
558000 -- (-359.289) (-356.076) (-355.084) [-355.331] * [-356.374] (-354.138) (-355.778) (-354.996) -- 0:00:26
558500 -- [-355.876] (-355.441) (-355.963) (-354.836) * (-355.707) (-354.161) (-355.352) [-354.612] -- 0:00:26
559000 -- (-356.740) (-358.759) [-355.927] (-358.658) * (-356.202) [-354.369] (-356.950) (-355.497) -- 0:00:26
559500 -- (-356.030) [-357.069] (-356.199) (-355.398) * (-354.841) (-354.252) (-357.322) [-360.096] -- 0:00:25
560000 -- (-355.255) [-358.113] (-356.892) (-355.173) * [-357.133] (-354.995) (-359.429) (-362.732) -- 0:00:25
Average standard deviation of split frequencies: 0.010594
560500 -- (-357.741) (-354.345) (-355.902) [-354.154] * (-356.052) (-358.910) [-357.457] (-358.904) -- 0:00:25
561000 -- (-356.607) (-354.836) [-355.611] (-355.369) * (-355.501) (-358.412) [-355.642] (-360.074) -- 0:00:25
561500 -- (-355.722) (-357.850) (-357.599) [-357.420] * [-357.008] (-357.810) (-357.030) (-360.143) -- 0:00:25
562000 -- (-357.093) (-358.135) [-355.659] (-356.245) * (-358.514) (-356.948) [-356.134] (-356.505) -- 0:00:25
562500 -- (-355.101) [-354.789] (-355.358) (-357.311) * (-356.957) [-357.917] (-355.611) (-354.516) -- 0:00:25
563000 -- (-357.177) (-354.921) [-355.505] (-355.736) * (-359.178) (-359.320) (-355.684) [-355.743] -- 0:00:25
563500 -- (-355.795) [-355.466] (-356.686) (-356.371) * [-356.470] (-360.290) (-355.417) (-357.753) -- 0:00:25
564000 -- [-355.101] (-356.366) (-356.978) (-356.530) * [-355.737] (-354.674) (-357.293) (-354.705) -- 0:00:25
564500 -- [-355.921] (-355.761) (-357.054) (-356.232) * [-355.225] (-355.392) (-356.185) (-355.239) -- 0:00:25
565000 -- (-355.828) [-354.973] (-355.216) (-359.800) * (-356.185) [-356.081] (-356.504) (-356.453) -- 0:00:25
Average standard deviation of split frequencies: 0.009474
565500 -- (-357.815) [-359.488] (-356.235) (-360.074) * [-355.999] (-354.465) (-361.352) (-360.652) -- 0:00:25
566000 -- (-356.112) [-356.075] (-355.996) (-358.151) * (-359.721) (-360.503) [-354.930] (-361.436) -- 0:00:25
566500 -- (-358.196) (-357.427) [-356.735] (-354.599) * (-356.220) [-355.218] (-354.817) (-358.683) -- 0:00:25
567000 -- [-363.425] (-357.350) (-357.143) (-357.053) * (-357.839) (-355.948) [-355.232] (-355.454) -- 0:00:25
567500 -- (-360.135) (-355.835) [-355.808] (-356.026) * (-355.315) (-358.356) (-357.962) [-355.728] -- 0:00:25
568000 -- [-356.519] (-357.034) (-356.192) (-356.834) * (-355.640) (-356.583) (-354.776) [-355.495] -- 0:00:25
568500 -- (-355.299) [-358.048] (-356.601) (-356.743) * (-357.432) [-357.431] (-356.307) (-356.010) -- 0:00:25
569000 -- (-355.551) (-358.584) (-356.179) [-356.952] * (-354.435) [-354.576] (-356.393) (-355.093) -- 0:00:24
569500 -- [-355.811] (-357.891) (-359.192) (-358.751) * (-354.169) (-354.468) [-354.834] (-354.630) -- 0:00:24
570000 -- (-356.725) (-362.837) [-355.439] (-355.897) * (-355.333) [-358.308] (-357.151) (-356.500) -- 0:00:25
Average standard deviation of split frequencies: 0.009655
570500 -- [-355.401] (-359.431) (-356.458) (-357.710) * (-359.075) (-355.942) [-356.279] (-361.432) -- 0:00:25
571000 -- [-354.886] (-360.793) (-356.286) (-361.885) * (-361.852) (-362.397) (-354.961) [-355.900] -- 0:00:25
571500 -- [-355.477] (-354.255) (-355.401) (-362.126) * (-362.256) (-355.746) (-356.137) [-356.094] -- 0:00:25
572000 -- (-356.284) (-354.686) [-355.366] (-357.964) * [-356.306] (-360.406) (-360.460) (-355.573) -- 0:00:25
572500 -- (-357.327) (-354.787) [-356.506] (-355.171) * (-357.917) (-357.431) [-361.757] (-354.512) -- 0:00:25
573000 -- (-359.973) (-354.309) (-355.549) [-356.452] * [-354.602] (-357.704) (-355.659) (-356.624) -- 0:00:25
573500 -- (-357.920) [-355.655] (-355.853) (-355.299) * [-357.662] (-355.037) (-356.044) (-355.460) -- 0:00:25
574000 -- (-356.696) [-355.304] (-355.400) (-355.811) * (-354.841) (-359.960) (-355.575) [-356.008] -- 0:00:25
574500 -- (-357.748) [-356.567] (-355.113) (-361.874) * (-357.003) (-355.474) (-355.490) [-354.746] -- 0:00:25
575000 -- (-356.433) (-359.419) [-357.522] (-358.722) * (-358.617) [-355.532] (-357.000) (-359.906) -- 0:00:25
Average standard deviation of split frequencies: 0.010257
575500 -- [-355.964] (-357.238) (-357.003) (-359.681) * (-355.377) (-355.332) (-356.437) [-358.040] -- 0:00:25
576000 -- [-356.298] (-359.060) (-356.070) (-356.066) * [-356.020] (-355.900) (-357.744) (-355.780) -- 0:00:25
576500 -- (-358.670) (-355.588) (-356.652) [-354.588] * [-357.169] (-354.661) (-356.222) (-358.064) -- 0:00:24
577000 -- (-361.097) (-359.625) (-363.913) [-356.716] * (-360.336) (-355.355) [-355.397] (-361.855) -- 0:00:24
577500 -- (-356.522) (-362.489) (-356.732) [-356.656] * [-356.815] (-356.871) (-356.962) (-357.095) -- 0:00:24
578000 -- (-356.723) (-358.779) (-357.737) [-355.039] * (-355.646) [-356.575] (-354.753) (-355.972) -- 0:00:24
578500 -- (-354.830) (-358.451) [-358.292] (-357.131) * (-355.222) (-355.869) (-354.452) [-356.597] -- 0:00:24
579000 -- (-359.589) [-355.125] (-357.166) (-357.163) * (-355.667) [-354.776] (-365.315) (-355.732) -- 0:00:24
579500 -- (-357.345) (-355.473) (-354.555) [-357.407] * [-356.242] (-354.639) (-357.090) (-356.058) -- 0:00:24
580000 -- (-354.694) (-355.237) [-358.912] (-357.029) * (-355.677) (-355.792) [-357.459] (-356.735) -- 0:00:24
Average standard deviation of split frequencies: 0.010097
580500 -- (-356.423) (-356.965) [-359.393] (-357.538) * [-354.727] (-355.448) (-355.824) (-356.217) -- 0:00:24
581000 -- (-355.401) [-357.484] (-356.427) (-355.944) * (-360.044) (-355.707) (-359.427) [-354.838] -- 0:00:24
581500 -- [-355.167] (-356.083) (-356.984) (-355.100) * (-356.575) [-355.131] (-355.814) (-356.611) -- 0:00:24
582000 -- (-355.424) (-357.583) [-357.295] (-355.977) * (-355.919) (-357.120) [-355.503] (-356.109) -- 0:00:24
582500 -- (-354.110) (-358.680) (-354.031) [-357.361] * (-362.282) (-358.529) [-356.237] (-358.293) -- 0:00:24
583000 -- (-354.312) (-358.201) [-354.395] (-359.339) * (-357.724) (-357.412) [-355.510] (-361.283) -- 0:00:24
583500 -- [-354.774] (-357.048) (-354.440) (-355.162) * (-354.408) (-359.797) [-356.492] (-356.682) -- 0:00:24
584000 -- (-359.417) (-357.219) (-355.004) [-355.829] * (-361.068) (-355.886) (-361.958) [-356.642] -- 0:00:24
584500 -- (-356.602) [-355.305] (-356.841) (-358.433) * [-360.558] (-354.717) (-354.392) (-356.775) -- 0:00:24
585000 -- (-359.871) [-354.770] (-359.564) (-357.335) * [-356.710] (-354.827) (-354.562) (-354.934) -- 0:00:24
Average standard deviation of split frequencies: 0.009704
585500 -- [-356.072] (-357.821) (-355.648) (-356.199) * (-360.999) (-355.268) [-355.639] (-361.914) -- 0:00:24
586000 -- (-359.502) (-355.794) [-357.637] (-356.414) * [-355.245] (-360.862) (-355.867) (-354.282) -- 0:00:24
586500 -- (-359.068) [-354.901] (-358.935) (-359.393) * [-354.561] (-355.523) (-356.400) (-356.223) -- 0:00:23
587000 -- (-358.335) (-356.309) (-360.287) [-357.226] * (-354.911) (-355.688) [-355.394] (-355.863) -- 0:00:24
587500 -- (-355.762) (-354.800) (-357.977) [-356.636] * (-354.372) (-354.103) [-358.782] (-356.879) -- 0:00:24
588000 -- (-356.162) [-355.851] (-357.407) (-356.716) * (-355.825) (-354.697) (-357.304) [-355.496] -- 0:00:24
588500 -- (-355.756) (-356.956) [-357.604] (-359.979) * (-356.033) (-355.464) [-356.887] (-355.484) -- 0:00:24
589000 -- [-357.490] (-355.704) (-357.311) (-354.591) * (-358.130) [-354.896] (-357.564) (-355.951) -- 0:00:24
589500 -- (-357.288) (-356.329) [-358.412] (-355.924) * (-356.478) (-355.935) (-355.548) [-354.750] -- 0:00:24
590000 -- (-356.684) (-356.115) [-355.623] (-356.009) * [-360.210] (-355.051) (-356.907) (-355.424) -- 0:00:24
Average standard deviation of split frequencies: 0.009843
590500 -- (-356.811) [-358.521] (-356.505) (-355.772) * (-357.777) [-355.971] (-356.332) (-355.497) -- 0:00:24
591000 -- (-358.580) [-354.893] (-354.085) (-356.866) * [-355.868] (-358.937) (-358.071) (-355.567) -- 0:00:24
591500 -- (-360.399) (-355.683) [-355.375] (-359.797) * (-358.953) (-356.073) (-357.466) [-355.781] -- 0:00:24
592000 -- (-356.725) (-354.999) (-357.414) [-358.301] * [-354.563] (-361.544) (-357.376) (-357.205) -- 0:00:24
592500 -- (-356.136) [-357.319] (-356.635) (-357.254) * (-360.033) (-355.757) (-355.141) [-359.179] -- 0:00:24
593000 -- [-355.480] (-357.429) (-357.242) (-360.015) * (-357.224) (-355.038) (-355.279) [-355.446] -- 0:00:24
593500 -- (-355.058) (-358.985) [-355.804] (-355.377) * (-357.603) (-356.647) [-355.962] (-355.218) -- 0:00:23
594000 -- (-355.156) [-358.283] (-355.192) (-355.888) * (-356.840) [-355.709] (-355.092) (-354.695) -- 0:00:23
594500 -- [-355.886] (-357.371) (-356.100) (-361.421) * [-358.642] (-355.629) (-355.815) (-357.875) -- 0:00:23
595000 -- (-356.705) (-354.428) (-357.357) [-354.715] * (-358.784) [-356.847] (-356.236) (-356.482) -- 0:00:23
Average standard deviation of split frequencies: 0.009640
595500 -- (-356.016) [-357.494] (-362.052) (-356.235) * (-356.200) (-355.574) (-355.695) [-357.822] -- 0:00:23
596000 -- (-359.376) (-355.703) (-355.990) [-354.789] * (-355.596) (-356.027) [-355.422] (-358.158) -- 0:00:23
596500 -- (-356.575) (-355.058) [-354.160] (-361.024) * (-355.028) (-356.371) [-355.994] (-355.229) -- 0:00:23
597000 -- (-356.919) (-355.416) [-357.051] (-355.578) * (-355.824) (-359.670) (-356.807) [-356.056] -- 0:00:23
597500 -- (-357.084) [-354.678] (-355.312) (-356.539) * (-356.003) (-364.585) (-354.161) [-357.389] -- 0:00:23
598000 -- (-358.175) [-355.883] (-355.693) (-356.832) * (-359.222) (-359.833) [-354.646] (-358.634) -- 0:00:23
598500 -- (-356.204) (-355.736) [-355.448] (-355.365) * (-370.370) [-357.640] (-355.537) (-356.112) -- 0:00:23
599000 -- [-358.691] (-355.799) (-355.611) (-358.355) * (-363.251) (-360.479) (-358.623) [-355.688] -- 0:00:23
599500 -- (-356.605) (-354.129) (-357.345) [-355.966] * (-359.150) (-355.512) (-357.668) [-357.524] -- 0:00:23
600000 -- (-357.602) (-357.486) (-355.430) [-354.754] * (-357.675) (-357.465) [-355.176] (-358.278) -- 0:00:23
Average standard deviation of split frequencies: 0.009784
600500 -- (-358.127) (-356.275) [-358.272] (-358.737) * (-355.820) [-357.745] (-358.276) (-355.889) -- 0:00:23
601000 -- (-356.453) [-358.967] (-355.540) (-355.205) * (-358.763) [-356.262] (-356.665) (-360.383) -- 0:00:23
601500 -- (-358.517) [-357.501] (-354.802) (-357.310) * (-356.399) (-356.486) [-354.713] (-356.130) -- 0:00:23
602000 -- (-356.128) (-359.641) (-356.456) [-354.626] * [-355.466] (-357.644) (-355.712) (-360.899) -- 0:00:23
602500 -- [-357.057] (-355.499) (-357.110) (-357.275) * (-354.216) (-355.943) [-356.100] (-355.792) -- 0:00:23
603000 -- [-355.577] (-362.307) (-357.224) (-356.182) * [-355.057] (-362.432) (-356.670) (-357.100) -- 0:00:23
603500 -- [-355.040] (-357.574) (-356.163) (-356.239) * (-354.574) (-355.854) (-356.825) [-357.737] -- 0:00:22
604000 -- [-357.349] (-358.203) (-356.661) (-354.089) * (-358.203) (-355.647) [-356.742] (-357.640) -- 0:00:22
604500 -- (-355.714) [-354.950] (-357.013) (-356.538) * (-355.028) (-355.831) (-364.689) [-355.242] -- 0:00:23
605000 -- [-356.572] (-359.032) (-355.960) (-357.668) * (-355.791) (-357.732) [-357.303] (-357.980) -- 0:00:23
Average standard deviation of split frequencies: 0.009383
605500 -- [-355.557] (-360.412) (-358.831) (-358.943) * [-354.566] (-357.653) (-361.460) (-360.407) -- 0:00:23
606000 -- (-356.875) (-356.467) (-356.111) [-357.954] * (-358.373) [-355.397] (-355.800) (-361.640) -- 0:00:23
606500 -- (-356.850) (-354.298) [-354.828] (-355.484) * [-357.158] (-360.531) (-356.432) (-358.489) -- 0:00:23
607000 -- (-356.151) (-354.157) (-357.146) [-358.156] * (-356.475) (-358.204) (-356.851) [-355.319] -- 0:00:23
607500 -- (-357.231) (-355.960) (-359.196) [-358.039] * (-356.355) [-355.845] (-357.305) (-359.615) -- 0:00:23
608000 -- (-360.532) (-357.780) [-355.134] (-355.703) * (-358.304) (-358.393) (-356.536) [-354.941] -- 0:00:23
608500 -- (-357.596) (-361.099) (-355.096) [-356.889] * [-358.474] (-361.752) (-357.661) (-354.685) -- 0:00:23
609000 -- [-356.088] (-354.958) (-354.912) (-355.285) * (-354.361) [-356.623] (-357.255) (-355.341) -- 0:00:23
609500 -- (-356.798) [-357.275] (-355.224) (-358.993) * (-355.095) (-356.693) (-357.361) [-355.060] -- 0:00:23
610000 -- (-357.117) (-357.754) [-355.061] (-358.697) * (-358.759) (-354.952) (-359.219) [-357.405] -- 0:00:23
Average standard deviation of split frequencies: 0.009070
610500 -- [-355.307] (-357.945) (-359.840) (-357.397) * (-356.951) (-355.021) [-357.489] (-357.459) -- 0:00:22
611000 -- (-358.518) [-355.524] (-355.414) (-358.360) * (-355.631) (-359.040) (-356.082) [-354.978] -- 0:00:22
611500 -- (-361.136) (-357.853) (-358.674) [-354.505] * (-354.799) (-354.857) (-358.762) [-355.095] -- 0:00:22
612000 -- (-356.619) (-355.738) (-358.208) [-354.729] * (-355.831) (-356.926) (-358.096) [-357.874] -- 0:00:22
612500 -- (-356.190) (-356.013) (-358.708) [-354.299] * (-356.453) (-356.108) (-357.815) [-358.260] -- 0:00:22
613000 -- (-358.785) [-357.589] (-358.951) (-354.217) * (-356.536) (-356.022) (-357.197) [-358.373] -- 0:00:22
613500 -- (-356.814) [-355.397] (-355.459) (-358.664) * (-357.608) (-361.698) (-355.010) [-355.314] -- 0:00:22
614000 -- [-360.007] (-356.898) (-357.298) (-354.493) * (-358.051) (-361.723) [-355.215] (-358.950) -- 0:00:22
614500 -- [-357.541] (-355.001) (-356.750) (-354.739) * (-355.961) [-356.005] (-355.636) (-355.631) -- 0:00:22
615000 -- (-359.558) [-356.243] (-357.669) (-356.356) * (-356.047) [-355.083] (-354.724) (-355.150) -- 0:00:22
Average standard deviation of split frequencies: 0.008801
615500 -- (-359.130) [-355.385] (-359.097) (-355.629) * (-357.002) (-355.608) (-360.812) [-356.287] -- 0:00:22
616000 -- (-359.721) [-356.062] (-355.830) (-356.918) * (-355.444) [-355.104] (-358.891) (-355.303) -- 0:00:22
616500 -- (-361.507) (-355.760) [-357.152] (-356.217) * [-354.245] (-368.051) (-357.507) (-358.247) -- 0:00:22
617000 -- (-355.421) (-355.451) (-359.981) [-354.121] * [-357.002] (-354.707) (-356.704) (-357.621) -- 0:00:22
617500 -- (-355.071) (-356.295) (-357.063) [-355.097] * (-358.713) (-354.377) (-355.120) [-358.114] -- 0:00:22
618000 -- (-357.026) (-356.021) [-355.772] (-354.986) * (-355.775) (-355.061) [-355.545] (-359.374) -- 0:00:22
618500 -- (-358.478) (-355.611) (-359.992) [-355.488] * (-355.787) (-360.232) [-355.554] (-354.999) -- 0:00:22
619000 -- (-356.674) (-355.584) [-356.803] (-355.156) * (-356.669) (-358.754) (-359.082) [-354.651] -- 0:00:22
619500 -- (-356.186) (-355.053) [-358.600] (-359.506) * [-354.640] (-357.258) (-356.205) (-357.857) -- 0:00:22
620000 -- (-359.733) [-355.988] (-355.997) (-355.573) * (-354.471) (-358.190) (-356.208) [-356.213] -- 0:00:22
Average standard deviation of split frequencies: 0.009019
620500 -- (-360.048) (-356.801) (-355.495) [-354.646] * (-357.783) (-359.031) [-355.777] (-355.094) -- 0:00:22
621000 -- (-357.768) [-355.548] (-355.341) (-357.311) * (-355.638) (-358.492) [-356.582] (-355.925) -- 0:00:21
621500 -- (-359.695) (-354.974) (-357.572) [-358.391] * [-355.476] (-355.508) (-355.499) (-355.173) -- 0:00:22
622000 -- (-358.017) [-355.698] (-355.895) (-361.305) * [-355.223] (-359.508) (-357.462) (-356.043) -- 0:00:22
622500 -- [-356.909] (-357.577) (-354.469) (-357.666) * (-358.505) [-360.026] (-358.436) (-355.808) -- 0:00:22
623000 -- (-357.933) (-358.823) [-357.906] (-355.675) * (-356.369) [-356.249] (-360.561) (-356.585) -- 0:00:22
623500 -- [-358.188] (-355.300) (-355.660) (-355.305) * (-355.978) [-356.091] (-357.629) (-357.176) -- 0:00:22
624000 -- (-357.471) (-359.161) (-357.554) [-355.090] * (-356.212) (-354.824) (-356.370) [-355.755] -- 0:00:22
624500 -- [-356.047] (-357.139) (-357.856) (-358.335) * (-359.325) (-355.809) (-355.459) [-355.716] -- 0:00:22
625000 -- (-354.726) (-357.992) (-355.776) [-354.120] * [-356.200] (-363.225) (-356.999) (-357.272) -- 0:00:22
Average standard deviation of split frequencies: 0.009272
625500 -- (-358.304) [-355.463] (-360.141) (-355.271) * (-355.487) (-360.957) (-357.610) [-357.364] -- 0:00:22
626000 -- (-356.625) (-358.446) [-358.681] (-354.740) * (-355.243) [-356.449] (-358.696) (-357.147) -- 0:00:22
626500 -- (-357.609) [-355.313] (-355.789) (-356.418) * (-355.102) (-357.390) (-356.328) [-356.961] -- 0:00:22
627000 -- (-358.062) (-356.009) [-355.761] (-363.644) * (-356.012) [-359.009] (-358.576) (-355.169) -- 0:00:22
627500 -- (-355.698) (-356.387) [-356.288] (-355.709) * (-356.417) (-359.430) (-354.982) [-357.632] -- 0:00:21
628000 -- (-359.377) [-356.738] (-357.552) (-356.959) * (-360.656) (-355.577) (-356.524) [-361.454] -- 0:00:21
628500 -- (-356.013) (-358.817) (-357.562) [-356.437] * (-356.895) (-361.644) (-356.425) [-356.544] -- 0:00:21
629000 -- [-355.657] (-355.235) (-356.774) (-359.655) * (-356.697) (-355.658) (-356.549) [-357.218] -- 0:00:21
629500 -- (-356.596) (-355.635) [-354.560] (-356.557) * (-356.366) [-357.570] (-357.481) (-360.024) -- 0:00:21
630000 -- (-356.909) (-355.416) (-359.613) [-355.626] * (-357.109) (-356.671) [-358.046] (-360.425) -- 0:00:21
Average standard deviation of split frequencies: 0.009811
630500 -- (-358.816) [-354.343] (-356.613) (-355.589) * (-357.775) [-363.815] (-357.238) (-361.067) -- 0:00:21
631000 -- [-355.178] (-361.884) (-357.039) (-357.837) * (-355.415) [-354.987] (-356.274) (-355.283) -- 0:00:21
631500 -- [-357.422] (-355.622) (-360.015) (-356.233) * [-355.034] (-354.756) (-357.707) (-356.482) -- 0:00:21
632000 -- (-354.114) (-360.822) (-356.007) [-357.666] * [-354.723] (-357.331) (-358.666) (-359.961) -- 0:00:21
632500 -- [-356.685] (-356.564) (-357.250) (-359.357) * (-362.212) (-355.066) [-359.084] (-354.547) -- 0:00:21
633000 -- (-357.294) [-355.481] (-355.622) (-356.169) * [-355.680] (-356.411) (-359.205) (-354.823) -- 0:00:21
633500 -- (-357.016) [-355.335] (-354.209) (-354.669) * [-356.633] (-355.256) (-354.734) (-357.397) -- 0:00:21
634000 -- (-355.179) (-355.344) (-359.221) [-355.616] * (-358.986) (-355.889) (-356.876) [-358.572] -- 0:00:21
634500 -- (-356.220) [-356.542] (-360.297) (-357.878) * (-356.288) (-357.906) [-354.620] (-357.113) -- 0:00:21
635000 -- (-354.755) (-356.623) [-355.392] (-357.024) * (-358.904) [-355.358] (-354.521) (-356.779) -- 0:00:21
Average standard deviation of split frequencies: 0.009682
635500 -- (-356.281) (-355.839) [-355.990] (-355.240) * [-356.857] (-356.946) (-356.402) (-357.281) -- 0:00:21
636000 -- (-355.847) (-355.840) [-355.152] (-354.794) * [-355.741] (-357.269) (-354.782) (-354.816) -- 0:00:21
636500 -- (-356.367) (-356.064) [-356.731] (-355.923) * [-354.765] (-357.711) (-354.577) (-357.396) -- 0:00:21
637000 -- (-356.834) (-354.799) (-356.005) [-355.222] * (-356.354) (-356.284) (-355.483) [-355.126] -- 0:00:21
637500 -- (-357.197) (-354.540) [-361.368] (-358.018) * (-356.932) (-356.424) [-356.272] (-361.546) -- 0:00:21
638000 -- [-357.375] (-354.882) (-356.517) (-356.965) * [-356.043] (-354.639) (-356.129) (-355.228) -- 0:00:20
638500 -- (-355.726) (-354.880) [-355.682] (-355.768) * (-354.782) (-357.523) (-355.841) [-360.058] -- 0:00:20
639000 -- [-354.796] (-355.681) (-355.014) (-356.210) * (-357.134) (-358.535) (-354.763) [-357.554] -- 0:00:21
639500 -- [-357.555] (-357.100) (-358.571) (-354.653) * [-359.256] (-355.868) (-356.447) (-354.648) -- 0:00:21
640000 -- (-356.494) (-355.369) [-356.873] (-354.869) * (-356.127) (-355.061) [-356.681] (-355.727) -- 0:00:21
Average standard deviation of split frequencies: 0.009611
640500 -- (-356.101) [-358.766] (-358.444) (-357.693) * [-357.016] (-357.903) (-355.542) (-355.485) -- 0:00:21
641000 -- (-358.445) (-360.512) [-355.108] (-355.418) * (-355.729) [-354.299] (-368.598) (-354.683) -- 0:00:21
641500 -- [-356.555] (-360.502) (-356.674) (-362.284) * (-359.312) [-355.509] (-359.110) (-354.563) -- 0:00:21
642000 -- (-356.253) (-360.844) [-356.339] (-357.561) * (-356.174) (-356.455) (-354.696) [-356.245] -- 0:00:21
642500 -- (-355.897) (-355.418) (-355.985) [-357.316] * (-356.309) (-354.546) [-358.285] (-356.359) -- 0:00:21
643000 -- (-355.476) (-355.504) (-356.040) [-358.230] * (-357.749) (-355.904) (-358.933) [-356.782] -- 0:00:21
643500 -- (-362.153) (-360.730) (-357.458) [-354.406] * [-356.896] (-359.243) (-356.439) (-356.370) -- 0:00:21
644000 -- (-356.387) (-355.762) [-355.524] (-358.017) * (-357.070) (-357.493) [-356.544] (-362.592) -- 0:00:21
644500 -- (-355.348) [-355.228] (-354.303) (-357.852) * [-356.736] (-359.459) (-358.542) (-359.642) -- 0:00:20
645000 -- [-356.561] (-355.580) (-359.615) (-355.526) * (-357.683) (-356.354) [-356.146] (-356.008) -- 0:00:20
Average standard deviation of split frequencies: 0.009304
645500 -- (-358.204) [-354.145] (-360.109) (-356.721) * (-358.915) (-355.085) (-356.268) [-356.231] -- 0:00:20
646000 -- [-355.597] (-356.558) (-354.850) (-357.030) * (-356.801) (-357.869) (-355.258) [-355.441] -- 0:00:20
646500 -- (-355.534) [-354.191] (-355.325) (-357.511) * (-359.073) (-357.782) (-354.343) [-357.479] -- 0:00:20
647000 -- (-355.125) (-355.941) [-357.793] (-358.270) * (-357.022) (-357.586) (-356.381) [-356.061] -- 0:00:20
647500 -- [-355.337] (-358.499) (-357.967) (-357.321) * (-357.357) [-358.124] (-354.753) (-362.051) -- 0:00:20
648000 -- (-356.517) [-355.299] (-357.365) (-357.665) * [-355.234] (-363.498) (-354.840) (-357.223) -- 0:00:20
648500 -- (-355.253) [-356.217] (-359.455) (-355.130) * [-357.980] (-355.156) (-355.901) (-356.969) -- 0:00:20
649000 -- [-356.120] (-356.514) (-357.495) (-356.504) * (-359.689) (-357.712) (-355.984) [-355.677] -- 0:00:20
649500 -- (-355.437) (-356.890) (-355.338) [-355.018] * (-357.684) (-357.109) [-357.527] (-356.119) -- 0:00:20
650000 -- [-355.390] (-355.417) (-358.014) (-356.980) * (-355.439) [-355.913] (-358.006) (-357.838) -- 0:00:20
Average standard deviation of split frequencies: 0.009192
650500 -- [-356.236] (-356.443) (-358.442) (-356.199) * (-357.126) (-356.817) [-359.057] (-356.092) -- 0:00:20
651000 -- [-358.567] (-359.328) (-355.897) (-359.112) * (-355.826) (-361.302) (-355.154) [-354.786] -- 0:00:20
651500 -- (-360.122) [-359.699] (-355.553) (-358.030) * (-356.425) (-356.814) [-355.522] (-355.166) -- 0:00:20
652000 -- [-361.706] (-358.078) (-354.993) (-355.411) * (-356.570) [-355.227] (-355.102) (-361.247) -- 0:00:20
652500 -- (-357.976) (-356.262) [-355.925] (-359.389) * (-356.118) (-357.442) (-355.695) [-356.783] -- 0:00:20
653000 -- (-359.379) [-355.873] (-357.637) (-355.004) * [-356.873] (-356.123) (-359.869) (-357.596) -- 0:00:20
653500 -- (-356.984) (-359.393) [-359.168] (-360.886) * [-358.406] (-355.531) (-355.795) (-359.272) -- 0:00:20
654000 -- (-358.275) (-356.143) [-355.026] (-361.269) * [-357.422] (-357.185) (-355.846) (-357.997) -- 0:00:20
654500 -- (-356.535) (-359.354) [-355.338] (-357.788) * (-358.883) (-354.139) (-357.906) [-358.890] -- 0:00:20
655000 -- (-357.305) [-359.795] (-355.195) (-356.381) * (-360.652) [-358.474] (-358.725) (-357.360) -- 0:00:20
Average standard deviation of split frequencies: 0.008758
655500 -- (-356.779) [-360.464] (-358.452) (-356.186) * (-355.502) (-359.451) (-357.597) [-355.848] -- 0:00:19
656000 -- (-356.296) [-355.326] (-357.041) (-356.434) * [-355.467] (-359.298) (-355.917) (-356.028) -- 0:00:20
656500 -- [-355.670] (-358.623) (-355.435) (-356.592) * (-355.342) [-356.015] (-355.625) (-356.861) -- 0:00:20
657000 -- (-355.616) [-355.855] (-354.469) (-359.794) * (-356.568) (-355.656) (-355.008) [-359.246] -- 0:00:20
657500 -- (-358.982) (-355.638) (-356.225) [-361.755] * (-356.683) (-354.808) [-357.473] (-354.267) -- 0:00:20
658000 -- (-361.948) (-357.220) (-356.359) [-359.553] * (-355.111) (-354.910) (-355.159) [-354.742] -- 0:00:20
658500 -- (-361.360) [-356.429] (-356.833) (-359.434) * (-356.117) (-357.975) [-354.864] (-358.346) -- 0:00:20
659000 -- (-356.847) (-355.904) [-357.443] (-356.293) * (-356.225) [-358.587] (-363.587) (-364.515) -- 0:00:20
659500 -- (-357.220) (-356.305) [-356.984] (-357.294) * (-358.328) [-354.486] (-356.653) (-354.121) -- 0:00:20
660000 -- (-357.151) (-356.182) (-355.763) [-360.140] * (-354.698) (-357.553) (-356.892) [-357.506] -- 0:00:20
Average standard deviation of split frequencies: 0.008785
660500 -- (-356.048) (-358.076) (-356.796) [-354.907] * (-355.390) [-355.716] (-355.882) (-356.645) -- 0:00:20
661000 -- [-357.365] (-358.720) (-354.876) (-355.898) * [-357.975] (-355.799) (-357.670) (-355.118) -- 0:00:20
661500 -- (-361.074) (-363.580) [-354.641] (-355.331) * (-359.117) [-357.340] (-358.286) (-355.105) -- 0:00:19
662000 -- (-355.244) [-355.491] (-355.542) (-357.632) * (-355.079) (-363.813) [-355.899] (-358.427) -- 0:00:19
662500 -- (-355.017) (-356.209) [-355.601] (-356.606) * (-354.765) (-355.746) (-355.610) [-356.174] -- 0:00:19
663000 -- (-357.751) (-361.498) (-357.330) [-358.698] * [-357.501] (-354.639) (-356.670) (-354.558) -- 0:00:19
663500 -- (-357.836) (-355.481) [-357.592] (-356.726) * (-356.628) (-356.638) [-357.858] (-354.147) -- 0:00:19
664000 -- (-356.162) (-361.993) (-355.793) [-355.587] * [-357.954] (-357.476) (-355.899) (-358.532) -- 0:00:19
664500 -- (-357.962) [-355.599] (-356.227) (-354.812) * [-359.063] (-357.352) (-356.840) (-358.874) -- 0:00:19
665000 -- (-355.712) (-354.735) [-356.101] (-355.021) * (-359.291) [-357.728] (-356.600) (-355.026) -- 0:00:19
Average standard deviation of split frequencies: 0.008582
665500 -- (-355.368) (-358.787) [-356.924] (-357.793) * (-359.952) (-360.808) [-357.796] (-354.405) -- 0:00:19
666000 -- (-354.658) (-361.125) [-355.866] (-356.371) * (-359.177) (-360.544) (-355.214) [-354.964] -- 0:00:19
666500 -- (-355.626) (-357.914) [-354.704] (-357.861) * (-364.209) (-354.693) [-354.799] (-359.907) -- 0:00:19
667000 -- (-357.338) (-357.207) (-357.884) [-357.124] * (-357.578) [-356.961] (-358.960) (-356.948) -- 0:00:19
667500 -- (-355.454) (-354.926) (-356.270) [-355.986] * (-356.038) (-355.715) [-357.511] (-358.615) -- 0:00:19
668000 -- (-358.433) (-354.628) (-355.418) [-357.533] * (-355.953) [-356.160] (-355.737) (-354.695) -- 0:00:19
668500 -- [-356.810] (-356.627) (-357.548) (-360.563) * [-355.645] (-356.409) (-358.320) (-361.405) -- 0:00:19
669000 -- (-355.031) (-361.442) (-359.268) [-355.379] * (-355.798) (-354.656) [-358.401] (-358.788) -- 0:00:19
669500 -- [-355.211] (-355.815) (-357.005) (-361.736) * (-356.868) (-354.547) (-357.104) [-355.946] -- 0:00:19
670000 -- (-355.020) (-354.215) (-355.684) [-355.267] * (-355.933) (-355.503) [-356.584] (-359.356) -- 0:00:19
Average standard deviation of split frequencies: 0.008127
670500 -- [-355.869] (-354.811) (-354.387) (-355.449) * (-355.466) [-354.471] (-357.392) (-356.462) -- 0:00:19
671000 -- (-356.874) (-357.666) [-354.184] (-357.308) * (-357.365) (-355.577) [-355.848] (-356.697) -- 0:00:19
671500 -- (-356.024) (-362.175) (-355.519) [-354.730] * (-357.042) (-356.670) [-354.594] (-357.139) -- 0:00:19
672000 -- [-356.403] (-360.688) (-354.537) (-357.597) * (-357.201) (-355.745) [-354.662] (-355.150) -- 0:00:19
672500 -- (-354.796) (-363.040) [-355.090] (-356.299) * (-355.477) (-354.339) (-356.203) [-354.538] -- 0:00:18
673000 -- [-356.978] (-358.643) (-356.398) (-354.730) * [-355.631] (-355.601) (-355.934) (-356.472) -- 0:00:19
673500 -- [-355.227] (-357.254) (-357.314) (-355.577) * (-356.284) [-357.020] (-356.306) (-357.125) -- 0:00:19
674000 -- (-355.453) [-356.334] (-356.610) (-357.130) * (-356.593) [-355.489] (-358.038) (-358.514) -- 0:00:19
674500 -- (-356.257) [-358.228] (-356.865) (-359.990) * [-358.094] (-359.415) (-360.297) (-363.045) -- 0:00:19
675000 -- (-355.059) [-360.627] (-357.046) (-356.070) * (-357.758) (-360.477) (-356.140) [-356.041] -- 0:00:19
Average standard deviation of split frequencies: 0.008194
675500 -- (-354.238) (-354.675) (-355.939) [-355.709] * (-356.110) (-357.590) (-356.763) [-357.646] -- 0:00:19
676000 -- (-358.655) (-357.749) [-357.075] (-355.644) * (-355.658) [-355.865] (-357.788) (-354.606) -- 0:00:19
676500 -- (-356.862) (-356.090) (-356.688) [-355.529] * (-356.194) (-356.320) [-355.919] (-356.952) -- 0:00:19
677000 -- (-358.174) (-357.461) (-355.210) [-355.091] * (-357.224) [-356.585] (-356.568) (-355.431) -- 0:00:19
677500 -- (-355.556) [-359.059] (-355.955) (-356.575) * [-358.051] (-360.992) (-356.163) (-355.911) -- 0:00:19
678000 -- (-355.554) [-355.602] (-355.771) (-358.401) * (-359.347) (-355.670) [-355.881] (-356.059) -- 0:00:18
678500 -- (-357.174) (-355.888) [-356.487] (-355.754) * (-357.681) [-356.268] (-358.701) (-354.750) -- 0:00:18
679000 -- (-358.937) (-357.320) [-357.807] (-356.302) * [-356.887] (-356.173) (-357.966) (-357.316) -- 0:00:18
679500 -- (-355.004) [-355.355] (-360.144) (-357.456) * [-356.564] (-357.249) (-357.184) (-357.900) -- 0:00:18
680000 -- [-355.201] (-357.337) (-358.088) (-357.446) * (-355.488) (-358.454) (-355.207) [-356.011] -- 0:00:18
Average standard deviation of split frequencies: 0.008441
680500 -- [-359.510] (-357.723) (-356.712) (-357.175) * [-356.878] (-357.270) (-355.559) (-357.314) -- 0:00:18
681000 -- (-355.238) [-354.485] (-355.730) (-361.248) * (-355.671) (-357.680) [-354.480] (-357.146) -- 0:00:18
681500 -- [-362.425] (-355.971) (-355.454) (-356.061) * [-355.337] (-358.698) (-354.401) (-361.996) -- 0:00:18
682000 -- (-357.454) (-355.112) (-356.214) [-354.945] * [-356.655] (-356.068) (-356.937) (-355.031) -- 0:00:18
682500 -- (-357.121) (-357.369) [-357.776] (-359.941) * [-356.586] (-356.644) (-354.852) (-358.235) -- 0:00:18
683000 -- [-355.541] (-355.116) (-354.677) (-357.516) * (-354.979) (-355.859) [-354.773] (-356.968) -- 0:00:18
683500 -- (-355.281) (-356.659) (-357.473) [-357.899] * (-354.854) (-361.407) [-357.989] (-356.053) -- 0:00:18
684000 -- (-355.586) [-357.176] (-358.413) (-357.712) * [-356.034] (-355.281) (-357.937) (-356.512) -- 0:00:18
684500 -- (-359.487) (-356.193) (-355.213) [-357.966] * [-360.088] (-357.417) (-357.768) (-358.999) -- 0:00:18
685000 -- (-355.959) [-359.796] (-356.272) (-355.199) * [-357.974] (-356.122) (-358.347) (-355.002) -- 0:00:18
Average standard deviation of split frequencies: 0.008289
685500 -- (-358.030) (-356.574) [-355.419] (-355.971) * (-358.214) (-357.865) [-355.152] (-355.935) -- 0:00:18
686000 -- (-354.177) (-354.166) (-356.491) [-357.617] * (-356.504) [-355.386] (-355.276) (-356.365) -- 0:00:18
686500 -- (-356.577) (-356.680) (-355.420) [-357.413] * (-355.997) (-361.400) (-360.564) [-360.364] -- 0:00:18
687000 -- (-354.256) (-355.637) (-356.188) [-356.055] * (-357.702) [-358.919] (-356.278) (-356.774) -- 0:00:18
687500 -- [-354.669] (-356.998) (-357.078) (-362.468) * (-357.013) [-358.810] (-356.888) (-356.533) -- 0:00:18
688000 -- [-355.458] (-361.679) (-357.858) (-357.757) * (-358.459) (-357.739) (-356.416) [-356.479] -- 0:00:18
688500 -- (-355.656) (-361.882) [-357.301] (-360.926) * (-355.048) (-359.284) [-356.300] (-357.902) -- 0:00:18
689000 -- (-354.795) (-357.060) [-355.774] (-360.125) * (-356.281) (-360.211) [-355.753] (-360.261) -- 0:00:18
689500 -- (-355.418) (-356.392) [-355.617] (-360.496) * (-359.056) [-359.687] (-355.376) (-360.233) -- 0:00:18
690000 -- (-359.957) (-354.491) [-355.072] (-356.910) * (-359.115) (-359.595) [-355.561] (-354.788) -- 0:00:17
Average standard deviation of split frequencies: 0.008062
690500 -- (-355.155) (-355.264) (-359.196) [-355.944] * (-358.304) (-354.549) [-355.310] (-355.104) -- 0:00:18
691000 -- (-359.541) (-355.144) [-360.665] (-355.458) * (-357.141) (-355.643) [-354.310] (-355.915) -- 0:00:18
691500 -- (-356.635) (-355.877) (-360.570) [-354.551] * (-355.885) (-356.768) [-354.906] (-354.726) -- 0:00:18
692000 -- (-355.600) (-356.898) [-356.921] (-356.193) * (-360.197) (-358.740) (-355.830) [-355.509] -- 0:00:18
692500 -- [-355.980] (-354.483) (-358.560) (-357.319) * (-358.463) (-359.066) [-354.209] (-355.601) -- 0:00:18
693000 -- (-356.531) [-355.310] (-355.916) (-356.411) * (-355.162) (-359.317) (-354.757) [-355.807] -- 0:00:18
693500 -- (-355.716) (-356.092) (-355.320) [-356.207] * (-356.710) (-356.724) [-354.635] (-356.817) -- 0:00:18
694000 -- (-360.126) (-360.349) [-355.807] (-357.624) * (-355.624) (-359.116) [-358.693] (-356.326) -- 0:00:18
694500 -- (-355.660) (-356.953) (-358.942) [-355.861] * (-356.195) (-358.405) (-357.140) [-355.751] -- 0:00:18
695000 -- (-355.442) (-356.660) [-355.335] (-357.273) * (-357.829) [-354.720] (-358.558) (-357.927) -- 0:00:17
Average standard deviation of split frequencies: 0.007947
695500 -- (-355.664) [-354.795] (-359.298) (-359.525) * (-358.027) (-355.395) [-358.353] (-361.866) -- 0:00:17
696000 -- [-355.521] (-357.657) (-358.343) (-356.850) * [-355.203] (-355.039) (-356.971) (-360.125) -- 0:00:17
696500 -- (-355.510) (-354.938) [-357.289] (-357.250) * (-357.189) (-355.143) [-357.249] (-356.043) -- 0:00:17
697000 -- (-357.511) [-356.312] (-354.980) (-356.577) * (-354.660) (-355.357) (-356.924) [-354.347] -- 0:00:17
697500 -- (-355.368) (-356.545) [-355.173] (-355.420) * (-357.855) (-360.325) [-355.500] (-358.870) -- 0:00:17
698000 -- (-356.090) (-355.698) (-357.705) [-355.487] * (-356.974) [-359.149] (-356.346) (-356.649) -- 0:00:17
698500 -- (-355.905) [-356.180] (-358.466) (-355.719) * (-355.297) (-357.010) [-357.103] (-355.887) -- 0:00:17
699000 -- (-356.166) [-357.578] (-356.052) (-355.295) * (-355.506) [-354.965] (-356.144) (-357.571) -- 0:00:17
699500 -- (-355.885) (-356.772) [-355.021] (-357.811) * (-356.248) (-361.117) (-357.230) [-355.556] -- 0:00:17
700000 -- (-356.254) (-355.927) [-355.886] (-358.775) * (-358.042) (-360.952) (-355.762) [-357.631] -- 0:00:17
Average standard deviation of split frequencies: 0.007611
700500 -- (-355.671) (-355.083) (-361.677) [-358.709] * (-356.585) (-356.143) [-355.810] (-358.399) -- 0:00:17
701000 -- (-356.990) (-356.788) (-358.133) [-358.994] * (-358.156) [-354.319] (-357.201) (-356.795) -- 0:00:17
701500 -- (-355.929) [-356.017] (-355.123) (-357.545) * (-355.794) [-354.309] (-360.090) (-361.905) -- 0:00:17
702000 -- (-355.730) (-355.633) (-358.963) [-355.594] * (-355.885) (-355.581) (-354.960) [-354.882] -- 0:00:17
702500 -- (-355.182) (-355.403) [-355.179] (-356.717) * (-355.638) (-355.041) [-359.724] (-356.302) -- 0:00:17
703000 -- (-356.435) (-360.739) (-355.505) [-355.832] * [-355.665] (-356.447) (-355.608) (-357.862) -- 0:00:17
703500 -- (-355.575) (-359.718) (-354.811) [-354.613] * (-358.608) [-356.417] (-355.857) (-357.057) -- 0:00:17
704000 -- (-355.044) (-361.006) [-355.793] (-356.148) * (-359.642) [-358.497] (-358.763) (-358.543) -- 0:00:17
704500 -- (-355.563) (-359.733) (-355.906) [-356.166] * (-361.771) (-357.855) (-356.191) [-359.289] -- 0:00:17
705000 -- (-358.662) (-360.674) [-354.712] (-359.821) * (-357.388) (-354.892) [-355.303] (-355.443) -- 0:00:17
Average standard deviation of split frequencies: 0.007804
705500 -- (-355.479) (-356.751) [-356.039] (-357.088) * (-355.337) (-357.321) (-355.213) [-357.719] -- 0:00:17
706000 -- (-355.314) (-356.321) [-355.746] (-357.326) * [-356.594] (-356.282) (-358.204) (-355.607) -- 0:00:17
706500 -- (-357.681) [-357.552] (-356.491) (-356.429) * (-356.123) (-357.870) [-355.924] (-359.276) -- 0:00:17
707000 -- (-357.509) (-354.763) (-355.997) [-358.667] * [-354.098] (-357.433) (-356.944) (-358.674) -- 0:00:16
707500 -- (-356.631) (-359.207) [-356.821] (-359.908) * [-356.049] (-355.968) (-354.672) (-356.609) -- 0:00:17
708000 -- (-358.366) [-355.103] (-363.593) (-354.352) * [-357.384] (-354.912) (-355.332) (-361.119) -- 0:00:17
708500 -- (-357.650) [-356.154] (-356.748) (-354.825) * (-358.921) [-355.943] (-358.917) (-359.746) -- 0:00:17
709000 -- (-354.720) [-356.191] (-356.163) (-355.848) * (-360.056) [-355.317] (-355.599) (-368.020) -- 0:00:17
709500 -- (-355.558) [-354.980] (-360.178) (-357.227) * (-356.092) [-357.237] (-355.403) (-368.383) -- 0:00:17
710000 -- (-359.552) [-354.760] (-356.615) (-356.521) * (-355.500) (-357.832) (-355.302) [-356.086] -- 0:00:17
Average standard deviation of split frequencies: 0.008001
710500 -- (-355.899) (-355.916) (-356.055) [-355.972] * (-355.771) [-357.503] (-354.363) (-355.571) -- 0:00:17
711000 -- (-357.483) (-359.134) [-356.376] (-354.940) * [-356.911] (-357.250) (-357.831) (-354.818) -- 0:00:17
711500 -- [-358.164] (-356.848) (-355.119) (-355.003) * (-355.125) (-357.032) [-355.100] (-354.519) -- 0:00:17
712000 -- (-356.826) (-358.131) [-358.740] (-357.544) * (-357.228) [-356.127] (-356.788) (-355.442) -- 0:00:16
712500 -- (-356.705) (-356.339) (-356.152) [-357.335] * (-356.690) (-354.229) (-354.463) [-354.464] -- 0:00:16
713000 -- (-355.016) [-355.275] (-362.903) (-354.898) * [-354.086] (-354.162) (-354.813) (-355.440) -- 0:00:16
713500 -- (-356.540) (-357.322) (-356.150) [-354.968] * (-357.255) (-355.164) (-355.654) [-360.360] -- 0:00:16
714000 -- (-355.090) (-362.154) [-355.436] (-362.641) * (-359.932) [-354.287] (-357.885) (-359.713) -- 0:00:16
714500 -- (-359.182) [-359.335] (-354.336) (-356.583) * (-359.994) (-356.949) (-354.951) [-356.687] -- 0:00:16
715000 -- (-356.639) (-358.340) [-357.788] (-355.992) * (-359.855) (-356.882) [-355.192] (-355.445) -- 0:00:16
Average standard deviation of split frequencies: 0.008271
715500 -- (-354.924) (-357.609) [-356.167] (-359.703) * (-361.315) (-355.544) [-355.831] (-356.572) -- 0:00:16
716000 -- [-359.615] (-356.028) (-356.223) (-356.576) * [-355.058] (-356.455) (-354.052) (-356.327) -- 0:00:16
716500 -- (-359.746) (-357.892) (-356.763) [-357.285] * (-355.363) [-359.251] (-353.982) (-355.361) -- 0:00:16
717000 -- (-360.170) (-358.170) [-358.462] (-358.518) * (-355.410) [-357.001] (-355.773) (-355.937) -- 0:00:16
717500 -- [-354.795] (-358.070) (-356.285) (-357.714) * [-356.498] (-357.179) (-355.129) (-355.364) -- 0:00:16
718000 -- (-354.906) [-357.020] (-355.021) (-355.406) * [-356.463] (-355.165) (-357.366) (-355.135) -- 0:00:16
718500 -- (-356.401) (-356.507) [-356.462] (-355.544) * [-360.765] (-355.115) (-358.914) (-355.046) -- 0:00:16
719000 -- (-357.635) (-359.125) (-357.702) [-355.192] * (-359.446) [-356.665] (-356.895) (-354.134) -- 0:00:16
719500 -- [-355.850] (-358.296) (-354.806) (-354.607) * (-357.249) (-356.931) [-354.701] (-355.236) -- 0:00:16
720000 -- [-354.993] (-359.812) (-358.848) (-356.154) * (-359.694) [-355.500] (-357.047) (-355.189) -- 0:00:16
Average standard deviation of split frequencies: 0.008177
720500 -- (-355.362) [-355.299] (-355.633) (-358.103) * (-356.265) [-355.150] (-355.248) (-357.060) -- 0:00:16
721000 -- [-359.866] (-355.667) (-354.231) (-356.500) * (-358.443) [-360.862] (-355.478) (-357.461) -- 0:00:16
721500 -- [-355.253] (-355.276) (-355.411) (-356.330) * (-364.132) (-357.921) (-358.317) [-354.880] -- 0:00:16
722000 -- (-354.623) [-355.830] (-354.317) (-355.982) * [-359.100] (-356.720) (-355.053) (-354.566) -- 0:00:16
722500 -- (-354.097) [-358.193] (-358.373) (-355.549) * (-357.729) [-355.838] (-359.424) (-355.379) -- 0:00:16
723000 -- (-359.248) (-355.582) [-357.369] (-354.841) * (-357.777) [-357.625] (-357.053) (-359.931) -- 0:00:16
723500 -- (-358.671) (-356.200) (-354.408) [-354.926] * (-355.926) (-355.467) (-356.554) [-356.567] -- 0:00:16
724000 -- (-355.295) (-360.349) (-357.989) [-357.185] * [-354.200] (-355.835) (-356.951) (-357.823) -- 0:00:16
724500 -- [-361.168] (-355.096) (-357.816) (-361.639) * [-354.924] (-358.814) (-357.461) (-356.697) -- 0:00:15
725000 -- [-362.355] (-354.391) (-357.671) (-355.521) * (-356.472) (-358.667) (-356.573) [-357.376] -- 0:00:16
Average standard deviation of split frequencies: 0.008401
725500 -- [-354.099] (-356.991) (-354.924) (-355.385) * (-355.393) (-355.015) (-357.672) [-359.873] -- 0:00:16
726000 -- (-354.534) (-355.024) [-355.038] (-354.655) * (-357.466) (-357.035) [-358.049] (-355.278) -- 0:00:16
726500 -- (-357.339) (-355.634) (-358.936) [-356.290] * (-355.578) (-356.055) [-354.982] (-358.057) -- 0:00:16
727000 -- (-357.275) (-358.268) [-358.405] (-357.803) * [-355.697] (-355.604) (-356.492) (-358.946) -- 0:00:16
727500 -- (-355.351) (-357.498) [-356.420] (-358.795) * (-355.788) (-355.574) [-355.937] (-360.633) -- 0:00:16
728000 -- (-354.509) (-356.354) [-357.824] (-356.138) * (-357.445) [-355.765] (-359.946) (-356.668) -- 0:00:16
728500 -- (-358.544) [-356.837] (-356.701) (-356.540) * (-357.580) (-358.522) (-355.989) [-357.480] -- 0:00:16
729000 -- (-355.901) [-356.024] (-355.375) (-356.189) * (-355.471) (-360.616) [-355.346] (-356.035) -- 0:00:15
729500 -- (-357.396) (-354.726) (-358.401) [-354.768] * (-355.736) [-361.433] (-359.473) (-362.334) -- 0:00:15
730000 -- [-354.852] (-359.314) (-356.092) (-359.952) * [-355.107] (-358.689) (-355.845) (-360.212) -- 0:00:15
Average standard deviation of split frequencies: 0.008629
730500 -- (-355.436) [-358.408] (-354.789) (-357.718) * (-356.249) (-355.314) (-355.339) [-357.155] -- 0:00:15
731000 -- (-359.394) [-355.297] (-355.698) (-356.888) * (-356.388) [-357.865] (-356.673) (-357.017) -- 0:00:15
731500 -- [-354.964] (-355.200) (-355.695) (-359.455) * (-356.805) (-355.904) [-356.582] (-356.754) -- 0:00:15
732000 -- (-355.579) [-355.648] (-357.152) (-357.390) * (-360.084) [-354.412] (-356.593) (-357.310) -- 0:00:15
732500 -- (-356.461) [-356.824] (-357.295) (-356.733) * (-359.404) [-355.204] (-362.627) (-357.641) -- 0:00:15
733000 -- (-357.630) [-355.454] (-359.366) (-354.162) * [-356.720] (-355.483) (-357.695) (-357.831) -- 0:00:15
733500 -- (-356.899) (-358.444) [-356.261] (-356.622) * (-359.047) [-355.623] (-356.200) (-358.089) -- 0:00:15
734000 -- (-363.168) (-359.956) [-355.861] (-355.077) * (-356.477) [-357.073] (-356.306) (-358.350) -- 0:00:15
734500 -- [-359.959] (-355.428) (-358.180) (-356.776) * [-356.283] (-356.231) (-357.317) (-357.131) -- 0:00:15
735000 -- (-359.343) (-356.833) [-359.904] (-357.276) * (-354.897) (-354.505) [-357.796] (-355.034) -- 0:00:15
Average standard deviation of split frequencies: 0.008487
735500 -- (-354.665) (-358.996) [-357.084] (-358.749) * [-356.828] (-354.885) (-359.665) (-356.974) -- 0:00:15
736000 -- [-354.897] (-354.868) (-359.153) (-359.044) * (-355.781) [-355.950] (-359.220) (-355.314) -- 0:00:15
736500 -- (-358.664) (-356.684) (-357.852) [-354.853] * (-356.652) (-358.221) (-361.670) [-358.121] -- 0:00:15
737000 -- (-355.908) (-354.385) (-359.826) [-355.323] * (-357.374) (-359.265) (-361.050) [-357.847] -- 0:00:15
737500 -- (-356.313) [-354.454] (-362.953) (-356.024) * (-357.783) [-356.828] (-356.676) (-356.738) -- 0:00:15
738000 -- (-356.640) [-356.433] (-357.724) (-356.980) * (-357.542) [-355.580] (-356.501) (-361.013) -- 0:00:15
738500 -- (-355.745) [-357.404] (-355.662) (-357.204) * (-356.841) (-354.385) [-358.829] (-361.739) -- 0:00:15
739000 -- [-355.225] (-355.590) (-354.500) (-356.911) * (-356.388) (-356.499) [-357.735] (-362.065) -- 0:00:15
739500 -- (-357.359) (-357.330) (-356.742) [-356.573] * [-355.090] (-355.157) (-355.428) (-355.303) -- 0:00:15
740000 -- (-358.480) [-355.585] (-358.715) (-361.316) * [-354.889] (-358.514) (-361.505) (-354.832) -- 0:00:15
Average standard deviation of split frequencies: 0.008513
740500 -- (-357.608) (-358.628) [-356.103] (-359.382) * (-355.807) (-358.245) (-360.174) [-355.231] -- 0:00:15
741000 -- (-355.830) [-357.133] (-355.900) (-356.198) * [-356.318] (-356.513) (-358.849) (-357.501) -- 0:00:15
741500 -- (-356.964) [-354.541] (-356.610) (-357.360) * (-359.319) (-359.495) (-358.250) [-358.569] -- 0:00:14
742000 -- (-358.749) (-355.552) [-355.886] (-357.099) * [-356.947] (-358.858) (-359.194) (-357.394) -- 0:00:15
742500 -- (-355.493) (-354.945) (-356.536) [-355.307] * (-354.991) [-355.682] (-355.135) (-354.581) -- 0:00:15
743000 -- (-358.107) [-355.820] (-354.679) (-355.954) * (-356.741) (-355.807) [-356.386] (-354.869) -- 0:00:15
743500 -- [-355.212] (-358.349) (-356.817) (-355.038) * (-357.087) (-359.728) (-354.624) [-359.075] -- 0:00:15
744000 -- (-355.086) [-360.589] (-358.875) (-354.890) * (-360.250) (-356.564) [-355.085] (-358.677) -- 0:00:15
744500 -- (-356.623) (-356.208) [-356.248] (-359.400) * [-360.986] (-355.921) (-358.117) (-355.240) -- 0:00:15
745000 -- (-355.622) [-357.417] (-358.023) (-358.876) * (-358.920) [-358.326] (-360.161) (-355.208) -- 0:00:15
Average standard deviation of split frequencies: 0.008088
745500 -- [-354.491] (-356.784) (-355.707) (-356.976) * (-359.338) [-358.431] (-359.159) (-355.070) -- 0:00:15
746000 -- (-356.691) (-357.602) (-355.495) [-357.211] * (-356.605) (-354.798) (-358.305) [-355.782] -- 0:00:14
746500 -- (-354.698) (-355.813) (-358.136) [-355.768] * (-358.944) (-354.702) [-359.215] (-361.396) -- 0:00:14
747000 -- [-355.230] (-361.525) (-356.453) (-357.104) * (-358.407) (-354.866) (-356.092) [-361.576] -- 0:00:14
747500 -- [-354.951] (-363.187) (-356.888) (-359.343) * (-356.492) [-356.233] (-356.597) (-358.947) -- 0:00:14
748000 -- [-355.565] (-356.000) (-356.112) (-357.715) * (-357.533) (-357.989) [-355.626] (-355.502) -- 0:00:14
748500 -- (-356.966) (-358.208) [-356.024] (-358.012) * (-355.357) (-358.597) [-357.750] (-356.729) -- 0:00:14
749000 -- (-355.518) (-356.580) (-356.070) [-354.545] * (-355.491) (-354.890) (-355.671) [-357.349] -- 0:00:14
749500 -- (-354.826) [-355.692] (-354.532) (-354.874) * (-357.363) (-355.053) [-357.539] (-359.813) -- 0:00:14
750000 -- [-357.382] (-354.801) (-356.612) (-357.102) * [-357.229] (-355.496) (-356.013) (-356.641) -- 0:00:14
Average standard deviation of split frequencies: 0.008242
750500 -- [-355.592] (-354.589) (-356.121) (-355.847) * [-358.539] (-356.872) (-359.347) (-356.158) -- 0:00:14
751000 -- (-354.720) [-355.713] (-357.519) (-356.622) * (-358.258) [-354.652] (-356.223) (-355.379) -- 0:00:14
751500 -- (-356.418) [-356.310] (-357.546) (-362.462) * (-356.663) [-354.590] (-357.903) (-355.141) -- 0:00:14
752000 -- (-360.909) (-355.015) [-354.714] (-356.551) * (-357.589) (-357.297) (-355.486) [-355.154] -- 0:00:14
752500 -- (-356.033) (-355.092) [-354.310] (-355.449) * (-356.818) [-359.103] (-356.031) (-354.015) -- 0:00:14
753000 -- [-358.481] (-356.418) (-355.881) (-355.928) * (-360.573) [-356.142] (-357.697) (-355.143) -- 0:00:14
753500 -- (-354.936) (-362.482) (-357.390) [-356.887] * (-355.445) [-358.866] (-361.168) (-356.634) -- 0:00:14
754000 -- (-356.396) [-357.096] (-359.028) (-355.667) * (-355.831) (-358.843) [-354.548] (-359.654) -- 0:00:14
754500 -- (-355.004) [-356.005] (-356.449) (-357.712) * [-354.366] (-356.050) (-357.868) (-358.315) -- 0:00:14
755000 -- (-359.830) (-358.793) (-356.329) [-358.176] * [-357.299] (-355.228) (-358.489) (-357.012) -- 0:00:14
Average standard deviation of split frequencies: 0.008067
755500 -- (-355.117) (-354.835) (-355.219) [-357.102] * [-359.227] (-355.224) (-357.051) (-355.555) -- 0:00:14
756000 -- [-355.227] (-356.864) (-362.210) (-355.991) * [-356.086] (-355.481) (-355.949) (-360.016) -- 0:00:14
756500 -- (-355.201) [-356.129] (-360.291) (-358.331) * (-356.810) (-354.782) (-354.592) [-355.979] -- 0:00:14
757000 -- (-356.054) (-356.040) [-356.517] (-362.569) * (-355.751) (-354.952) [-356.145] (-357.062) -- 0:00:14
757500 -- (-355.892) [-355.914] (-355.532) (-355.609) * [-355.660] (-354.595) (-356.355) (-356.501) -- 0:00:14
758000 -- (-360.052) [-357.079] (-354.552) (-357.370) * (-356.588) (-355.861) (-356.089) [-355.734] -- 0:00:14
758500 -- (-357.152) [-358.734] (-354.253) (-357.092) * (-358.191) (-356.661) (-358.067) [-357.566] -- 0:00:14
759000 -- [-356.609] (-355.706) (-354.242) (-357.818) * (-354.939) (-356.785) (-357.403) [-356.906] -- 0:00:13
759500 -- (-358.538) (-357.856) (-357.979) [-355.082] * (-361.187) (-354.683) [-355.568] (-355.675) -- 0:00:14
760000 -- [-357.786] (-356.109) (-355.153) (-358.592) * (-355.774) (-354.241) (-354.607) [-356.141] -- 0:00:14
Average standard deviation of split frequencies: 0.008180
760500 -- (-357.381) (-358.342) (-360.816) [-357.755] * (-356.577) [-355.634] (-354.490) (-354.483) -- 0:00:14
761000 -- [-356.879] (-354.903) (-356.846) (-356.061) * (-356.234) (-354.593) [-355.186] (-354.754) -- 0:00:14
761500 -- (-357.276) (-359.967) [-356.462] (-354.539) * (-361.528) [-354.936] (-356.967) (-355.610) -- 0:00:14
762000 -- (-358.432) (-356.823) (-356.164) [-356.839] * (-358.744) (-357.745) (-356.705) [-357.879] -- 0:00:14
762500 -- (-354.396) (-354.779) (-356.089) [-359.585] * (-355.128) [-357.586] (-361.491) (-356.459) -- 0:00:14
763000 -- [-357.794] (-354.868) (-358.042) (-355.417) * [-357.095] (-358.214) (-356.193) (-356.130) -- 0:00:13
763500 -- (-354.406) [-356.209] (-358.871) (-356.321) * (-355.109) [-355.624] (-354.775) (-359.997) -- 0:00:13
764000 -- (-357.617) (-357.650) [-355.141] (-355.514) * (-356.122) (-354.647) (-355.120) [-356.314] -- 0:00:13
764500 -- [-360.125] (-356.218) (-354.756) (-355.736) * (-357.780) (-357.466) [-356.924] (-354.373) -- 0:00:13
765000 -- (-354.931) [-355.044] (-356.641) (-355.492) * (-357.605) (-355.596) (-355.971) [-358.083] -- 0:00:13
Average standard deviation of split frequencies: 0.007508
765500 -- (-354.760) [-354.670] (-354.606) (-356.613) * (-356.299) [-356.684] (-354.960) (-357.372) -- 0:00:13
766000 -- [-357.512] (-355.258) (-356.255) (-356.565) * [-355.239] (-357.205) (-358.676) (-355.614) -- 0:00:13
766500 -- (-359.797) (-358.393) (-356.543) [-358.166] * [-355.741] (-358.313) (-358.894) (-357.711) -- 0:00:13
767000 -- (-356.491) (-356.349) [-355.334] (-356.187) * [-354.759] (-355.274) (-355.497) (-361.965) -- 0:00:13
767500 -- [-355.163] (-356.666) (-355.844) (-356.252) * (-356.578) (-359.709) (-360.030) [-358.603] -- 0:00:13
768000 -- (-356.580) [-356.536] (-358.400) (-356.322) * [-355.164] (-359.164) (-359.512) (-358.493) -- 0:00:13
768500 -- (-356.015) (-358.433) (-357.539) [-354.250] * (-357.751) (-360.250) (-358.254) [-356.888] -- 0:00:13
769000 -- (-354.995) [-354.512] (-361.403) (-354.707) * (-355.065) (-361.417) [-354.636] (-357.579) -- 0:00:13
769500 -- [-354.737] (-358.743) (-357.922) (-357.751) * (-359.076) (-354.854) (-356.829) [-356.145] -- 0:00:13
770000 -- (-354.308) (-355.034) [-355.258] (-355.457) * (-359.461) (-360.802) [-356.131] (-356.000) -- 0:00:13
Average standard deviation of split frequencies: 0.007340
770500 -- (-354.356) (-357.636) [-357.829] (-356.057) * (-355.057) [-357.789] (-355.721) (-356.385) -- 0:00:13
771000 -- (-354.621) (-355.315) [-356.456] (-356.724) * (-355.502) (-356.697) (-355.371) [-354.804] -- 0:00:13
771500 -- [-356.049] (-355.943) (-354.589) (-356.781) * [-357.334] (-354.730) (-355.442) (-356.141) -- 0:00:13
772000 -- [-356.478] (-357.609) (-359.584) (-355.344) * (-360.137) [-359.895] (-359.210) (-354.295) -- 0:00:13
772500 -- [-356.830] (-356.214) (-360.057) (-355.083) * (-357.676) (-363.874) [-356.959] (-358.496) -- 0:00:13
773000 -- (-356.880) [-356.318] (-358.265) (-355.558) * (-362.325) (-358.421) (-356.809) [-356.597] -- 0:00:13
773500 -- (-358.889) (-356.853) [-359.445] (-355.781) * (-364.699) (-356.111) (-356.920) [-359.497] -- 0:00:13
774000 -- (-354.682) (-355.285) (-362.871) [-357.474] * [-356.105] (-356.305) (-355.209) (-356.299) -- 0:00:13
774500 -- (-355.439) (-356.083) [-355.735] (-356.124) * (-357.730) (-354.414) (-356.660) [-355.055] -- 0:00:13
775000 -- (-357.470) (-355.395) (-358.461) [-355.895] * (-356.130) (-355.825) [-355.587] (-357.373) -- 0:00:13
Average standard deviation of split frequencies: 0.007168
775500 -- (-357.951) [-358.082] (-358.212) (-355.804) * [-356.762] (-354.945) (-358.137) (-356.554) -- 0:00:13
776000 -- (-357.606) (-357.383) (-358.990) [-355.378] * (-355.058) [-354.665] (-355.082) (-355.452) -- 0:00:12
776500 -- (-356.397) (-362.816) (-355.767) [-354.705] * (-361.361) (-357.451) [-356.129] (-355.880) -- 0:00:13
777000 -- [-358.662] (-359.331) (-355.862) (-355.294) * (-357.337) (-357.272) (-357.245) [-355.712] -- 0:00:13
777500 -- [-357.551] (-358.503) (-357.827) (-355.008) * [-357.452] (-360.391) (-356.265) (-356.087) -- 0:00:13
778000 -- [-356.874] (-355.958) (-355.542) (-356.725) * (-356.290) (-356.646) (-354.815) [-354.548] -- 0:00:13
778500 -- [-355.979] (-355.734) (-362.085) (-358.862) * (-357.300) (-356.397) (-357.912) [-356.168] -- 0:00:13
779000 -- [-355.191] (-354.918) (-355.912) (-355.485) * (-358.119) [-356.059] (-357.680) (-354.729) -- 0:00:13
779500 -- (-356.825) [-356.797] (-355.495) (-360.029) * (-359.879) (-357.054) (-360.428) [-356.377] -- 0:00:13
780000 -- (-355.402) (-364.543) (-357.552) [-363.051] * (-355.221) (-356.921) [-356.852] (-357.149) -- 0:00:12
Average standard deviation of split frequencies: 0.007166
780500 -- (-358.014) (-358.700) [-354.557] (-363.257) * (-357.700) (-361.773) (-354.691) [-358.947] -- 0:00:12
781000 -- (-356.100) (-355.633) [-356.462] (-354.973) * (-355.583) [-355.827] (-355.032) (-356.478) -- 0:00:12
781500 -- (-354.471) (-357.528) (-354.497) [-355.987] * (-357.121) (-354.153) (-356.486) [-357.751] -- 0:00:12
782000 -- [-355.761] (-357.021) (-354.349) (-355.475) * [-356.906] (-354.898) (-357.692) (-358.693) -- 0:00:12
782500 -- (-355.735) (-354.228) (-357.614) [-354.487] * (-355.706) (-356.087) (-355.500) [-355.267] -- 0:00:12
783000 -- [-356.935] (-355.058) (-359.932) (-354.297) * (-355.787) [-354.329] (-355.282) (-359.248) -- 0:00:12
783500 -- (-356.445) (-359.952) [-357.603] (-356.365) * (-355.097) [-356.991] (-355.275) (-357.710) -- 0:00:12
784000 -- [-355.623] (-358.107) (-357.366) (-355.003) * (-354.888) (-357.967) (-355.784) [-358.609] -- 0:00:12
784500 -- (-356.722) (-360.528) [-355.241] (-357.884) * (-356.424) [-355.423] (-356.659) (-356.884) -- 0:00:12
785000 -- [-355.391] (-356.007) (-355.697) (-355.134) * (-357.078) [-355.239] (-356.333) (-356.980) -- 0:00:12
Average standard deviation of split frequencies: 0.006717
785500 -- (-354.965) [-357.194] (-354.776) (-356.912) * (-355.015) (-354.510) [-356.468] (-356.464) -- 0:00:12
786000 -- (-354.521) (-354.800) [-357.126] (-354.629) * (-354.655) (-357.320) [-360.939] (-356.007) -- 0:00:12
786500 -- (-357.763) (-357.257) (-357.580) [-355.868] * (-359.164) (-357.661) [-357.510] (-356.939) -- 0:00:12
787000 -- (-354.970) (-354.757) [-355.445] (-356.146) * (-356.848) (-355.966) [-355.304] (-356.457) -- 0:00:12
787500 -- (-354.372) (-357.674) (-359.037) [-354.822] * (-355.378) (-356.399) (-359.331) [-357.108] -- 0:00:12
788000 -- (-355.140) (-356.888) [-357.899] (-357.898) * (-356.456) [-355.419] (-358.324) (-359.286) -- 0:00:12
788500 -- (-357.245) [-356.286] (-360.348) (-354.835) * (-355.669) [-357.298] (-357.478) (-355.677) -- 0:00:12
789000 -- [-354.559] (-359.596) (-361.941) (-355.560) * (-355.120) (-359.968) [-355.131] (-356.742) -- 0:00:12
789500 -- (-354.876) [-354.414] (-356.849) (-357.753) * [-356.712] (-362.769) (-355.866) (-356.332) -- 0:00:12
790000 -- (-356.699) (-356.553) (-358.349) [-356.814] * (-354.965) (-354.649) [-356.783] (-355.347) -- 0:00:12
Average standard deviation of split frequencies: 0.006837
790500 -- [-358.548] (-356.341) (-359.137) (-355.224) * [-357.021] (-355.067) (-356.324) (-356.882) -- 0:00:12
791000 -- (-357.950) (-357.195) (-359.128) [-355.552] * (-357.792) (-355.381) (-355.638) [-354.869] -- 0:00:12
791500 -- [-356.284] (-354.398) (-355.718) (-356.397) * (-356.976) (-357.066) (-356.459) [-358.412] -- 0:00:12
792000 -- [-354.144] (-354.461) (-358.666) (-357.370) * (-359.578) (-355.704) [-356.647] (-357.814) -- 0:00:12
792500 -- [-357.330] (-355.140) (-357.037) (-358.676) * (-354.108) [-354.552] (-354.315) (-355.189) -- 0:00:12
793000 -- (-357.616) (-361.043) (-358.775) [-355.345] * (-354.225) (-355.206) [-357.291] (-356.279) -- 0:00:12
793500 -- (-362.410) [-359.950] (-358.088) (-356.147) * [-354.113] (-355.996) (-356.017) (-357.782) -- 0:00:11
794000 -- (-356.540) (-358.912) (-356.117) [-356.552] * (-363.856) (-357.337) [-356.355] (-362.485) -- 0:00:12
794500 -- (-355.700) (-357.601) [-358.410] (-355.694) * (-363.460) (-357.952) (-354.890) [-356.806] -- 0:00:12
795000 -- [-355.191] (-359.819) (-356.276) (-362.222) * (-358.024) (-357.432) (-354.411) [-354.448] -- 0:00:12
Average standard deviation of split frequencies: 0.007146
795500 -- (-358.389) (-356.215) (-357.117) [-356.292] * [-355.855] (-355.587) (-357.261) (-356.779) -- 0:00:12
796000 -- [-354.771] (-358.882) (-357.024) (-356.047) * (-355.590) [-355.038] (-355.640) (-356.037) -- 0:00:12
796500 -- (-356.929) (-357.729) [-355.837] (-356.028) * [-355.377] (-354.313) (-355.177) (-357.057) -- 0:00:12
797000 -- (-357.352) [-355.219] (-358.085) (-355.764) * (-356.526) [-358.906] (-357.466) (-358.243) -- 0:00:11
797500 -- (-356.967) (-359.091) [-355.212] (-356.369) * (-355.454) (-354.837) (-356.486) [-356.486] -- 0:00:11
798000 -- (-354.213) (-358.859) (-354.483) [-354.318] * (-356.214) (-357.108) [-356.138] (-357.038) -- 0:00:11
798500 -- [-356.119] (-356.310) (-357.330) (-358.264) * (-356.846) (-357.544) (-356.662) [-358.158] -- 0:00:11
799000 -- [-355.869] (-356.428) (-355.616) (-357.501) * [-356.504] (-355.818) (-354.675) (-357.002) -- 0:00:11
799500 -- (-355.356) (-356.643) (-354.895) [-354.415] * (-355.506) (-357.935) [-355.338] (-357.648) -- 0:00:11
800000 -- [-354.882] (-354.497) (-355.089) (-358.308) * (-355.836) (-356.647) [-356.831] (-360.218) -- 0:00:11
Average standard deviation of split frequencies: 0.007458
800500 -- (-354.728) [-355.657] (-358.715) (-357.805) * (-354.928) [-356.920] (-356.464) (-359.719) -- 0:00:11
801000 -- (-354.356) [-356.207] (-362.284) (-357.376) * (-358.013) (-358.896) [-363.713] (-355.799) -- 0:00:11
801500 -- (-355.502) (-357.674) (-356.694) [-355.857] * (-359.117) (-358.484) [-355.946] (-357.860) -- 0:00:11
802000 -- [-355.742] (-356.221) (-355.957) (-356.123) * (-357.604) [-357.272] (-354.668) (-357.620) -- 0:00:11
802500 -- (-354.401) [-354.841] (-360.377) (-356.066) * (-357.863) (-362.416) (-356.020) [-358.522] -- 0:00:11
803000 -- (-357.170) (-355.933) [-357.774] (-357.459) * [-356.485] (-357.863) (-356.487) (-354.536) -- 0:00:11
803500 -- (-355.418) (-354.399) (-360.531) [-354.597] * (-360.094) (-359.482) [-355.225] (-356.583) -- 0:00:11
804000 -- (-355.417) [-356.436] (-357.376) (-360.435) * (-361.498) (-356.848) (-359.067) [-355.120] -- 0:00:11
804500 -- [-356.551] (-358.431) (-356.748) (-363.199) * (-359.541) (-358.302) (-354.514) [-354.656] -- 0:00:11
805000 -- (-355.629) (-355.110) (-356.659) [-354.685] * (-357.535) [-359.587] (-357.899) (-361.131) -- 0:00:11
Average standard deviation of split frequencies: 0.007096
805500 -- (-358.074) (-355.419) (-357.626) [-355.581] * [-355.865] (-357.076) (-361.171) (-355.084) -- 0:00:11
806000 -- (-356.837) (-356.320) (-357.445) [-356.051] * (-354.999) (-356.877) [-357.749] (-354.451) -- 0:00:11
806500 -- (-356.935) (-359.525) [-354.595] (-361.328) * (-358.516) (-355.398) (-357.628) [-356.709] -- 0:00:11
807000 -- (-354.208) (-362.001) [-357.519] (-362.059) * (-359.883) [-354.973] (-357.040) (-355.088) -- 0:00:11
807500 -- (-356.895) [-355.448] (-361.663) (-361.260) * [-355.112] (-360.490) (-357.986) (-355.182) -- 0:00:11
808000 -- (-355.300) [-357.033] (-360.207) (-355.934) * (-355.267) (-357.107) [-354.532] (-355.181) -- 0:00:11
808500 -- (-355.418) (-355.320) (-363.856) [-355.479] * (-356.126) [-357.763] (-357.773) (-357.705) -- 0:00:11
809000 -- (-359.260) (-355.018) [-356.145] (-358.903) * [-354.993] (-361.924) (-361.459) (-356.846) -- 0:00:11
809500 -- [-358.279] (-355.558) (-355.586) (-354.561) * (-354.856) (-359.494) (-357.164) [-357.386] -- 0:00:11
810000 -- (-359.093) (-356.922) [-362.953] (-355.861) * (-356.389) (-358.013) [-354.268] (-356.800) -- 0:00:11
Average standard deviation of split frequencies: 0.007443
810500 -- [-355.407] (-356.262) (-357.694) (-355.811) * (-355.189) (-356.707) [-354.914] (-355.038) -- 0:00:11
811000 -- (-355.881) (-358.478) [-355.254] (-355.774) * [-355.255] (-358.597) (-356.436) (-354.998) -- 0:00:11
811500 -- (-358.550) (-362.763) (-355.142) [-357.381] * (-355.445) [-355.979] (-360.213) (-356.499) -- 0:00:11
812000 -- (-358.026) [-357.099] (-356.953) (-354.680) * (-360.072) (-356.803) (-358.779) [-356.306] -- 0:00:11
812500 -- (-359.625) (-355.902) (-358.500) [-354.594] * (-356.317) (-355.579) [-356.041] (-358.609) -- 0:00:11
813000 -- (-356.974) [-356.453] (-355.794) (-356.084) * (-358.210) (-356.644) [-356.538] (-357.537) -- 0:00:11
813500 -- [-356.355] (-357.001) (-356.826) (-356.568) * (-357.846) (-356.071) (-357.503) [-358.135] -- 0:00:11
814000 -- (-361.052) [-355.848] (-356.811) (-357.302) * (-355.358) (-362.794) (-355.933) [-356.513] -- 0:00:10
814500 -- (-357.318) (-356.101) (-359.436) [-356.374] * (-359.072) [-357.894] (-355.941) (-361.887) -- 0:00:10
815000 -- (-357.525) [-356.227] (-354.665) (-355.518) * (-355.055) (-354.991) [-356.271] (-358.486) -- 0:00:10
Average standard deviation of split frequencies: 0.008413
815500 -- [-356.118] (-357.795) (-354.463) (-354.437) * (-356.297) (-356.725) [-356.586] (-357.755) -- 0:00:10
816000 -- (-355.225) (-358.001) (-357.453) [-354.625] * (-356.042) (-355.569) [-358.830] (-359.363) -- 0:00:10
816500 -- [-356.590] (-359.569) (-365.562) (-357.386) * (-358.306) [-354.818] (-356.771) (-355.047) -- 0:00:10
817000 -- (-355.495) [-356.688] (-358.014) (-356.100) * (-358.816) (-355.918) (-358.799) [-355.071] -- 0:00:10
817500 -- (-356.847) (-356.117) (-357.042) [-358.238] * (-356.978) (-355.851) [-355.784] (-354.909) -- 0:00:10
818000 -- (-357.180) [-356.403] (-355.222) (-356.047) * (-359.105) (-355.348) [-356.398] (-359.360) -- 0:00:10
818500 -- (-355.405) [-358.679] (-355.743) (-355.447) * (-355.979) (-357.210) (-357.818) [-354.830] -- 0:00:10
819000 -- (-356.888) [-355.073] (-358.068) (-355.664) * [-355.236] (-357.436) (-358.025) (-356.727) -- 0:00:10
819500 -- (-356.561) (-358.561) (-356.332) [-359.149] * (-359.561) [-354.736] (-357.439) (-357.556) -- 0:00:10
820000 -- (-356.219) (-356.073) [-355.121] (-356.322) * (-355.326) (-356.993) [-356.986] (-355.682) -- 0:00:10
Average standard deviation of split frequencies: 0.008796
820500 -- (-356.192) [-357.007] (-358.784) (-355.734) * [-354.695] (-360.215) (-359.134) (-356.672) -- 0:00:10
821000 -- [-356.572] (-357.066) (-356.938) (-355.460) * (-357.318) (-356.975) (-355.003) [-355.245] -- 0:00:10
821500 -- (-355.766) (-358.307) [-356.685] (-354.905) * [-354.875] (-355.420) (-356.832) (-355.696) -- 0:00:10
822000 -- [-356.756] (-357.625) (-354.816) (-355.059) * (-356.414) [-356.601] (-354.904) (-356.017) -- 0:00:10
822500 -- [-356.690] (-356.386) (-356.214) (-356.901) * (-357.276) (-354.810) (-358.465) [-356.128] -- 0:00:10
823000 -- [-354.728] (-356.434) (-358.694) (-355.911) * (-362.517) [-355.972] (-356.140) (-356.046) -- 0:00:10
823500 -- (-354.734) (-357.027) [-357.301] (-354.972) * [-356.199] (-357.624) (-356.769) (-360.397) -- 0:00:10
824000 -- [-356.137] (-355.456) (-354.981) (-353.988) * (-356.471) (-359.095) [-354.965] (-356.934) -- 0:00:10
824500 -- (-356.888) [-355.505] (-358.604) (-356.118) * (-357.310) (-356.650) (-355.814) [-355.353] -- 0:00:10
825000 -- (-358.742) (-356.527) [-354.974] (-357.263) * (-357.590) (-357.203) [-355.340] (-357.004) -- 0:00:10
Average standard deviation of split frequencies: 0.008917
825500 -- (-356.385) (-354.607) [-355.388] (-356.469) * (-355.837) [-355.795] (-358.158) (-356.775) -- 0:00:10
826000 -- (-355.636) (-356.421) (-354.727) [-357.876] * (-357.220) [-357.060] (-358.933) (-357.748) -- 0:00:10
826500 -- (-355.575) (-356.447) (-356.448) [-355.312] * [-355.405] (-355.738) (-356.850) (-355.071) -- 0:00:10
827000 -- (-364.793) (-358.048) (-355.579) [-356.240] * (-356.541) [-356.093] (-354.417) (-355.911) -- 0:00:10
827500 -- [-355.452] (-356.791) (-358.970) (-360.770) * (-356.950) (-359.282) [-355.103] (-354.723) -- 0:00:10
828000 -- (-355.571) (-358.339) (-354.581) [-359.336] * [-356.222] (-361.225) (-357.828) (-354.262) -- 0:00:10
828500 -- (-354.653) (-359.194) (-355.009) [-356.677] * (-355.465) [-355.785] (-358.229) (-355.235) -- 0:00:10
829000 -- (-358.594) (-358.536) (-355.765) [-354.766] * (-360.396) [-355.292] (-357.409) (-355.876) -- 0:00:10
829500 -- (-360.178) [-356.222] (-357.174) (-356.675) * (-357.968) (-357.448) (-356.111) [-356.012] -- 0:00:10
830000 -- (-354.531) [-355.873] (-355.957) (-354.715) * [-356.837] (-360.135) (-357.307) (-356.894) -- 0:00:10
Average standard deviation of split frequencies: 0.008974
830500 -- (-358.645) (-354.521) [-356.417] (-356.750) * (-356.835) [-358.315] (-355.714) (-356.258) -- 0:00:10
831000 -- (-354.683) [-355.251] (-355.580) (-357.393) * [-356.332] (-355.902) (-354.746) (-355.151) -- 0:00:09
831500 -- (-358.221) (-357.389) (-356.602) [-355.942] * (-358.175) (-358.659) [-358.131] (-355.222) -- 0:00:09
832000 -- (-355.549) (-358.999) [-357.005] (-355.037) * [-356.757] (-361.057) (-357.164) (-358.588) -- 0:00:09
832500 -- [-355.611] (-355.936) (-359.245) (-355.409) * [-356.255] (-365.441) (-356.542) (-357.440) -- 0:00:09
833000 -- (-359.901) (-357.423) [-355.897] (-356.131) * (-360.874) [-354.902] (-356.990) (-355.391) -- 0:00:09
833500 -- [-355.233] (-357.036) (-356.110) (-355.177) * (-359.007) (-358.803) (-354.871) [-355.119] -- 0:00:09
834000 -- (-355.830) [-358.159] (-357.766) (-357.594) * (-356.203) (-354.195) [-355.623] (-355.305) -- 0:00:09
834500 -- (-356.055) [-356.890] (-354.885) (-357.393) * [-354.382] (-356.009) (-358.608) (-355.205) -- 0:00:09
835000 -- (-356.947) (-358.344) (-355.193) [-356.547] * [-354.660] (-356.389) (-356.731) (-356.343) -- 0:00:09
Average standard deviation of split frequencies: 0.008881
835500 -- (-359.233) (-357.130) (-356.975) [-355.953] * (-356.976) (-356.407) [-357.411] (-358.811) -- 0:00:09
836000 -- (-357.258) (-356.189) [-357.546] (-355.446) * (-357.000) (-355.840) [-355.775] (-356.535) -- 0:00:09
836500 -- (-357.018) (-355.748) (-357.149) [-359.128] * (-355.298) (-356.724) [-355.808] (-355.393) -- 0:00:09
837000 -- (-356.305) [-355.774] (-357.951) (-358.047) * [-355.527] (-357.761) (-354.803) (-357.498) -- 0:00:09
837500 -- (-354.300) (-355.235) [-355.930] (-358.270) * (-356.273) (-354.588) (-356.446) [-360.587] -- 0:00:09
838000 -- (-354.654) (-355.126) [-354.840] (-356.701) * [-356.556] (-357.312) (-358.717) (-357.290) -- 0:00:09
838500 -- (-355.119) (-356.658) (-356.482) [-356.088] * (-356.483) (-363.278) (-358.648) [-355.636] -- 0:00:09
839000 -- (-363.606) (-355.940) (-354.842) [-355.977] * (-354.997) (-364.214) (-355.986) [-354.933] -- 0:00:09
839500 -- [-358.935] (-355.838) (-354.071) (-356.374) * (-356.513) (-356.741) (-359.470) [-358.045] -- 0:00:09
840000 -- [-356.994] (-356.260) (-356.409) (-354.293) * (-357.474) (-356.050) [-357.064] (-357.299) -- 0:00:09
Average standard deviation of split frequencies: 0.008902
840500 -- (-355.117) (-358.660) (-356.390) [-354.248] * (-355.968) (-357.488) [-357.446] (-355.794) -- 0:00:09
841000 -- [-355.336] (-354.422) (-356.300) (-354.739) * (-357.114) (-356.993) [-359.135] (-355.563) -- 0:00:09
841500 -- [-356.319] (-356.123) (-357.823) (-359.019) * (-354.286) [-359.916] (-357.477) (-355.567) -- 0:00:09
842000 -- (-360.842) [-356.362] (-361.476) (-357.868) * (-356.091) (-356.447) (-355.351) [-354.640] -- 0:00:09
842500 -- [-355.411] (-356.435) (-357.916) (-357.237) * (-356.520) (-356.496) (-354.823) [-354.496] -- 0:00:09
843000 -- (-358.719) (-355.055) [-354.590] (-354.045) * (-355.129) (-354.730) (-355.322) [-355.559] -- 0:00:09
843500 -- [-363.331] (-355.955) (-354.538) (-355.641) * [-354.390] (-354.075) (-355.552) (-355.575) -- 0:00:09
844000 -- (-356.048) (-356.215) (-354.841) [-355.386] * [-354.286] (-354.076) (-358.381) (-357.623) -- 0:00:09
844500 -- [-355.076] (-358.939) (-358.376) (-359.820) * (-359.256) [-355.300] (-356.405) (-356.107) -- 0:00:09
845000 -- (-354.507) [-360.739] (-364.349) (-357.172) * [-357.491] (-355.612) (-358.193) (-355.829) -- 0:00:09
Average standard deviation of split frequencies: 0.008881
845500 -- (-354.393) [-358.016] (-358.715) (-354.809) * (-356.476) (-355.838) (-360.416) [-356.762] -- 0:00:09
846000 -- (-361.317) (-355.599) [-356.975] (-357.680) * (-356.865) [-356.069] (-359.339) (-354.847) -- 0:00:09
846500 -- [-358.723] (-357.298) (-358.671) (-354.577) * (-355.115) (-356.657) [-355.812] (-354.549) -- 0:00:09
847000 -- (-354.211) (-358.377) (-355.375) [-356.588] * (-356.126) (-356.278) [-357.032] (-355.500) -- 0:00:09
847500 -- (-356.871) (-357.748) (-357.117) [-357.253] * [-354.831] (-356.722) (-357.260) (-354.479) -- 0:00:08
848000 -- [-356.731] (-357.727) (-358.849) (-358.812) * (-357.344) (-356.991) (-355.902) [-355.425] -- 0:00:08
848500 -- (-358.371) (-357.038) (-357.614) [-357.132] * [-355.761] (-358.580) (-359.341) (-355.194) -- 0:00:08
849000 -- (-355.708) (-356.677) (-354.953) [-357.843] * [-355.514] (-360.085) (-356.206) (-357.447) -- 0:00:08
849500 -- (-356.591) [-354.569] (-356.234) (-358.690) * (-356.824) (-357.901) [-355.967] (-356.041) -- 0:00:08
850000 -- (-357.413) (-356.586) [-356.487] (-354.649) * (-356.787) (-356.847) [-361.495] (-354.275) -- 0:00:08
Average standard deviation of split frequencies: 0.009074
850500 -- (-356.686) [-354.534] (-358.727) (-356.753) * (-361.507) [-355.665] (-356.267) (-354.730) -- 0:00:08
851000 -- (-356.555) [-356.317] (-356.377) (-358.504) * (-355.274) (-356.879) (-355.271) [-356.599] -- 0:00:08
851500 -- (-354.700) (-359.252) (-355.924) [-355.658] * [-356.908] (-359.401) (-357.462) (-355.830) -- 0:00:08
852000 -- (-356.493) (-356.722) (-355.501) [-355.954] * (-357.263) [-359.977] (-359.620) (-356.846) -- 0:00:08
852500 -- (-355.347) (-357.574) [-357.691] (-354.319) * [-356.861] (-357.122) (-358.098) (-358.073) -- 0:00:08
853000 -- [-355.717] (-359.212) (-357.757) (-357.926) * (-360.165) [-362.652] (-357.292) (-360.417) -- 0:00:08
853500 -- (-354.795) (-355.430) (-355.632) [-358.935] * [-357.523] (-358.846) (-355.939) (-355.240) -- 0:00:08
854000 -- [-357.085] (-358.277) (-357.194) (-359.999) * (-357.128) (-354.616) (-356.650) [-354.835] -- 0:00:08
854500 -- (-356.660) (-355.449) (-354.941) [-354.784] * [-354.697] (-356.679) (-356.484) (-360.979) -- 0:00:08
855000 -- (-357.217) (-355.475) [-355.784] (-355.694) * (-357.669) (-358.566) [-355.928] (-360.214) -- 0:00:08
Average standard deviation of split frequencies: 0.007857
855500 -- (-358.741) (-355.761) [-357.442] (-357.923) * [-354.813] (-357.101) (-356.625) (-357.261) -- 0:00:08
856000 -- (-355.404) (-355.814) (-356.950) [-355.831] * (-359.410) [-355.412] (-356.340) (-356.740) -- 0:00:08
856500 -- (-355.221) (-355.437) (-354.966) [-357.588] * [-357.082] (-358.110) (-356.737) (-357.487) -- 0:00:08
857000 -- (-357.824) (-357.747) (-355.744) [-355.376] * (-355.494) [-356.998] (-357.534) (-357.558) -- 0:00:08
857500 -- [-355.564] (-355.832) (-356.727) (-355.395) * (-354.827) (-355.614) [-356.484] (-355.386) -- 0:00:08
858000 -- (-355.599) (-354.744) [-355.445] (-356.220) * [-355.283] (-356.016) (-356.331) (-356.247) -- 0:00:08
858500 -- [-356.259] (-357.076) (-356.132) (-358.118) * (-354.899) (-359.190) (-355.923) [-357.059] -- 0:00:08
859000 -- (-357.637) (-354.767) (-357.018) [-354.925] * (-359.268) (-357.045) [-354.791] (-354.296) -- 0:00:08
859500 -- [-360.546] (-357.229) (-355.239) (-359.762) * (-357.774) (-357.500) [-356.056] (-356.053) -- 0:00:08
860000 -- (-355.703) (-355.013) (-356.366) [-357.518] * (-357.761) (-356.695) (-356.822) [-356.687] -- 0:00:08
Average standard deviation of split frequencies: 0.007778
860500 -- (-355.844) [-358.917] (-356.279) (-356.315) * [-354.610] (-355.974) (-356.850) (-356.786) -- 0:00:08
861000 -- (-358.955) (-356.334) [-357.442] (-356.631) * (-354.833) (-359.834) (-357.015) [-357.121] -- 0:00:08
861500 -- (-355.418) (-356.565) [-354.785] (-354.972) * (-355.304) (-359.263) [-354.913] (-355.290) -- 0:00:08
862000 -- (-356.715) (-356.558) (-357.049) [-357.689] * (-356.593) (-357.128) (-357.232) [-356.676] -- 0:00:08
862500 -- (-356.191) [-355.766] (-357.910) (-356.564) * (-357.046) (-355.309) (-355.927) [-356.446] -- 0:00:08
863000 -- [-356.046] (-357.290) (-355.473) (-356.607) * (-358.084) (-355.156) (-355.437) [-354.906] -- 0:00:08
863500 -- [-355.839] (-360.618) (-357.055) (-356.369) * (-354.476) [-356.014] (-356.120) (-358.884) -- 0:00:08
864000 -- (-355.144) (-357.436) [-356.853] (-359.294) * [-354.244] (-356.401) (-355.908) (-357.709) -- 0:00:08
864500 -- [-356.238] (-356.783) (-356.793) (-355.234) * (-361.425) [-357.279] (-356.970) (-358.846) -- 0:00:07
865000 -- (-356.334) [-359.214] (-355.715) (-357.843) * (-357.023) (-360.440) (-354.476) [-356.494] -- 0:00:07
Average standard deviation of split frequencies: 0.007476
865500 -- (-357.654) (-354.993) (-362.154) [-355.071] * (-358.684) (-355.025) [-355.535] (-355.745) -- 0:00:07
866000 -- (-355.835) (-360.959) [-354.837] (-356.195) * (-361.233) [-357.167] (-356.947) (-360.767) -- 0:00:07
866500 -- (-356.183) (-355.916) [-356.750] (-360.196) * (-366.603) (-358.210) (-355.229) [-355.853] -- 0:00:07
867000 -- [-359.724] (-358.629) (-360.990) (-357.918) * (-361.445) (-354.997) [-356.029] (-357.991) -- 0:00:07
867500 -- (-356.590) (-354.957) (-362.152) [-357.434] * (-355.668) [-357.072] (-354.646) (-357.428) -- 0:00:07
868000 -- (-357.683) (-357.612) (-359.175) [-354.940] * [-358.123] (-361.386) (-355.349) (-360.180) -- 0:00:07
868500 -- (-357.203) [-357.128] (-357.652) (-355.283) * [-354.967] (-357.707) (-356.911) (-357.550) -- 0:00:07
869000 -- (-355.418) (-355.272) (-358.716) [-356.079] * (-358.512) (-357.494) [-358.337] (-358.521) -- 0:00:07
869500 -- (-358.157) [-358.177] (-359.083) (-355.572) * (-356.700) (-356.907) [-354.382] (-358.218) -- 0:00:07
870000 -- (-359.902) (-355.154) [-357.813] (-355.654) * [-357.358] (-355.743) (-354.446) (-357.446) -- 0:00:07
Average standard deviation of split frequencies: 0.007255
870500 -- (-356.590) [-355.964] (-356.047) (-357.250) * (-355.259) (-357.901) (-355.097) [-362.085] -- 0:00:07
871000 -- (-356.780) (-358.806) (-354.218) [-355.534] * (-356.197) (-358.440) (-359.334) [-358.116] -- 0:00:07
871500 -- (-359.572) (-358.536) (-354.309) [-355.924] * (-357.196) (-357.089) (-355.291) [-356.567] -- 0:00:07
872000 -- (-354.461) [-357.993] (-354.675) (-355.518) * (-354.996) [-357.919] (-359.043) (-358.956) -- 0:00:07
872500 -- (-357.446) (-357.668) (-359.463) [-355.700] * (-357.384) (-356.744) (-355.972) [-354.803] -- 0:00:07
873000 -- (-355.788) [-357.964] (-355.209) (-354.617) * (-356.158) [-358.388] (-356.926) (-359.096) -- 0:00:07
873500 -- (-361.589) [-355.898] (-357.451) (-356.566) * (-357.279) [-358.054] (-355.625) (-361.337) -- 0:00:07
874000 -- [-355.123] (-355.436) (-354.970) (-357.098) * (-358.383) (-356.991) (-355.970) [-355.281] -- 0:00:07
874500 -- (-356.666) [-358.019] (-358.126) (-362.136) * (-357.384) (-357.520) (-358.228) [-354.355] -- 0:00:07
875000 -- (-355.431) [-356.295] (-355.406) (-358.932) * (-360.479) (-357.596) (-358.754) [-354.759] -- 0:00:07
Average standard deviation of split frequencies: 0.007606
875500 -- (-354.358) (-357.312) (-355.328) [-357.160] * (-357.031) [-357.602] (-357.417) (-357.099) -- 0:00:07
876000 -- (-355.270) (-358.225) (-356.376) [-357.284] * (-354.951) [-356.247] (-362.183) (-357.559) -- 0:00:07
876500 -- (-355.968) (-355.945) [-355.121] (-356.131) * (-357.344) [-354.242] (-358.180) (-357.436) -- 0:00:07
877000 -- [-355.917] (-355.711) (-360.772) (-354.751) * (-357.242) (-355.670) (-354.985) [-356.282] -- 0:00:07
877500 -- (-354.946) (-355.238) (-360.351) [-354.824] * (-358.677) (-356.442) (-355.785) [-357.491] -- 0:00:07
878000 -- (-355.765) [-357.782] (-356.567) (-354.544) * (-357.434) (-359.217) [-355.511] (-357.679) -- 0:00:07
878500 -- (-356.344) [-358.349] (-359.748) (-355.284) * (-355.585) (-357.702) [-356.839] (-357.186) -- 0:00:07
879000 -- [-355.977] (-356.144) (-358.401) (-355.270) * [-355.547] (-361.282) (-356.096) (-360.305) -- 0:00:07
879500 -- (-354.883) [-358.138] (-360.482) (-357.280) * [-356.054] (-357.249) (-358.590) (-355.460) -- 0:00:07
880000 -- [-356.698] (-358.897) (-358.061) (-355.181) * (-357.575) (-358.326) (-354.227) [-356.627] -- 0:00:07
Average standard deviation of split frequencies: 0.007030
880500 -- (-355.136) [-355.492] (-356.553) (-356.025) * (-355.371) [-354.757] (-355.232) (-357.743) -- 0:00:07
881000 -- (-357.942) [-354.760] (-354.403) (-354.807) * (-354.285) (-357.493) (-356.627) [-362.240] -- 0:00:07
881500 -- (-356.664) (-357.514) (-356.377) [-358.709] * (-356.111) (-356.826) [-355.209] (-355.704) -- 0:00:06
882000 -- (-355.650) (-359.348) [-356.596] (-358.542) * [-356.871] (-354.785) (-358.857) (-355.385) -- 0:00:06
882500 -- (-355.490) [-355.888] (-360.445) (-356.416) * (-355.397) [-354.822] (-356.245) (-355.182) -- 0:00:06
883000 -- [-355.549] (-355.971) (-354.863) (-358.062) * [-356.374] (-357.485) (-356.308) (-356.498) -- 0:00:06
883500 -- (-355.803) (-356.038) (-357.305) [-358.249] * [-356.578] (-354.541) (-356.484) (-354.278) -- 0:00:06
884000 -- [-355.913] (-356.140) (-354.625) (-359.739) * [-355.929] (-354.546) (-355.571) (-354.582) -- 0:00:06
884500 -- (-360.719) (-362.069) (-357.213) [-356.271] * (-357.628) (-354.940) (-357.459) [-355.427] -- 0:00:06
885000 -- (-358.484) (-355.783) [-356.205] (-355.651) * [-360.537] (-354.108) (-356.906) (-354.835) -- 0:00:06
Average standard deviation of split frequencies: 0.006668
885500 -- (-358.973) (-357.258) [-356.182] (-357.059) * (-359.113) [-355.783] (-360.071) (-360.600) -- 0:00:06
886000 -- (-357.659) (-357.179) (-356.973) [-356.514] * (-357.158) (-358.117) (-358.851) [-357.761] -- 0:00:06
886500 -- [-354.609] (-357.348) (-354.846) (-356.870) * (-356.984) (-358.643) [-356.460] (-358.762) -- 0:00:06
887000 -- (-354.905) [-355.775] (-354.924) (-356.034) * (-356.816) (-355.844) [-356.195] (-357.005) -- 0:00:06
887500 -- (-356.683) [-356.008] (-357.758) (-356.312) * (-357.678) (-356.795) (-354.693) [-357.527] -- 0:00:06
888000 -- (-357.013) (-359.296) [-356.905] (-358.064) * (-356.690) [-355.977] (-360.570) (-360.075) -- 0:00:06
888500 -- (-356.053) (-356.726) [-357.321] (-356.486) * [-355.283] (-357.115) (-359.310) (-358.594) -- 0:00:06
889000 -- (-357.652) (-355.667) (-359.625) [-356.842] * (-361.426) [-362.473] (-357.732) (-355.018) -- 0:00:06
889500 -- (-356.958) (-357.546) [-356.989] (-355.437) * (-357.525) (-357.796) [-356.147] (-354.369) -- 0:00:06
890000 -- (-358.905) [-356.661] (-357.225) (-355.325) * (-358.958) (-357.008) [-356.638] (-356.298) -- 0:00:06
Average standard deviation of split frequencies: 0.006598
890500 -- (-354.783) [-354.701] (-359.300) (-356.185) * [-359.374] (-355.519) (-356.726) (-356.075) -- 0:00:06
891000 -- [-355.696] (-354.787) (-358.093) (-355.475) * (-358.904) [-355.043] (-357.336) (-355.239) -- 0:00:06
891500 -- (-355.615) (-354.354) [-358.609] (-356.699) * (-356.371) (-358.205) [-357.619] (-355.407) -- 0:00:06
892000 -- (-357.928) (-358.279) [-356.758] (-359.920) * (-358.094) (-356.127) (-361.675) [-356.908] -- 0:00:06
892500 -- [-358.063] (-354.191) (-367.989) (-363.733) * (-357.280) (-357.415) [-354.820] (-354.911) -- 0:00:06
893000 -- (-356.468) [-354.197] (-354.670) (-358.503) * (-356.747) [-355.757] (-355.748) (-354.254) -- 0:00:06
893500 -- (-356.483) (-354.270) [-354.976] (-355.222) * (-355.367) (-355.732) (-356.442) [-356.241] -- 0:00:06
894000 -- (-357.691) [-354.145] (-355.526) (-357.161) * [-355.436] (-355.352) (-354.880) (-359.305) -- 0:00:06
894500 -- [-358.340] (-355.523) (-357.252) (-356.528) * (-354.222) [-356.911] (-356.347) (-358.941) -- 0:00:06
895000 -- (-356.258) [-355.326] (-360.404) (-355.317) * [-356.858] (-356.358) (-355.270) (-356.381) -- 0:00:06
Average standard deviation of split frequencies: 0.006313
895500 -- (-354.672) [-356.828] (-359.533) (-357.980) * (-354.851) (-354.736) [-357.426] (-360.187) -- 0:00:06
896000 -- (-357.108) (-357.203) (-354.685) [-354.398] * [-354.437] (-356.168) (-358.352) (-361.384) -- 0:00:06
896500 -- (-357.056) [-359.158] (-354.659) (-361.577) * (-355.429) (-356.166) [-357.400] (-357.081) -- 0:00:06
897000 -- (-356.121) (-356.216) [-355.692] (-355.349) * (-354.562) [-356.912] (-356.166) (-355.945) -- 0:00:06
897500 -- (-357.696) (-354.722) [-356.904] (-355.151) * [-354.515] (-356.577) (-356.486) (-357.504) -- 0:00:06
898000 -- [-356.766] (-357.816) (-354.891) (-363.246) * (-355.487) (-354.535) (-355.542) [-356.241] -- 0:00:06
898500 -- (-355.569) (-358.687) (-354.596) [-358.471] * [-355.468] (-355.083) (-358.560) (-357.734) -- 0:00:05
899000 -- (-357.441) (-358.843) [-356.337] (-358.367) * (-358.767) [-355.157] (-359.080) (-358.345) -- 0:00:05
899500 -- (-358.807) (-355.638) (-355.737) [-356.547] * (-359.248) (-359.767) (-358.758) [-358.399] -- 0:00:05
900000 -- [-356.825] (-357.252) (-356.467) (-357.627) * (-358.189) (-356.457) (-355.990) [-355.969] -- 0:00:05
Average standard deviation of split frequencies: 0.006211
900500 -- (-354.923) (-359.249) [-356.618] (-354.733) * (-362.238) (-355.954) (-356.199) [-354.921] -- 0:00:05
901000 -- (-357.384) (-356.511) (-354.328) [-355.514] * (-359.465) (-356.487) [-356.247] (-354.723) -- 0:00:05
901500 -- (-356.335) (-358.793) (-358.144) [-355.116] * (-354.951) [-360.016] (-357.340) (-355.734) -- 0:00:05
902000 -- (-358.172) [-358.056] (-360.904) (-357.756) * (-355.311) (-355.873) [-356.393] (-354.936) -- 0:00:05
902500 -- (-359.384) [-355.606] (-355.200) (-355.708) * (-355.125) [-354.542] (-357.417) (-355.087) -- 0:00:05
903000 -- [-358.720] (-360.223) (-355.426) (-357.491) * [-356.003] (-355.109) (-357.675) (-357.017) -- 0:00:05
903500 -- (-357.722) (-359.822) (-355.598) [-356.293] * (-357.132) (-356.197) [-359.177] (-362.893) -- 0:00:05
904000 -- (-355.468) (-362.570) (-355.440) [-355.155] * (-358.617) (-356.919) [-358.059] (-359.049) -- 0:00:05
904500 -- (-358.878) (-360.639) (-358.922) [-356.045] * (-359.275) (-356.199) [-355.410] (-358.169) -- 0:00:05
905000 -- (-359.424) (-358.448) [-355.034] (-356.536) * (-358.471) [-355.621] (-357.192) (-355.908) -- 0:00:05
Average standard deviation of split frequencies: 0.006209
905500 -- (-355.572) (-356.010) [-356.911] (-355.914) * (-356.665) [-355.622] (-357.418) (-356.974) -- 0:00:05
906000 -- (-354.256) (-354.085) (-357.850) [-356.235] * (-357.633) (-357.486) (-360.381) [-360.089] -- 0:00:05
906500 -- [-359.362] (-358.222) (-357.592) (-355.428) * (-357.751) (-354.809) (-355.192) [-359.372] -- 0:00:05
907000 -- (-354.263) (-356.001) (-354.924) [-355.936] * (-354.643) [-354.763] (-356.019) (-359.463) -- 0:00:05
907500 -- (-355.592) [-355.590] (-356.380) (-356.859) * (-357.963) (-356.313) (-357.097) [-356.537] -- 0:00:05
908000 -- (-357.129) (-354.872) [-356.675] (-357.242) * [-357.392] (-356.868) (-358.477) (-359.572) -- 0:00:05
908500 -- (-356.238) (-355.750) (-357.529) [-355.395] * (-357.116) [-355.340] (-357.882) (-359.082) -- 0:00:05
909000 -- [-356.725] (-356.258) (-356.635) (-356.795) * (-359.809) (-356.442) [-355.826] (-355.678) -- 0:00:05
909500 -- [-354.674] (-356.351) (-355.345) (-355.849) * [-356.020] (-356.649) (-357.084) (-354.698) -- 0:00:05
910000 -- (-355.854) (-356.318) [-355.725] (-357.204) * [-355.401] (-354.755) (-358.211) (-357.383) -- 0:00:05
Average standard deviation of split frequencies: 0.006350
910500 -- (-354.916) [-356.359] (-358.137) (-359.087) * (-357.043) (-356.920) [-356.646] (-355.583) -- 0:00:05
911000 -- [-356.102] (-355.229) (-356.502) (-356.742) * (-355.623) [-356.500] (-355.261) (-355.814) -- 0:00:05
911500 -- (-359.708) (-358.133) (-357.831) [-355.571] * (-354.625) (-358.082) (-358.545) [-358.705] -- 0:00:05
912000 -- (-354.680) (-357.615) [-361.205] (-355.291) * (-356.630) (-355.984) (-358.899) [-357.707] -- 0:00:05
912500 -- (-354.626) [-355.695] (-357.576) (-355.997) * (-355.681) (-358.530) [-356.874] (-356.153) -- 0:00:05
913000 -- (-357.458) (-356.953) [-357.321] (-358.730) * (-356.308) (-356.546) (-356.430) [-355.158] -- 0:00:05
913500 -- (-356.076) (-359.827) [-356.467] (-357.961) * (-357.680) (-356.684) (-363.626) [-356.009] -- 0:00:05
914000 -- (-355.717) [-355.711] (-354.858) (-356.620) * [-360.973] (-357.710) (-355.261) (-354.167) -- 0:00:05
914500 -- [-356.628] (-355.025) (-355.380) (-358.717) * (-355.448) (-356.621) [-356.364] (-355.710) -- 0:00:05
915000 -- (-357.150) (-355.316) (-359.229) [-358.376] * (-355.915) (-355.077) [-355.486] (-355.085) -- 0:00:05
Average standard deviation of split frequencies: 0.007720
915500 -- [-356.042] (-357.585) (-356.241) (-356.347) * (-355.459) (-356.020) [-354.098] (-356.178) -- 0:00:04
916000 -- [-354.411] (-354.755) (-357.246) (-356.011) * [-355.053] (-358.986) (-356.618) (-356.295) -- 0:00:04
916500 -- (-355.023) [-356.486] (-355.459) (-358.323) * (-357.644) (-355.992) (-354.938) [-356.367] -- 0:00:04
917000 -- [-354.462] (-355.934) (-354.659) (-355.603) * (-360.843) (-358.054) [-355.945] (-355.002) -- 0:00:04
917500 -- (-355.923) (-356.108) [-355.330] (-355.669) * (-355.115) (-362.072) [-355.206] (-357.190) -- 0:00:04
918000 -- (-357.974) (-356.494) [-361.258] (-357.469) * (-356.530) [-359.088] (-354.903) (-359.660) -- 0:00:04
918500 -- (-356.888) [-356.956] (-360.585) (-356.826) * (-357.343) (-358.055) [-355.033] (-358.467) -- 0:00:04
919000 -- (-354.902) (-355.339) (-357.278) [-356.740] * (-355.181) (-356.518) [-356.020] (-355.399) -- 0:00:04
919500 -- (-357.107) (-354.680) [-356.143] (-356.426) * (-357.623) [-355.718] (-357.085) (-359.540) -- 0:00:04
920000 -- (-358.213) (-359.766) (-359.272) [-358.086] * [-356.864] (-356.088) (-357.253) (-356.365) -- 0:00:04
Average standard deviation of split frequencies: 0.006690
920500 -- (-354.517) [-360.043] (-359.817) (-358.261) * [-358.633] (-355.352) (-355.144) (-356.763) -- 0:00:04
921000 -- (-357.493) (-356.465) (-358.238) [-355.042] * (-356.935) [-354.845] (-355.059) (-356.423) -- 0:00:04
921500 -- (-354.899) [-359.154] (-354.472) (-357.116) * [-354.914] (-357.689) (-358.635) (-355.454) -- 0:00:04
922000 -- (-360.360) [-357.140] (-355.917) (-355.309) * (-355.639) (-360.499) (-358.306) [-356.879] -- 0:00:04
922500 -- (-357.641) [-357.154] (-355.932) (-355.915) * (-355.713) (-355.334) (-354.627) [-354.782] -- 0:00:04
923000 -- (-361.510) (-355.037) (-354.793) [-357.729] * [-356.857] (-356.656) (-355.492) (-360.380) -- 0:00:04
923500 -- (-355.290) (-356.299) (-354.856) [-355.310] * (-354.540) (-358.016) (-355.985) [-358.144] -- 0:00:04
924000 -- (-358.089) (-359.557) (-357.318) [-355.531] * [-355.483] (-355.484) (-354.223) (-358.149) -- 0:00:04
924500 -- (-355.816) (-358.516) (-357.747) [-356.506] * (-359.200) (-355.834) (-354.869) [-356.752] -- 0:00:04
925000 -- (-360.262) (-358.859) (-355.225) [-355.117] * (-364.326) (-357.666) (-355.728) [-354.971] -- 0:00:04
Average standard deviation of split frequencies: 0.006686
925500 -- (-355.030) [-360.123] (-355.159) (-355.307) * (-359.164) [-356.483] (-354.311) (-355.447) -- 0:00:04
926000 -- (-354.616) [-357.885] (-356.319) (-355.640) * (-355.965) (-357.070) [-356.534] (-358.769) -- 0:00:04
926500 -- (-354.375) [-357.095] (-358.261) (-355.625) * (-356.382) (-359.517) [-355.755] (-356.141) -- 0:00:04
927000 -- (-358.273) (-354.935) [-356.323] (-355.641) * (-355.875) (-356.672) (-360.820) [-357.521] -- 0:00:04
927500 -- (-354.975) (-356.933) (-358.132) [-354.983] * (-360.862) (-359.325) (-355.318) [-355.300] -- 0:00:04
928000 -- (-354.715) (-358.182) [-356.307] (-355.844) * (-357.123) (-357.009) [-356.391] (-356.376) -- 0:00:04
928500 -- [-357.140] (-355.697) (-358.016) (-356.230) * (-362.062) (-357.340) [-356.802] (-354.306) -- 0:00:04
929000 -- (-360.087) (-355.458) [-354.833] (-356.297) * (-361.188) (-357.683) (-357.242) [-355.710] -- 0:00:04
929500 -- (-360.591) (-355.762) (-357.022) [-355.808] * (-354.644) [-358.237] (-355.407) (-356.621) -- 0:00:04
930000 -- [-360.028] (-355.737) (-354.732) (-358.253) * (-357.706) (-359.838) [-355.886] (-356.969) -- 0:00:04
Average standard deviation of split frequencies: 0.006619
930500 -- (-355.492) [-357.841] (-357.881) (-355.062) * (-356.119) (-356.776) [-355.182] (-358.563) -- 0:00:04
931000 -- [-356.253] (-355.315) (-354.805) (-355.029) * (-360.537) (-354.537) [-355.671] (-356.057) -- 0:00:04
931500 -- (-358.410) (-354.581) (-356.562) [-355.074] * [-356.220] (-356.049) (-355.313) (-356.651) -- 0:00:04
932000 -- (-355.445) (-355.140) (-356.168) [-355.167] * (-354.526) (-356.363) (-355.452) [-357.050] -- 0:00:04
932500 -- [-357.581] (-356.204) (-357.548) (-359.645) * (-355.529) (-357.010) (-360.782) [-354.965] -- 0:00:03
933000 -- (-355.740) (-357.164) (-355.379) [-356.709] * (-357.357) (-355.981) (-356.417) [-356.987] -- 0:00:03
933500 -- (-357.354) [-356.684] (-357.298) (-354.772) * (-358.506) (-354.883) (-357.251) [-355.875] -- 0:00:03
934000 -- [-355.887] (-357.824) (-356.600) (-354.392) * [-354.673] (-358.193) (-354.637) (-355.199) -- 0:00:03
934500 -- (-356.913) (-355.039) (-356.662) [-358.288] * [-356.666] (-359.367) (-354.301) (-357.377) -- 0:00:03
935000 -- (-356.805) (-357.485) (-355.208) [-356.042] * (-357.068) (-355.525) (-355.313) [-357.396] -- 0:00:03
Average standard deviation of split frequencies: 0.006782
935500 -- [-355.596] (-355.418) (-361.531) (-354.381) * (-356.040) (-354.546) [-355.944] (-357.006) -- 0:00:03
936000 -- (-355.295) [-355.370] (-356.255) (-357.379) * (-359.769) (-354.440) (-355.157) [-356.240] -- 0:00:03
936500 -- (-357.708) [-356.791] (-355.281) (-355.818) * (-357.011) (-354.383) [-356.525] (-355.521) -- 0:00:03
937000 -- (-356.297) [-357.486] (-354.493) (-355.719) * (-355.740) [-355.706] (-356.381) (-358.066) -- 0:00:03
937500 -- (-359.699) (-354.740) (-356.141) [-354.928] * [-354.734] (-357.139) (-355.070) (-355.631) -- 0:00:03
938000 -- [-359.765] (-355.006) (-356.600) (-357.133) * (-359.111) (-356.287) [-357.017] (-356.738) -- 0:00:03
938500 -- (-357.157) (-356.227) [-355.324] (-355.954) * (-357.797) (-357.879) [-355.594] (-356.646) -- 0:00:03
939000 -- (-356.793) (-361.206) (-355.738) [-357.536] * (-358.773) (-354.741) (-356.660) [-357.316] -- 0:00:03
939500 -- [-355.673] (-359.239) (-355.477) (-357.279) * (-363.056) (-354.726) (-355.096) [-356.391] -- 0:00:03
940000 -- [-356.578] (-358.901) (-355.324) (-355.533) * (-354.941) [-355.082] (-356.963) (-355.192) -- 0:00:03
Average standard deviation of split frequencies: 0.007016
940500 -- [-359.154] (-358.151) (-355.447) (-355.217) * (-363.052) [-358.140] (-359.100) (-357.153) -- 0:00:03
941000 -- (-358.095) (-359.615) (-355.329) [-355.243] * [-356.416] (-356.754) (-355.941) (-356.083) -- 0:00:03
941500 -- (-355.872) [-354.918] (-356.144) (-356.949) * [-354.641] (-356.365) (-358.031) (-355.648) -- 0:00:03
942000 -- (-355.844) [-356.737] (-355.746) (-357.294) * [-360.658] (-355.703) (-357.935) (-356.604) -- 0:00:03
942500 -- (-357.112) (-358.586) [-355.537] (-357.367) * [-354.577] (-357.434) (-357.847) (-357.198) -- 0:00:03
943000 -- [-357.242] (-356.501) (-358.039) (-358.423) * (-354.951) (-354.886) [-355.895] (-356.998) -- 0:00:03
943500 -- (-358.435) [-354.992] (-355.781) (-359.623) * (-357.748) [-355.124] (-358.956) (-355.351) -- 0:00:03
944000 -- (-360.035) [-355.378] (-359.091) (-354.812) * (-358.145) (-355.347) (-356.849) [-358.814] -- 0:00:03
944500 -- (-356.176) [-354.711] (-360.849) (-355.204) * (-357.148) [-357.335] (-354.779) (-354.407) -- 0:00:03
945000 -- (-355.239) (-354.359) [-356.131] (-354.773) * (-357.373) (-355.084) [-354.845] (-355.145) -- 0:00:03
Average standard deviation of split frequencies: 0.008098
945500 -- [-355.896] (-356.849) (-355.919) (-357.960) * (-356.761) (-357.260) [-355.714] (-355.684) -- 0:00:03
946000 -- (-356.761) (-355.855) (-354.600) [-357.060] * (-360.025) (-355.388) [-354.948] (-355.108) -- 0:00:03
946500 -- (-357.844) (-355.247) [-356.155] (-355.532) * (-362.541) (-354.331) [-355.142] (-358.427) -- 0:00:03
947000 -- (-355.014) (-359.648) (-357.922) [-355.794] * (-362.127) [-355.620] (-355.154) (-359.224) -- 0:00:03
947500 -- (-355.551) (-354.760) (-354.846) [-355.584] * (-356.776) [-354.476] (-354.873) (-360.266) -- 0:00:03
948000 -- (-357.831) (-360.543) [-356.683] (-356.035) * (-360.030) (-357.263) [-355.353] (-358.606) -- 0:00:03
948500 -- (-355.623) [-356.076] (-361.717) (-358.628) * (-355.173) [-355.112] (-354.497) (-357.032) -- 0:00:03
949000 -- (-355.921) (-359.620) (-361.478) [-356.743] * (-355.726) (-355.191) (-357.267) [-357.618] -- 0:00:03
949500 -- (-361.267) (-355.961) (-358.443) [-356.079] * (-355.672) (-354.857) [-355.532] (-355.270) -- 0:00:02
950000 -- (-360.480) [-355.981] (-359.257) (-355.635) * (-358.165) [-354.668] (-356.236) (-357.473) -- 0:00:02
Average standard deviation of split frequencies: 0.008120
950500 -- [-356.474] (-356.402) (-355.436) (-355.353) * [-355.220] (-355.977) (-356.807) (-356.958) -- 0:00:02
951000 -- [-355.633] (-356.231) (-355.742) (-354.703) * (-357.137) [-356.383] (-356.998) (-355.945) -- 0:00:02
951500 -- [-358.415] (-358.464) (-354.512) (-355.690) * (-363.418) (-356.728) [-358.277] (-357.550) -- 0:00:02
952000 -- [-358.960] (-355.076) (-358.730) (-355.996) * (-356.576) (-357.949) (-359.509) [-356.645] -- 0:00:02
952500 -- (-355.654) (-355.685) [-357.050] (-356.089) * [-355.950] (-356.534) (-359.195) (-357.037) -- 0:00:02
953000 -- (-355.255) (-356.887) [-354.470] (-354.271) * (-356.005) [-358.606] (-354.963) (-356.757) -- 0:00:02
953500 -- (-358.646) (-355.527) (-355.092) [-354.756] * (-356.931) (-355.399) (-355.399) [-355.139] -- 0:00:02
954000 -- [-358.219] (-356.156) (-356.360) (-355.030) * [-356.335] (-356.815) (-358.047) (-354.089) -- 0:00:02
954500 -- (-360.102) [-355.080] (-359.658) (-356.898) * (-355.066) (-356.567) (-359.389) [-355.927] -- 0:00:02
955000 -- (-354.626) (-355.923) [-359.022] (-358.150) * (-357.526) (-354.695) [-356.510] (-356.771) -- 0:00:02
Average standard deviation of split frequencies: 0.007068
955500 -- (-355.031) [-355.006] (-356.609) (-356.129) * (-356.198) [-356.872] (-356.165) (-354.621) -- 0:00:02
956000 -- (-354.605) (-355.954) [-355.911] (-358.234) * [-357.289] (-358.781) (-357.776) (-356.060) -- 0:00:02
956500 -- (-357.020) (-358.815) (-355.377) [-357.114] * (-358.814) (-362.236) (-359.844) [-357.361] -- 0:00:02
957000 -- (-356.255) (-358.414) [-356.717] (-360.431) * (-355.126) [-358.252] (-357.857) (-359.034) -- 0:00:02
957500 -- (-357.664) (-357.507) (-356.910) [-355.725] * (-355.869) (-354.314) [-354.042] (-356.239) -- 0:00:02
958000 -- [-356.318] (-354.171) (-356.154) (-360.116) * (-355.225) [-354.366] (-357.982) (-360.768) -- 0:00:02
958500 -- (-362.097) (-358.299) [-355.084] (-356.064) * (-355.650) [-354.348] (-355.022) (-359.450) -- 0:00:02
959000 -- (-355.555) (-356.793) [-360.162] (-357.729) * (-355.245) (-356.168) (-355.390) [-357.933] -- 0:00:02
959500 -- (-355.568) (-355.346) [-354.290] (-358.169) * (-355.362) (-357.197) [-355.307] (-355.184) -- 0:00:02
960000 -- (-358.046) (-358.017) (-356.765) [-357.623] * (-357.986) (-359.848) (-356.201) [-356.062] -- 0:00:02
Average standard deviation of split frequencies: 0.007132
960500 -- (-357.965) (-361.702) (-358.454) [-357.336] * (-361.143) (-364.744) (-356.401) [-356.023] -- 0:00:02
961000 -- (-362.009) (-357.093) [-358.704] (-358.820) * (-358.806) [-354.433] (-357.517) (-356.846) -- 0:00:02
961500 -- (-356.548) (-355.981) (-359.001) [-355.451] * [-355.696] (-355.579) (-356.489) (-358.057) -- 0:00:02
962000 -- (-355.456) [-356.722] (-362.101) (-360.051) * (-356.567) (-356.218) [-356.144] (-360.156) -- 0:00:02
962500 -- (-355.004) (-362.569) [-357.051] (-357.684) * (-356.275) (-355.855) (-355.599) [-355.441] -- 0:00:02
963000 -- (-355.805) (-359.618) [-357.655] (-355.655) * (-357.367) [-356.111] (-357.346) (-357.537) -- 0:00:02
963500 -- (-355.578) [-357.032] (-356.583) (-354.871) * (-356.100) (-355.944) [-355.225] (-356.178) -- 0:00:02
964000 -- (-355.800) [-356.866] (-360.306) (-356.759) * [-356.062] (-358.499) (-357.726) (-354.999) -- 0:00:02
964500 -- [-354.932] (-358.605) (-356.757) (-357.720) * [-354.658] (-358.806) (-354.895) (-357.785) -- 0:00:02
965000 -- [-361.287] (-355.930) (-357.436) (-356.233) * [-354.137] (-362.185) (-357.747) (-357.622) -- 0:00:02
Average standard deviation of split frequencies: 0.007092
965500 -- (-363.334) [-354.552] (-356.657) (-356.702) * (-359.866) [-354.517] (-359.476) (-354.685) -- 0:00:02
966000 -- (-358.485) (-354.878) (-357.185) [-357.474] * (-356.686) (-355.101) (-355.937) [-356.330] -- 0:00:02
966500 -- [-355.176] (-361.543) (-359.067) (-356.733) * (-358.497) [-355.995] (-354.696) (-358.689) -- 0:00:01
967000 -- (-356.851) [-357.924] (-356.331) (-359.179) * (-356.227) (-355.377) [-358.701] (-356.751) -- 0:00:01
967500 -- (-357.253) [-356.890] (-358.485) (-356.613) * (-355.531) (-356.080) (-355.647) [-357.728] -- 0:00:01
968000 -- [-355.388] (-357.331) (-358.962) (-357.149) * (-357.696) (-354.952) [-356.016] (-358.817) -- 0:00:01
968500 -- (-355.733) [-356.278] (-356.116) (-356.457) * (-359.613) (-355.455) (-354.622) [-357.309] -- 0:00:01
969000 -- (-358.555) (-355.410) [-354.324] (-356.252) * (-357.313) (-359.724) [-358.623] (-356.386) -- 0:00:01
969500 -- (-359.082) (-355.478) (-355.928) [-356.717] * (-360.021) (-356.454) (-358.539) [-354.137] -- 0:00:01
970000 -- (-360.205) (-358.495) [-354.416] (-355.444) * (-357.476) (-361.642) (-355.736) [-355.498] -- 0:00:01
Average standard deviation of split frequencies: 0.008347
970500 -- (-355.785) (-355.882) [-356.263] (-357.145) * (-354.694) (-357.375) (-356.447) [-356.629] -- 0:00:01
971000 -- (-354.953) [-354.364] (-354.594) (-356.791) * (-355.567) (-357.343) [-355.471] (-354.751) -- 0:00:01
971500 -- (-357.476) (-358.191) [-355.740] (-357.909) * (-358.831) (-361.123) [-354.988] (-355.822) -- 0:00:01
972000 -- [-357.826] (-356.027) (-356.810) (-357.376) * (-357.541) (-358.792) (-359.481) [-354.421] -- 0:00:01
972500 -- (-358.821) (-360.388) (-358.668) [-356.881] * (-356.189) (-362.357) [-354.183] (-355.073) -- 0:00:01
973000 -- [-358.150] (-357.961) (-355.174) (-361.688) * (-356.677) (-356.758) [-356.707] (-356.977) -- 0:00:01
973500 -- [-356.382] (-356.307) (-356.417) (-359.316) * [-357.416] (-356.328) (-359.587) (-359.214) -- 0:00:01
974000 -- (-356.553) [-354.989] (-355.556) (-355.207) * (-356.107) (-357.222) [-355.033] (-359.432) -- 0:00:01
974500 -- (-355.050) (-357.451) [-354.914] (-354.713) * (-358.507) [-355.144] (-355.653) (-354.193) -- 0:00:01
975000 -- (-357.639) [-356.193] (-355.161) (-357.579) * (-356.710) (-356.205) [-356.817] (-356.962) -- 0:00:01
Average standard deviation of split frequencies: 0.008241
975500 -- (-356.967) [-356.852] (-356.279) (-356.964) * (-358.426) (-355.193) [-355.221] (-359.258) -- 0:00:01
976000 -- (-356.062) [-356.504] (-359.938) (-355.369) * (-355.917) (-356.636) (-356.411) [-357.045] -- 0:00:01
976500 -- (-356.945) (-357.934) (-359.286) [-355.949] * [-356.819] (-355.830) (-356.604) (-355.532) -- 0:00:01
977000 -- (-364.234) (-357.693) [-356.402] (-355.317) * (-357.381) [-355.591] (-358.023) (-357.327) -- 0:00:01
977500 -- [-358.195] (-355.701) (-358.438) (-358.071) * (-360.192) (-355.732) (-356.816) [-355.240] -- 0:00:01
978000 -- (-358.626) (-357.248) [-354.532] (-357.212) * (-356.150) (-355.444) [-356.037] (-354.577) -- 0:00:01
978500 -- (-355.811) (-357.264) (-357.436) [-358.982] * [-357.077] (-358.801) (-358.154) (-354.481) -- 0:00:01
979000 -- (-355.589) (-357.718) (-358.837) [-356.567] * (-356.568) [-356.276] (-355.873) (-357.392) -- 0:00:01
979500 -- (-357.729) [-358.590] (-356.558) (-361.004) * (-354.973) [-357.833] (-354.939) (-356.265) -- 0:00:01
980000 -- (-355.346) (-357.614) (-357.345) [-357.582] * (-356.497) (-360.385) [-354.870] (-360.267) -- 0:00:01
Average standard deviation of split frequencies: 0.007627
980500 -- [-357.004] (-357.381) (-355.523) (-356.192) * (-358.879) (-355.541) [-355.743] (-355.864) -- 0:00:01
981000 -- [-356.008] (-355.930) (-356.544) (-355.546) * [-355.835] (-355.034) (-356.027) (-358.896) -- 0:00:01
981500 -- (-355.811) [-356.986] (-354.541) (-355.558) * [-356.554] (-355.709) (-357.053) (-358.266) -- 0:00:01
982000 -- (-355.691) (-354.715) [-356.701] (-354.531) * (-356.195) [-356.957] (-356.803) (-355.216) -- 0:00:01
982500 -- [-355.554] (-357.383) (-355.909) (-356.175) * [-354.592] (-356.462) (-354.605) (-356.579) -- 0:00:01
983000 -- (-355.892) (-359.147) [-354.743] (-359.286) * (-354.798) (-356.629) [-357.139] (-359.108) -- 0:00:01
983500 -- [-355.947] (-356.919) (-354.567) (-355.965) * [-358.653] (-357.730) (-355.767) (-357.070) -- 0:00:00
984000 -- (-354.943) [-354.387] (-356.931) (-359.606) * (-356.349) (-356.600) [-358.456] (-355.311) -- 0:00:00
984500 -- (-358.485) (-354.923) (-354.742) [-356.384] * (-356.687) (-357.772) (-356.948) [-355.933] -- 0:00:00
985000 -- (-357.213) (-354.542) (-355.048) [-358.700] * (-367.769) (-357.418) [-355.240] (-355.648) -- 0:00:00
Average standard deviation of split frequencies: 0.008247
985500 -- (-357.970) (-357.694) (-359.252) [-360.154] * [-359.342] (-356.189) (-360.095) (-358.336) -- 0:00:00
986000 -- (-359.052) (-356.331) [-354.482] (-354.523) * (-359.003) (-358.021) (-355.280) [-357.539] -- 0:00:00
986500 -- (-356.161) (-354.951) [-356.799] (-357.075) * (-355.343) (-354.943) [-354.774] (-361.766) -- 0:00:00
987000 -- (-358.552) [-354.567] (-356.744) (-356.766) * (-360.607) (-354.528) [-356.256] (-358.765) -- 0:00:00
987500 -- (-355.227) (-354.593) [-357.551] (-356.492) * (-357.336) [-355.608] (-358.117) (-356.655) -- 0:00:00
988000 -- (-364.500) (-355.499) (-356.808) [-354.786] * (-358.445) (-355.026) (-360.639) [-354.802] -- 0:00:00
988500 -- [-359.240] (-356.028) (-355.685) (-355.916) * (-355.908) [-356.059] (-355.662) (-357.219) -- 0:00:00
989000 -- (-356.626) [-355.206] (-355.459) (-360.189) * (-356.246) (-356.014) [-356.837] (-356.528) -- 0:00:00
989500 -- (-354.531) (-354.693) (-354.415) [-358.701] * (-357.420) (-356.782) [-355.201] (-357.094) -- 0:00:00
990000 -- (-355.309) (-356.570) (-357.148) [-355.509] * [-355.652] (-355.779) (-355.147) (-355.327) -- 0:00:00
Average standard deviation of split frequencies: 0.007455
990500 -- (-359.968) (-356.242) (-363.143) [-355.534] * [-354.718] (-355.129) (-357.624) (-356.739) -- 0:00:00
991000 -- [-354.616] (-358.304) (-361.458) (-355.502) * (-356.353) (-359.347) [-355.273] (-356.024) -- 0:00:00
991500 -- (-355.663) (-356.465) [-356.584] (-356.820) * (-357.133) (-358.388) [-355.477] (-358.273) -- 0:00:00
992000 -- [-355.234] (-355.491) (-357.470) (-354.807) * [-355.509] (-357.458) (-360.689) (-355.972) -- 0:00:00
992500 -- (-355.999) (-356.911) (-355.578) [-360.465] * (-356.484) (-355.921) (-358.831) [-355.044] -- 0:00:00
993000 -- [-354.992] (-354.681) (-356.823) (-356.809) * [-358.126] (-362.496) (-357.974) (-360.564) -- 0:00:00
993500 -- [-355.879] (-356.233) (-355.488) (-354.866) * [-356.725] (-359.811) (-358.204) (-357.971) -- 0:00:00
994000 -- (-354.862) [-357.130] (-354.554) (-356.786) * [-356.888] (-356.149) (-355.862) (-357.830) -- 0:00:00
994500 -- (-359.705) (-355.936) [-354.538] (-356.479) * [-356.576] (-358.399) (-355.750) (-357.372) -- 0:00:00
995000 -- (-358.998) (-356.159) (-357.305) [-356.761] * [-358.018] (-359.137) (-355.456) (-356.398) -- 0:00:00
Average standard deviation of split frequencies: 0.007415
995500 -- (-356.125) (-358.994) (-355.979) [-357.482] * (-356.776) [-355.160] (-356.120) (-356.703) -- 0:00:00
996000 -- (-354.214) (-362.623) [-355.167] (-356.491) * (-357.614) (-356.492) (-355.539) [-357.783] -- 0:00:00
996500 -- (-355.154) [-356.476] (-356.202) (-356.957) * (-359.592) [-356.211] (-355.179) (-357.431) -- 0:00:00
997000 -- (-354.365) [-356.077] (-357.933) (-354.615) * [-354.675] (-355.463) (-358.522) (-360.193) -- 0:00:00
997500 -- [-355.166] (-359.840) (-361.186) (-355.243) * (-357.385) (-356.580) (-360.932) [-354.640] -- 0:00:00
998000 -- (-355.715) (-360.334) [-356.655] (-357.618) * (-357.159) (-356.122) (-355.661) [-354.510] -- 0:00:00
998500 -- (-355.856) [-354.886] (-357.146) (-357.038) * (-356.955) (-359.697) (-356.086) [-355.816] -- 0:00:00
999000 -- (-356.027) (-355.499) (-355.399) [-355.854] * (-360.838) (-358.474) (-361.881) [-357.231] -- 0:00:00
999500 -- [-354.703] (-360.318) (-358.927) (-356.657) * [-356.769] (-356.215) (-359.673) (-356.280) -- 0:00:00
1000000 -- (-354.099) (-357.815) (-354.907) [-359.996] * (-356.630) (-356.460) [-356.596] (-357.250) -- 0:00:00
Average standard deviation of split frequencies: 0.007443
Analysis completed in 59 seconds
Analysis used 57.57 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -353.95
Likelihood of best state for "cold" chain of run 2 was -353.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
77.0 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.3 % ( 30 %) Dirichlet(Pi{all})
40.6 % ( 22 %) Slider(Pi{all})
78.6 % ( 51 %) Multiplier(Alpha{1,2})
77.5 % ( 54 %) Multiplier(Alpha{3})
27.3 % ( 19 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.5 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 79 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.7 % ( 31 %) Dirichlet(Pi{all})
41.2 % ( 30 %) Slider(Pi{all})
79.4 % ( 57 %) Multiplier(Alpha{1,2})
77.2 % ( 45 %) Multiplier(Alpha{3})
26.0 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.6 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167138 0.82 0.67
3 | 166505 167211 0.84
4 | 165550 166830 166766
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167041 0.82 0.67
3 | 166436 167261 0.84
4 | 166874 166144 166244
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -355.86
| 2 1 2 |
| 2 111 1 1 1 22 2|
| 1 1 12 22 22 1 2 22 |
| 1 2 2 22 1 2 21 |
| 11 1 2 1 2 1 1 1 2 1 12 2 1 1|
| 2 2 1 11 1 2 22 * 21 1 1 2 |
| 1 1 12 2 2 2 2 1 1 1 21 |
| 2 21 * 12 12 2* 2 1 1 1 |
| 2 2 1 2 2 1 21 |
|1 2 1 * 2 12 |
|2 |
| 111 2 1 |
| |
| 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -357.42
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -355.71 -359.01
2 -355.70 -358.80
--------------------------------------
TOTAL -355.71 -358.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890212 0.089446 0.345066 1.460665 0.863421 1228.97 1364.98 1.000
r(A<->C){all} 0.168078 0.018478 0.000106 0.436838 0.135642 153.01 310.56 1.002
r(A<->G){all} 0.164927 0.018634 0.000115 0.434387 0.129447 214.40 355.97 1.000
r(A<->T){all} 0.159762 0.018094 0.000057 0.429445 0.123165 167.55 336.84 1.003
r(C<->G){all} 0.164053 0.017280 0.000009 0.420027 0.133845 81.32 194.81 1.000
r(C<->T){all} 0.168728 0.019384 0.000009 0.444398 0.134371 159.53 224.15 1.001
r(G<->T){all} 0.174452 0.020392 0.000162 0.467088 0.139204 198.25 208.57 1.003
pi(A){all} 0.207108 0.000603 0.162462 0.256980 0.206667 1390.16 1445.58 1.001
pi(C){all} 0.287183 0.000784 0.234554 0.344478 0.286797 1254.92 1287.24 1.000
pi(G){all} 0.328208 0.000804 0.274782 0.385195 0.327692 1090.62 1121.08 1.000
pi(T){all} 0.177500 0.000560 0.132879 0.224912 0.176445 1114.20 1150.05 1.000
alpha{1,2} 0.419531 0.236215 0.000128 1.418861 0.242153 1206.43 1279.04 1.000
alpha{3} 0.480050 0.259433 0.000148 1.509187 0.311323 1246.58 1373.79 1.000
pinvar{all} 0.993780 0.000055 0.980224 0.999999 0.996111 1368.90 1434.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- .*..*.
9 -- .***.*
10 -- ..**..
11 -- ....**
12 -- ..*..*
13 -- ...*.*
14 -- .****.
15 -- ..*.*.
16 -- .**.**
17 -- .*.***
18 -- .**...
19 -- .*.*..
20 -- ...**.
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 482 0.160560 0.000000 0.160560 0.160560 2
8 450 0.149900 0.000000 0.149900 0.149900 2
9 438 0.145903 0.001884 0.144570 0.147235 2
10 438 0.145903 0.013191 0.136576 0.155230 2
11 433 0.144237 0.016488 0.132578 0.155896 2
12 425 0.141572 0.009893 0.134577 0.148568 2
13 424 0.141239 0.003769 0.138574 0.143904 2
14 423 0.140906 0.020257 0.126582 0.155230 2
15 419 0.139574 0.009893 0.132578 0.146569 2
16 419 0.139574 0.011777 0.131246 0.147901 2
17 419 0.139574 0.004240 0.136576 0.142572 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 414 0.137908 0.009422 0.131246 0.144570 2
20 411 0.136909 0.000471 0.136576 0.137242 2
21 407 0.135576 0.009893 0.128581 0.142572 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101129 0.010447 0.000005 0.301872 0.070605 1.000 2
length{all}[2] 0.099100 0.010173 0.000097 0.292079 0.068005 1.000 2
length{all}[3] 0.100511 0.010466 0.000054 0.297321 0.069001 1.001 2
length{all}[4] 0.099308 0.009143 0.000004 0.296614 0.070026 1.000 2
length{all}[5] 0.100510 0.010064 0.000021 0.293372 0.069311 1.000 2
length{all}[6] 0.098354 0.010103 0.000086 0.308867 0.066479 1.000 2
length{all}[7] 0.095322 0.008190 0.000273 0.292681 0.065104 0.998 2
length{all}[8] 0.097107 0.008848 0.000246 0.292342 0.064192 0.998 2
length{all}[9] 0.091863 0.007798 0.000026 0.274778 0.061569 0.998 2
length{all}[10] 0.092553 0.008322 0.000125 0.272698 0.061416 1.002 2
length{all}[11] 0.099464 0.010508 0.000284 0.311033 0.071146 0.998 2
length{all}[12] 0.098984 0.008506 0.000163 0.285164 0.073358 1.009 2
length{all}[13] 0.098739 0.010063 0.000149 0.312085 0.066088 0.998 2
length{all}[14] 0.100492 0.011212 0.000138 0.295213 0.064629 1.004 2
length{all}[15] 0.097198 0.009128 0.000336 0.283598 0.066066 0.998 2
length{all}[16] 0.095226 0.008295 0.000055 0.272310 0.069316 0.998 2
length{all}[17] 0.098104 0.010283 0.000193 0.313637 0.066115 1.000 2
length{all}[18] 0.094253 0.010194 0.000055 0.268452 0.067933 1.002 2
length{all}[19] 0.094361 0.010120 0.000466 0.267225 0.059860 1.011 2
length{all}[20] 0.097091 0.008386 0.000198 0.281744 0.066517 0.998 2
length{all}[21] 0.095903 0.009966 0.000141 0.292828 0.069341 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007443
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 261
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 87 / 87 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 87 / 87 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058066 0.052681 0.040955 0.046259 0.081596 0.072546 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -374.070313
Iterating by ming2
Initial: fx= 374.070313
x= 0.05807 0.05268 0.04096 0.04626 0.08160 0.07255 0.30000 1.30000
1 h-m-p 0.0000 0.0005 210.0379 +++ 352.991975 m 0.0005 14 | 1/8
2 h-m-p 0.0041 0.0386 22.2506 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 192.9587 ++ 350.692734 m 0.0001 46 | 2/8
4 h-m-p 0.0006 0.1717 17.9153 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 172.6256 ++ 348.461954 m 0.0001 77 | 3/8
6 h-m-p 0.0008 0.2902 14.8144 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 149.5463 ++ 347.057043 m 0.0001 108 | 4/8
8 h-m-p 0.0010 0.5246 11.5653 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 122.0839 +++ 344.530926 m 0.0002 140 | 5/8
10 h-m-p 0.0160 8.0000 7.9469 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 86.4728 ++ 343.737985 m 0.0001 173 | 6/8
12 h-m-p 0.3955 8.0000 0.0000 +++ 343.737985 m 8.0000 185 | 6/8
13 h-m-p 0.2795 8.0000 0.0000 +++ 343.737985 m 8.0000 199 | 6/8
14 h-m-p 0.0017 0.8727 0.3465 -----C 343.737985 0 0.0000 217 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 +++++ 343.737985 m 8.0000 233 | 6/8
16 h-m-p 0.0005 0.2062 1.4696 --------Y 343.737985 0 0.0000 254 | 6/8
17 h-m-p 0.0330 8.0000 0.0000 -C 343.737985 0 0.0021 266 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 -----------N 343.737985 0 0.0000 290
Out..
lnL = -343.737985
291 lfun, 291 eigenQcodon, 1746 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101334 0.035178 0.034198 0.070708 0.032067 0.072947 0.300925 0.882778 0.259533
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 14.847708
np = 9
lnL0 = -373.275624
Iterating by ming2
Initial: fx= 373.275624
x= 0.10133 0.03518 0.03420 0.07071 0.03207 0.07295 0.30093 0.88278 0.25953
1 h-m-p 0.0000 0.0004 204.1494 +++ 357.137923 m 0.0004 15 | 1/9
2 h-m-p 0.0000 0.0001 168.5530 ++ 356.217007 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0000 541.2947 ++ 355.893585 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 22108.3737 ++ 346.743151 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 281.4895 ++ 346.326087 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0004 520.4056 +++ 344.049613 m 0.0004 76 | 5/9
7 h-m-p 0.0031 0.0154 36.2744 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 87.4296 ++ 343.738011 m 0.0000 110 | 6/9
9 h-m-p 0.0675 8.0000 0.0000 ++++ 343.738011 m 8.0000 124 | 6/9
10 h-m-p 0.0160 8.0000 0.0169 +++++ 343.738010 m 8.0000 142 | 6/9
11 h-m-p 0.1001 0.5007 0.2707 -----------C 343.738010 0 0.0000 168 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 343.738010 m 8.0000 186 | 6/9
13 h-m-p 0.0008 0.3912 0.3698 --------C 343.738010 0 0.0000 209 | 6/9
14 h-m-p 0.0160 8.0000 0.0000 +++++ 343.738010 m 8.0000 227 | 6/9
15 h-m-p 0.0003 0.1610 1.8371 -------Y 343.738010 0 0.0000 249 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 N 343.738010 0 0.0080 261 | 6/9
17 h-m-p 0.0160 8.0000 0.0000 ---N 343.738010 0 0.0001 279
Out..
lnL = -343.738010
280 lfun, 840 eigenQcodon, 3360 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.062147 0.026310 0.051810 0.094200 0.046253 0.102756 0.274939 1.205403 0.499627 0.375560 1.457347
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.714146
np = 11
lnL0 = -375.865510
Iterating by ming2
Initial: fx= 375.865510
x= 0.06215 0.02631 0.05181 0.09420 0.04625 0.10276 0.27494 1.20540 0.49963 0.37556 1.45735
1 h-m-p 0.0000 0.0003 198.1985 +++ 363.007110 m 0.0003 17 | 1/11
2 h-m-p 0.0003 0.0016 81.7474 ++ 354.429018 m 0.0016 31 | 2/11
3 h-m-p 0.0000 0.0000 5607.3776 ++ 352.583430 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0001 687.4670 ++ 349.837442 m 0.0001 59 | 4/11
5 h-m-p 0.0000 0.0001 3203.3542 ++ 345.388887 m 0.0001 73 | 5/11
6 h-m-p 0.0291 6.6285 2.0887 --------------.. | 5/11
7 h-m-p 0.0000 0.0001 121.8204 ++ 344.460939 m 0.0001 113 | 6/11
8 h-m-p 0.0160 8.0000 1.1690 -------------.. | 6/11
9 h-m-p 0.0000 0.0001 86.6791 ++ 343.738002 m 0.0001 152 | 7/11
10 h-m-p 0.0943 8.0000 0.0000 ++++ 343.738002 m 8.0000 168 | 6/11
11 h-m-p 0.0192 8.0000 0.0021 ----C 343.738002 0 0.0000 190 | 6/11
12 h-m-p 0.0000 0.0000 0.2089 --.. | 6/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 343.738002 m 8.0000 231 | 6/11
14 h-m-p 0.0041 2.0260 0.6115 +++++ 343.737986 m 2.0260 253 | 7/11
15 h-m-p 1.6000 8.0000 0.1219 ++ 343.737984 m 8.0000 272 | 7/11
16 h-m-p 0.6519 8.0000 1.4955 +Y 343.737983 0 2.6074 291 | 7/11
17 h-m-p 1.6000 8.0000 0.3063 Y 343.737983 0 0.7326 305 | 7/11
18 h-m-p 1.6000 8.0000 0.0014 ++ 343.737983 m 8.0000 323 | 7/11
19 h-m-p 0.1801 8.0000 0.0642 +Y 343.737983 0 0.5846 342 | 7/11
20 h-m-p 1.6000 8.0000 0.0052 ++ 343.737983 m 8.0000 360 | 7/11
21 h-m-p 1.6000 8.0000 0.0067 ++ 343.737983 m 8.0000 378 | 7/11
22 h-m-p 0.1284 8.0000 0.4190 ++C 343.737983 0 2.0547 398 | 7/11
23 h-m-p 1.6000 8.0000 0.0337 ++ 343.737983 m 8.0000 416 | 7/11
24 h-m-p 0.0610 8.0000 4.4187 --------------.. | 7/11
25 h-m-p 0.0160 8.0000 0.0000 ----C 343.737983 0 0.0000 464
Out..
lnL = -343.737983
465 lfun, 1860 eigenQcodon, 8370 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -343.739436 S = -343.736461 -0.001136
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:03
did 20 / 45 patterns 0:03
did 30 / 45 patterns 0:03
did 40 / 45 patterns 0:03
did 45 / 45 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109591 0.031871 0.052551 0.082451 0.029578 0.055610 3.078427 0.621288 1.919963
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.601386
np = 9
lnL0 = -374.251573
Iterating by ming2
Initial: fx= 374.251573
x= 0.10959 0.03187 0.05255 0.08245 0.02958 0.05561 3.07843 0.62129 1.91996
1 h-m-p 0.0000 0.0004 200.6357 +++ 359.639338 m 0.0004 15 | 1/9
2 h-m-p 0.0092 0.1508 7.1308 -------------.. | 1/9
3 h-m-p 0.0000 0.0000 188.4758 ++ 358.673395 m 0.0000 50 | 2/9
4 h-m-p 0.0010 0.2837 4.7559 -----------.. | 2/9
5 h-m-p 0.0000 0.0002 168.4655 +++ 351.625511 m 0.0002 84 | 3/9
6 h-m-p 0.0098 0.4832 3.6508 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 148.0425 ++ 350.833880 m 0.0000 119 | 4/9
8 h-m-p 0.0023 1.1662 2.7292 ------------.. | 4/9
9 h-m-p 0.0000 0.0003 120.6037 +++ 346.157147 m 0.0003 154 | 5/9
10 h-m-p 0.0129 1.9565 2.0953 -------------.. | 5/9
11 h-m-p 0.0000 0.0003 86.2412 +++ 343.738003 m 0.0003 190 | 6/9
12 h-m-p 1.0195 8.0000 0.0000 ++ 343.738003 m 8.0000 202 | 6/9
13 h-m-p 0.0584 8.0000 0.0005 -----Y 343.738003 0 0.0000 222
Out..
lnL = -343.738003
223 lfun, 2453 eigenQcodon, 13380 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102683 0.063912 0.052731 0.105034 0.101438 0.014192 3.078445 0.900000 0.731106 1.957054 1.299977
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.308052
np = 11
lnL0 = -379.676831
Iterating by ming2
Initial: fx= 379.676831
x= 0.10268 0.06391 0.05273 0.10503 0.10144 0.01419 3.07845 0.90000 0.73111 1.95705 1.29998
1 h-m-p 0.0000 0.0002 189.3132 +++ 373.139027 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0012 135.6147 ++ 357.474996 m 0.0012 31 | 2/11
3 h-m-p 0.0000 0.0000 1828.2893 ++ 353.744361 m 0.0000 45 | 3/11
4 h-m-p 0.0020 0.0571 20.5061 +++ 344.492193 m 0.0571 60 | 4/11
5 h-m-p 0.0000 0.0000 21911.3727 ++ 344.113270 m 0.0000 74 | 5/11
6 h-m-p 0.0004 0.0018 41.8035 ----------.. | 5/11
7 h-m-p 0.0000 0.0001 86.2120 ++ 343.737980 m 0.0001 110 | 6/11
8 h-m-p 0.0160 8.0000 0.0000 +++++ 343.737980 m 8.0000 127 | 6/11
9 h-m-p 0.0268 8.0000 0.0013 +++++ 343.737980 m 8.0000 149 | 6/11
10 h-m-p 0.0205 0.5581 0.4960 +++ 343.737979 m 0.5581 169 | 7/11
11 h-m-p 0.0139 0.0696 5.7809 +
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+ 343.737978 m 0.0696 188
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232949e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
12 h-m-p -0.0000 -0.0000 0.9327
h-m-p: -1.02530181e-17 -5.12650907e-17 9.32675788e-01 343.737978
..
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14504) = 1.232862e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14480) = 1.233038e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
13 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
Y 343.737978 0 0.0378 217
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14504) = 1.232862e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14480) = 1.233038e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
14 h-m-p 0.0160 8.0000 0.0009
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+ 343.737978 m 8.0000 238
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14504) = 1.232862e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14480) = 1.233038e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 1.5703
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+ 343.737972 m 8.0000 259
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232949e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
16 h-m-p 1.6000 8.0000 0.5369
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+ 343.737972 m 8.0000 273
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14504) = 1.232862e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14480) = 1.233038e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
17 h-m-p 1.6000 8.0000 1.9986
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
+ 343.737972 m 8.0000 291
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232949e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
18 h-m-p 1.0717 5.3587 6.3940
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
N 343.737972 0 0.0000 317
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232949e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
19 h-m-p 0.0713 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
C 343.737972 0 0.0000 343
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14504) = 1.232862e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14480) = 1.233038e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
| 7/11
20 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
Y 343.737972 0 0.0040 361
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
Out..
lnL = -343.737972
362 lfun, 4344 eigenQcodon, 23892 P(t)
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -343.736119 S = -343.735934 -0.000081
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:13
did 20 / 45 patterns 0:14
did 30 / 45 patterns 0:14
did 40 / 45 patterns 0:14
did 45 / 45 patterns 0:14
QuantileBeta(0.15, 0.00500, 2.14492) = 1.232950e-160 2000 rounds
Time used: 0:14
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87
NC_011896_1_WP_010907503_1_69_MLBR_RS00345 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
NC_002677_1_NP_301178_1_50_ML0070 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
**************************************************
NC_011896_1_WP_010907503_1_69_MLBR_RS00345 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
NC_002677_1_NP_301178_1_50_ML0070 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365 LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
*************************************
>NC_011896_1_WP_010907503_1_69_MLBR_RS00345 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG >NC_002677_1_NP_301178_1_50_ML0070 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG >NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG >NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG >NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG >NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365 ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC CCCACAGGGAG
>NC_011896_1_WP_010907503_1_69_MLBR_RS00345 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE >NC_002677_1_NP_301178_1_50_ML0070 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE >NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE >NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE >NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE >NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365 MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
#NEXUS
[ID: 0172622997]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907503_1_69_MLBR_RS00345
NC_002677_1_NP_301178_1_50_ML0070
NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050
NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235
NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355
NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907503_1_69_MLBR_RS00345,
2 NC_002677_1_NP_301178_1_50_ML0070,
3 NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050,
4 NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235,
5 NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355,
6 NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0706047,2:0.06800523,3:0.0690006,4:0.07002586,5:0.06931144,6:0.0664787);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0706047,2:0.06800523,3:0.0690006,4:0.07002586,5:0.06931144,6:0.0664787);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -355.71 -359.01
2 -355.70 -358.80
--------------------------------------
TOTAL -355.71 -358.91
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890212 0.089446 0.345066 1.460665 0.863421 1228.97 1364.98 1.000
r(A<->C){all} 0.168078 0.018478 0.000106 0.436838 0.135642 153.01 310.56 1.002
r(A<->G){all} 0.164927 0.018634 0.000115 0.434387 0.129447 214.40 355.97 1.000
r(A<->T){all} 0.159762 0.018094 0.000057 0.429445 0.123165 167.55 336.84 1.003
r(C<->G){all} 0.164053 0.017280 0.000009 0.420027 0.133845 81.32 194.81 1.000
r(C<->T){all} 0.168728 0.019384 0.000009 0.444398 0.134371 159.53 224.15 1.001
r(G<->T){all} 0.174452 0.020392 0.000162 0.467088 0.139204 198.25 208.57 1.003
pi(A){all} 0.207108 0.000603 0.162462 0.256980 0.206667 1390.16 1445.58 1.001
pi(C){all} 0.287183 0.000784 0.234554 0.344478 0.286797 1254.92 1287.24 1.000
pi(G){all} 0.328208 0.000804 0.274782 0.385195 0.327692 1090.62 1121.08 1.000
pi(T){all} 0.177500 0.000560 0.132879 0.224912 0.176445 1114.20 1150.05 1.000
alpha{1,2} 0.419531 0.236215 0.000128 1.418861 0.242153 1206.43 1279.04 1.000
alpha{3} 0.480050 0.259433 0.000148 1.509187 0.311323 1246.58 1373.79 1.000
pinvar{all} 0.993780 0.000055 0.980224 0.999999 0.996111 1368.90 1434.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0070/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 87
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 1 1 1 1 1 1 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 2 2 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 5 5 5 5 5 5 | Asp GAT 2 2 2 2 2 2 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 1 1 1 1 1 1 | GAC 0 0 0 0 0 0 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 4 4 4 4 4 4 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907503_1_69_MLBR_RS00345
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
#2: NC_002677_1_NP_301178_1_50_ML0070
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
#3: NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
#4: NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
#5: NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
#6: NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 0 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 0 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 24 | CGC 12
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 6
CTG 30 | CCG 12 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 6 | ACC 18 | AAC 30 | AGC 18
ATA 6 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 12 | AAG 6 | AGG 12
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 30 | Asp D GAT 12 | Gly G GGT 6
GTC 6 | GCC 6 | GAC 0 | GGC 24
GTA 6 | GCA 12 | Glu E GAA 0 | GGA 6
GTG 36 | GCG 24 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06897 C:0.26437 A:0.27586 G:0.39080
position 2: T:0.24138 C:0.29885 A:0.21839 G:0.24138
position 3: T:0.21839 C:0.29885 A:0.12644 G:0.35632
Average T:0.17625 C:0.28736 A:0.20690 G:0.32950
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -343.737985 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300925 1.299977
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907503_1_69_MLBR_RS00345: 0.000004, NC_002677_1_NP_301178_1_50_ML0070: 0.000004, NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050: 0.000004, NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235: 0.000004, NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355: 0.000004, NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30093
omega (dN/dS) = 1.29998
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 192.9 68.1 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -343.738010 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.274939 0.720975 0.119262
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907503_1_69_MLBR_RS00345: 0.000004, NC_002677_1_NP_301178_1_50_ML0070: 0.000004, NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050: 0.000004, NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235: 0.000004, NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355: 0.000004, NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27494
MLEs of dN/dS (w) for site classes (K=2)
p: 0.72098 0.27902
w: 0.11926 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
7..2 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
7..3 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
7..4 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
7..5 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
7..6 0.000 193.1 67.9 0.3650 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -343.737983 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.078427 0.004161 0.897122 1.000000 4.061298
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907503_1_69_MLBR_RS00345: 0.000004, NC_002677_1_NP_301178_1_50_ML0070: 0.000004, NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050: 0.000004, NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235: 0.000004, NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355: 0.000004, NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.07843
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00416 0.89712 0.09872
w: 1.00000 1.00000 4.06130
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
7..2 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
7..3 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
7..4 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
7..5 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
7..6 0.000 187.0 74.0 1.3022 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907503_1_69_MLBR_RS00345)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907503_1_69_MLBR_RS00345)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -343.738003 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 3.078445 0.621259 1.919865
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907503_1_69_MLBR_RS00345: 0.000004, NC_002677_1_NP_301178_1_50_ML0070: 0.000004, NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050: 0.000004, NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235: 0.000004, NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355: 0.000004, NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 3.07845
Parameters in M7 (beta):
p = 0.62126 q = 1.91986
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00388 0.02297 0.05318 0.09358 0.14457 0.20752 0.28516 0.38278 0.51223 0.71407
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
7..2 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
7..3 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
7..4 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
7..5 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
7..6 0.000 187.0 74.0 0.2420 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -343.737972 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 4.509819 0.000010 0.005000 2.144923 35.234447
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907503_1_69_MLBR_RS00345: 0.000004, NC_002677_1_NP_301178_1_50_ML0070: 0.000004, NZ_LVXE01000014_1_WP_010907503_1_509_A3216_RS06050: 0.000004, NZ_LYPH01000018_1_WP_010907503_1_686_A8144_RS03235: 0.000004, NZ_CP029543_1_WP_010907503_1_68_DIJ64_RS00355: 0.000004, NZ_AP014567_1_WP_010907503_1_70_JK2ML_RS00365: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 4.50982
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.14492
(p1 = 0.99999) w = 35.23445
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 35.23445
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
7..2 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
7..3 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
7..4 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
7..5 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
7..6 0.000 185.9 75.1 35.2341 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907503_1_69_MLBR_RS00345)
Pr(w>1) post mean +- SE for w
1 M 1.000** 35.234
2 L 1.000** 35.234
3 T 1.000** 35.234
4 G 1.000** 35.234
5 V 1.000** 35.234
6 T 1.000** 35.234
7 N 1.000** 35.234
8 L 1.000** 35.234
9 L 1.000** 35.234
10 V 1.000** 35.234
11 P 1.000** 35.234
12 S 1.000** 35.234
13 V 1.000** 35.234
14 R 1.000** 35.234
15 L 1.000** 35.234
16 V 1.000** 35.234
17 A 1.000** 35.234
18 A 1.000** 35.234
19 G 1.000** 35.234
20 Q 1.000** 35.234
21 H 1.000** 35.234
22 A 1.000** 35.234
23 V 1.000** 35.234
24 G 1.000** 35.234
25 G 1.000** 35.234
26 G 1.000** 35.234
27 P 1.000** 35.234
28 V 1.000** 35.234
29 V 1.000** 35.234
30 I 1.000** 35.234
31 G 1.000** 35.234
32 V 1.000** 35.234
33 N 1.000** 35.234
34 A 1.000** 35.234
35 A 1.000** 35.234
36 L 1.000** 35.234
37 A 1.000** 35.234
38 L 1.000** 35.234
39 A 1.000** 35.234
40 T 1.000** 35.234
41 G 1.000** 35.234
42 K 1.000** 35.234
43 C 1.000** 35.234
44 R 1.000** 35.234
45 Y 1.000** 35.234
46 V 1.000** 35.234
47 A 1.000** 35.234
48 H 1.000** 35.234
49 S 1.000** 35.234
50 A 1.000** 35.234
51 L 1.000** 35.234
52 A 1.000** 35.234
53 T 1.000** 35.234
54 N 1.000** 35.234
55 K 1.000** 35.234
56 S 1.000** 35.234
57 N 1.000** 35.234
58 N 1.000** 35.234
59 R 1.000** 35.234
60 W 1.000** 35.234
61 E 1.000** 35.234
62 T 1.000** 35.234
63 T 1.000** 35.234
64 G 1.000** 35.234
65 R 1.000** 35.234
66 R 1.000** 35.234
67 L 1.000** 35.234
68 D 1.000** 35.234
69 I 1.000** 35.234
70 P 1.000** 35.234
71 S 1.000** 35.234
72 S 1.000** 35.234
73 T 1.000** 35.234
74 R 1.000** 35.234
75 A 1.000** 35.234
76 D 1.000** 35.234
77 H 1.000** 35.234
78 Q 1.000** 35.234
79 A 1.000** 35.234
80 V 1.000** 35.234
81 P 1.000** 35.234
82 N 1.000** 35.234
83 S 1.000** 35.234
84 P 1.000** 35.234
85 H 1.000** 35.234
86 R 1.000** 35.234
87 E 1.000** 35.234
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907503_1_69_MLBR_RS00345)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:14
Model 1: NearlyNeutral -343.73801 Model 2: PositiveSelection -343.737983 Model 0: one-ratio -343.737985 Model 7: beta -343.738003 Model 8: beta&w>1 -343.737972 Model 0 vs 1 4.999999998744897E-5 Model 2 vs 1 5.3999999977349944E-5 Model 8 vs 7 6.199999995715189E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
