--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:38:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0070/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -355.71          -359.01
2       -355.70          -358.80
--------------------------------------
TOTAL     -355.71          -358.91
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890212    0.089446    0.345066    1.460665    0.863421   1228.97   1364.98    1.000
r(A<->C){all}   0.168078    0.018478    0.000106    0.436838    0.135642    153.01    310.56    1.002
r(A<->G){all}   0.164927    0.018634    0.000115    0.434387    0.129447    214.40    355.97    1.000
r(A<->T){all}   0.159762    0.018094    0.000057    0.429445    0.123165    167.55    336.84    1.003
r(C<->G){all}   0.164053    0.017280    0.000009    0.420027    0.133845     81.32    194.81    1.000
r(C<->T){all}   0.168728    0.019384    0.000009    0.444398    0.134371    159.53    224.15    1.001
r(G<->T){all}   0.174452    0.020392    0.000162    0.467088    0.139204    198.25    208.57    1.003
pi(A){all}      0.207108    0.000603    0.162462    0.256980    0.206667   1390.16   1445.58    1.001
pi(C){all}      0.287183    0.000784    0.234554    0.344478    0.286797   1254.92   1287.24    1.000
pi(G){all}      0.328208    0.000804    0.274782    0.385195    0.327692   1090.62   1121.08    1.000
pi(T){all}      0.177500    0.000560    0.132879    0.224912    0.176445   1114.20   1150.05    1.000
alpha{1,2}      0.419531    0.236215    0.000128    1.418861    0.242153   1206.43   1279.04    1.000
alpha{3}        0.480050    0.259433    0.000148    1.509187    0.311323   1246.58   1373.79    1.000
pinvar{all}     0.993780    0.000055    0.980224    0.999999    0.996111   1368.90   1434.95    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-343.73801
Model 2: PositiveSelection	-343.737983
Model 0: one-ratio	-343.737985
Model 7: beta	-343.738003
Model 8: beta&w>1	-343.737972


Model 0 vs 1	4.999999998744897E-5

Model 2 vs 1	5.3999999977349944E-5

Model 8 vs 7	6.199999995715189E-5
>C1
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C2
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C3
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C4
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C5
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C6
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=87 

C1              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C2              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C3              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C4              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C5              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C6              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
                **************************************************

C1              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C2              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C3              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C4              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C5              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C6              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
                *************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   87 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   87 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2610]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2610]--->[2610]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.440 Mb, Max= 30.599 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C2              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C3              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C4              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C5              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
C6              MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
                **************************************************

C1              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C2              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C3              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C4              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C5              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
C6              LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
                *************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C2              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C3              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C4              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C5              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
C6              ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
                **************************************************

C1              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C2              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C3              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C4              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C5              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
C6              TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
                **************************************************

C1              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C2              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C3              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C4              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C5              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
C6              CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
                **************************************************

C1              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C2              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C3              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C4              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C5              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
C6              CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
                **************************************************

C1              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C2              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C3              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C4              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C5              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
C6              GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
                **************************************************

C1              CCCACAGGGAG
C2              CCCACAGGGAG
C3              CCCACAGGGAG
C4              CCCACAGGGAG
C5              CCCACAGGGAG
C6              CCCACAGGGAG
                ***********



>C1
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C2
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C3
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C4
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C5
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C6
ATGCTGACCGGGGTGACGAACCTGCTAGTTCCTAGCGTACGGCTTGTGGC
TGCTGGACAGCACGCTGTGGGTGGCGGCCCGGTGGTGATCGGCGTTAACG
CGGCTTTAGCGCTGGCAACAGGCAAATGTAGGTATGTCGCACACTCTGCG
CTGGCGACAAACAAGAGCAACAATCGCTGGGAGACCACCGGGCGCCGTCT
GGATATACCGTCCAGCACGCGAGCCGATCACCAGGCTGTGCCTAACAGTC
CCCACAGGGAG
>C1
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C2
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C3
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C4
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C5
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE
>C6
MLTGVTNLLVPSVRLVAAGQHAVGGGPVVIGVNAALALATGKCRYVAHSA
LATNKSNNRWETTGRRLDIPSSTRADHQAVPNSPHRE


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 261 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790234
      Setting output file names to "/data/3res/ML0070/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1563810649
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0172622997
      Seed = 1730934762
      Swapseed = 1579790234
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -584.130424 -- -24.965149
         Chain 2 -- -584.130513 -- -24.965149
         Chain 3 -- -584.130479 -- -24.965149
         Chain 4 -- -584.130513 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -584.130513 -- -24.965149
         Chain 2 -- -584.130479 -- -24.965149
         Chain 3 -- -584.130513 -- -24.965149
         Chain 4 -- -584.130513 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-584.130] (-584.131) (-584.130) (-584.131) * [-584.131] (-584.130) (-584.131) (-584.131) 
        500 -- (-370.700) (-362.204) [-369.786] (-372.531) * (-363.486) [-367.491] (-372.134) (-368.438) -- 0:00:00
       1000 -- [-368.764] (-363.964) (-363.247) (-374.419) * (-361.278) [-362.716] (-371.194) (-361.540) -- 0:00:00
       1500 -- (-361.526) (-361.243) (-361.520) [-376.189] * (-364.312) [-367.332] (-374.770) (-363.319) -- 0:00:00
       2000 -- (-364.783) [-364.477] (-368.822) (-365.671) * (-364.567) (-368.058) (-367.103) [-363.166] -- 0:00:00
       2500 -- [-361.364] (-363.519) (-362.282) (-362.718) * (-360.173) [-365.707] (-361.415) (-361.218) -- 0:00:00
       3000 -- [-368.067] (-380.257) (-366.197) (-371.340) * [-358.340] (-364.721) (-363.117) (-368.101) -- 0:00:00
       3500 -- (-362.187) [-362.623] (-370.163) (-368.593) * (-362.360) (-368.455) [-359.370] (-374.298) -- 0:00:00
       4000 -- (-362.509) (-363.209) [-365.588] (-369.082) * (-369.102) (-361.538) (-362.465) [-368.596] -- 0:00:00
       4500 -- (-363.617) (-368.999) (-373.753) [-364.622] * (-367.244) (-362.462) [-368.977] (-367.417) -- 0:00:00
       5000 -- [-370.052] (-367.768) (-379.436) (-368.735) * (-372.033) (-376.191) (-369.259) [-361.012] -- 0:00:00

      Average standard deviation of split frequencies: 0.071425

       5500 -- [-366.079] (-364.429) (-368.251) (-372.080) * (-370.466) [-365.122] (-364.878) (-365.502) -- 0:00:00
       6000 -- (-367.779) (-367.117) (-361.606) [-363.701] * (-371.496) [-360.366] (-360.446) (-377.985) -- 0:00:00
       6500 -- [-356.056] (-361.394) (-373.526) (-363.488) * (-366.243) (-367.275) [-363.836] (-364.734) -- 0:00:00
       7000 -- (-357.736) (-364.288) (-364.914) [-364.359] * (-377.011) (-368.609) [-365.614] (-364.997) -- 0:00:00
       7500 -- (-355.742) (-370.469) (-362.212) [-363.967] * (-362.123) [-366.682] (-371.315) (-370.297) -- 0:00:00
       8000 -- (-355.541) (-363.891) (-365.837) [-362.936] * (-363.404) (-381.700) [-366.226] (-361.149) -- 0:00:00
       8500 -- (-356.096) (-374.122) (-365.253) [-365.128] * [-360.918] (-362.952) (-370.898) (-366.747) -- 0:00:00
       9000 -- (-357.215) (-381.875) (-363.783) [-373.983] * (-365.554) (-364.989) [-360.674] (-366.894) -- 0:01:50
       9500 -- (-355.603) (-370.440) (-369.231) [-361.353] * (-362.825) (-359.096) (-368.463) [-367.283] -- 0:01:44
      10000 -- (-356.629) (-365.174) (-363.774) [-366.638] * (-362.291) [-355.660] (-364.748) (-369.738) -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- (-355.004) (-375.611) (-364.491) [-373.296] * (-370.779) (-357.194) [-364.444] (-368.304) -- 0:01:34
      11000 -- (-355.851) [-364.514] (-364.842) (-373.123) * (-371.217) (-359.664) (-365.194) [-368.894] -- 0:01:29
      11500 -- [-355.865] (-364.534) (-364.250) (-364.245) * (-372.578) [-354.688] (-366.093) (-370.148) -- 0:01:25
      12000 -- [-356.996] (-366.026) (-364.701) (-369.434) * (-367.556) (-357.851) (-364.682) [-366.314] -- 0:01:22
      12500 -- (-354.850) [-366.613] (-362.753) (-371.442) * [-364.006] (-356.564) (-370.589) (-367.671) -- 0:01:19
      13000 -- (-355.200) (-363.657) [-367.329] (-362.039) * (-367.226) (-355.045) [-364.630] (-366.059) -- 0:01:15
      13500 -- (-357.249) (-365.144) [-367.171] (-361.617) * (-369.599) (-355.808) [-365.438] (-363.302) -- 0:01:13
      14000 -- (-358.742) (-364.534) [-362.393] (-366.033) * (-365.970) (-356.029) (-365.590) [-364.976] -- 0:01:10
      14500 -- [-354.769] (-365.926) (-369.011) (-367.825) * (-362.523) [-354.709] (-369.280) (-365.610) -- 0:01:07
      15000 -- (-355.458) (-363.493) [-361.795] (-365.578) * (-361.289) (-356.972) [-362.776] (-371.288) -- 0:01:05

      Average standard deviation of split frequencies: 0.049622

      15500 -- (-357.414) [-367.841] (-373.366) (-371.929) * (-364.122) (-355.130) [-363.771] (-359.928) -- 0:01:03
      16000 -- (-363.407) (-368.505) [-366.204] (-360.714) * [-360.610] (-358.871) (-363.241) (-369.277) -- 0:01:01
      16500 -- (-358.648) (-368.204) (-366.960) [-362.251] * [-358.807] (-359.645) (-377.381) (-371.567) -- 0:00:59
      17000 -- [-356.562] (-363.664) (-367.567) (-364.668) * (-355.710) [-358.009] (-360.034) (-364.994) -- 0:00:57
      17500 -- [-358.287] (-365.117) (-370.517) (-363.843) * (-360.123) (-355.391) (-368.683) [-357.666] -- 0:00:56
      18000 -- (-356.725) (-370.673) [-363.082] (-370.952) * (-362.396) (-356.640) [-368.394] (-355.816) -- 0:00:54
      18500 -- (-362.294) (-368.868) [-368.238] (-364.683) * (-360.997) [-355.628] (-364.405) (-357.623) -- 0:00:53
      19000 -- (-358.571) (-376.659) [-372.851] (-363.130) * (-358.095) (-356.924) [-364.024] (-356.876) -- 0:00:51
      19500 -- [-355.248] (-365.872) (-371.466) (-361.469) * (-354.750) (-354.459) (-369.397) [-358.277] -- 0:00:50
      20000 -- (-357.301) (-365.795) [-365.187] (-365.253) * (-363.914) (-357.890) [-362.171] (-356.977) -- 0:00:49

      Average standard deviation of split frequencies: 0.053223

      20500 -- [-356.249] (-364.077) (-365.777) (-359.941) * (-358.796) (-359.429) (-371.127) [-355.003] -- 0:00:47
      21000 -- (-356.331) (-373.527) [-363.869] (-362.842) * [-359.459] (-359.318) (-365.544) (-355.089) -- 0:00:46
      21500 -- (-355.420) [-359.242] (-375.221) (-365.172) * [-356.090] (-357.264) (-369.290) (-356.299) -- 0:00:45
      22000 -- (-356.771) [-362.786] (-365.585) (-373.634) * [-355.299] (-356.727) (-372.435) (-355.473) -- 0:01:28
      22500 -- [-354.126] (-360.689) (-366.908) (-370.557) * (-357.911) [-358.822] (-363.785) (-354.642) -- 0:01:26
      23000 -- (-354.377) (-372.080) [-373.101] (-370.468) * [-355.569] (-354.882) (-367.208) (-357.303) -- 0:01:24
      23500 -- (-355.378) [-366.376] (-366.178) (-372.554) * (-356.684) [-357.442] (-365.256) (-355.593) -- 0:01:23
      24000 -- [-355.520] (-363.306) (-374.232) (-362.407) * [-355.854] (-357.986) (-371.017) (-354.507) -- 0:01:21
      24500 -- [-354.914] (-366.427) (-371.342) (-368.692) * (-354.990) (-357.009) (-366.590) [-355.957] -- 0:01:19
      25000 -- [-356.723] (-366.630) (-364.549) (-366.168) * (-355.274) (-354.731) [-367.340] (-358.442) -- 0:01:18

      Average standard deviation of split frequencies: 0.029669

      25500 -- [-355.819] (-364.702) (-373.457) (-371.951) * (-355.613) [-357.217] (-369.977) (-359.213) -- 0:01:16
      26000 -- (-356.869) (-371.538) [-364.887] (-365.819) * (-355.517) (-356.174) (-364.815) [-356.702] -- 0:01:14
      26500 -- (-355.806) [-363.824] (-361.682) (-370.836) * (-357.228) (-359.387) [-368.946] (-355.280) -- 0:01:13
      27000 -- (-355.662) [-366.045] (-366.255) (-365.674) * (-355.863) [-357.491] (-373.447) (-355.720) -- 0:01:12
      27500 -- (-356.937) (-361.986) [-366.873] (-366.846) * (-358.845) [-356.631] (-367.177) (-356.109) -- 0:01:10
      28000 -- [-357.775] (-372.404) (-365.386) (-360.102) * [-356.020] (-356.941) (-365.768) (-360.673) -- 0:01:09
      28500 -- (-356.869) [-364.511] (-367.569) (-368.073) * [-355.777] (-355.588) (-370.706) (-365.626) -- 0:01:08
      29000 -- (-354.386) (-385.528) [-363.488] (-367.477) * (-357.044) [-356.248] (-362.738) (-362.836) -- 0:01:06
      29500 -- [-356.340] (-355.239) (-365.793) (-366.665) * [-356.998] (-354.672) (-358.721) (-357.012) -- 0:01:05
      30000 -- [-357.311] (-355.855) (-379.270) (-366.793) * [-355.038] (-355.175) (-362.358) (-355.184) -- 0:01:04

      Average standard deviation of split frequencies: 0.027949

      30500 -- (-359.819) [-355.184] (-374.281) (-362.458) * (-354.501) (-355.228) (-357.335) [-355.525] -- 0:01:03
      31000 -- (-358.573) [-356.961] (-358.818) (-363.488) * (-358.572) (-354.733) (-356.950) [-354.962] -- 0:01:02
      31500 -- (-354.195) (-356.825) (-357.220) [-359.607] * (-357.148) [-356.184] (-361.737) (-355.177) -- 0:01:01
      32000 -- (-354.037) (-357.199) [-356.580] (-363.040) * [-357.858] (-355.936) (-357.466) (-354.808) -- 0:01:00
      32500 -- (-354.922) [-357.948] (-357.151) (-373.089) * (-357.317) (-359.245) [-355.604] (-359.233) -- 0:00:59
      33000 -- (-357.126) [-354.801] (-359.216) (-367.325) * (-357.995) (-359.910) (-356.797) [-356.635] -- 0:00:58
      33500 -- (-357.323) [-356.930] (-357.816) (-363.353) * [-355.880] (-361.245) (-355.292) (-357.713) -- 0:00:57
      34000 -- (-355.825) (-357.680) [-355.514] (-370.250) * [-356.661] (-356.555) (-356.350) (-356.195) -- 0:00:56
      34500 -- (-358.359) [-358.475] (-355.933) (-367.827) * (-360.301) [-354.728] (-359.635) (-354.694) -- 0:00:55
      35000 -- (-355.088) [-354.930] (-355.544) (-370.817) * (-355.476) (-356.820) [-356.543] (-356.665) -- 0:00:55

      Average standard deviation of split frequencies: 0.029635

      35500 -- (-360.942) [-359.569] (-356.320) (-371.592) * (-356.441) (-357.733) (-357.520) [-355.944] -- 0:00:54
      36000 -- (-359.756) [-356.409] (-355.938) (-364.015) * (-356.509) (-356.976) (-355.010) [-354.854] -- 0:00:53
      36500 -- (-356.123) (-355.726) [-356.540] (-375.019) * [-356.462] (-355.966) (-355.545) (-355.573) -- 0:00:52
      37000 -- [-355.833] (-357.924) (-357.997) (-371.630) * [-355.413] (-356.688) (-359.768) (-354.823) -- 0:00:52
      37500 -- (-355.799) [-356.327] (-355.198) (-355.987) * (-357.019) (-358.878) (-358.953) [-356.369] -- 0:00:51
      38000 -- (-357.885) [-355.842] (-355.684) (-356.219) * (-355.349) (-354.832) [-355.274] (-358.908) -- 0:01:15
      38500 -- [-358.752] (-355.081) (-355.132) (-357.925) * (-355.575) (-354.293) [-359.224] (-357.480) -- 0:01:14
      39000 -- (-355.902) (-365.125) [-355.906] (-354.813) * (-354.859) (-357.711) (-356.783) [-355.800] -- 0:01:13
      39500 -- (-356.668) (-358.444) (-356.652) [-355.971] * [-356.055] (-358.119) (-359.282) (-357.869) -- 0:01:12
      40000 -- [-354.497] (-358.808) (-357.072) (-357.750) * (-356.447) (-355.840) [-356.880] (-358.094) -- 0:01:12

      Average standard deviation of split frequencies: 0.032844

      40500 -- [-358.637] (-358.243) (-358.526) (-356.370) * (-356.456) (-356.831) [-359.159] (-356.061) -- 0:01:11
      41000 -- (-356.002) (-356.796) [-354.554] (-358.056) * (-356.829) [-354.332] (-359.144) (-355.564) -- 0:01:10
      41500 -- (-354.674) (-355.641) (-357.195) [-356.295] * (-354.615) [-355.164] (-360.354) (-356.384) -- 0:01:09
      42000 -- [-357.228] (-358.399) (-357.101) (-358.776) * (-358.399) (-357.800) [-355.480] (-357.897) -- 0:01:08
      42500 -- (-359.014) [-355.265] (-360.931) (-358.781) * (-356.381) (-354.329) (-363.147) [-355.584] -- 0:01:07
      43000 -- (-359.183) (-355.317) (-359.920) [-357.377] * (-355.683) (-354.108) (-358.111) [-356.801] -- 0:01:06
      43500 -- [-355.024] (-355.499) (-358.226) (-358.718) * (-355.836) (-356.919) [-356.688] (-354.188) -- 0:01:05
      44000 -- (-356.239) (-356.858) (-355.543) [-355.600] * (-356.373) [-358.401] (-359.939) (-354.874) -- 0:01:05
      44500 -- (-359.473) (-355.761) [-355.218] (-357.949) * (-355.805) (-360.333) [-360.283] (-356.181) -- 0:01:04
      45000 -- [-357.227] (-354.688) (-355.977) (-359.100) * [-354.634] (-357.019) (-360.760) (-356.045) -- 0:01:03

      Average standard deviation of split frequencies: 0.030231

      45500 -- [-355.887] (-358.681) (-355.405) (-355.103) * (-355.544) (-357.607) [-354.632] (-356.293) -- 0:01:02
      46000 -- (-355.235) (-358.320) (-355.126) [-355.235] * [-357.822] (-354.128) (-355.697) (-358.719) -- 0:01:02
      46500 -- (-354.304) (-355.305) [-354.599] (-354.976) * (-364.238) (-357.918) (-358.428) [-355.096] -- 0:01:01
      47000 -- (-357.174) [-356.738] (-354.873) (-356.405) * (-356.238) (-359.896) (-356.190) [-356.244] -- 0:01:00
      47500 -- (-356.295) [-355.687] (-355.345) (-357.861) * (-360.169) [-357.604] (-355.343) (-358.052) -- 0:01:00
      48000 -- (-355.840) [-355.976] (-356.309) (-356.812) * (-355.451) (-356.566) (-359.433) [-356.072] -- 0:00:59
      48500 -- [-354.892] (-358.706) (-358.725) (-354.795) * [-354.984] (-355.279) (-357.840) (-357.175) -- 0:00:58
      49000 -- (-357.350) (-358.723) [-354.768] (-355.892) * (-358.041) (-360.653) (-358.106) [-355.929] -- 0:00:58
      49500 -- (-355.625) [-356.483] (-355.183) (-356.956) * (-359.083) (-357.524) [-354.998] (-354.732) -- 0:00:57
      50000 -- (-356.720) (-359.889) [-357.578] (-357.659) * (-356.464) (-357.201) [-357.289] (-359.613) -- 0:00:57

      Average standard deviation of split frequencies: 0.030850

      50500 -- [-356.023] (-360.642) (-356.491) (-355.052) * (-355.934) (-357.673) [-354.962] (-355.121) -- 0:00:56
      51000 -- (-356.935) (-362.346) [-354.650] (-356.745) * (-355.387) [-355.554] (-356.773) (-356.009) -- 0:00:55
      51500 -- [-357.272] (-357.391) (-355.948) (-356.634) * (-357.823) (-355.938) [-356.687] (-355.650) -- 0:00:55
      52000 -- (-355.561) (-356.433) (-358.360) [-354.883] * [-357.586] (-355.247) (-357.837) (-356.880) -- 0:00:54
      52500 -- (-361.968) (-359.806) [-357.315] (-355.291) * (-357.059) (-356.985) [-356.544] (-356.580) -- 0:00:54
      53000 -- (-354.795) (-355.768) (-357.660) [-355.980] * (-357.852) (-357.655) [-356.456] (-355.516) -- 0:00:53
      53500 -- (-355.090) [-356.922] (-360.651) (-358.790) * (-356.260) (-356.401) (-361.780) [-356.425] -- 0:00:53
      54000 -- (-355.697) [-356.711] (-357.850) (-359.491) * [-356.727] (-356.069) (-358.564) (-357.241) -- 0:00:52
      54500 -- [-355.002] (-355.442) (-356.131) (-361.803) * (-359.914) (-356.176) [-355.969] (-357.412) -- 0:00:52
      55000 -- (-357.631) (-355.178) (-356.277) [-355.006] * [-357.134] (-358.700) (-355.046) (-354.991) -- 0:00:51

      Average standard deviation of split frequencies: 0.025721

      55500 -- (-357.866) (-355.572) [-357.320] (-357.614) * [-355.375] (-357.908) (-356.126) (-358.558) -- 0:01:08
      56000 -- (-354.812) (-356.287) [-354.293] (-355.646) * [-355.458] (-355.712) (-357.008) (-359.676) -- 0:01:07
      56500 -- (-356.247) [-354.930] (-356.991) (-355.993) * [-357.647] (-355.445) (-358.443) (-354.244) -- 0:01:06
      57000 -- (-355.471) (-355.891) [-355.832] (-355.746) * [-357.830] (-355.193) (-357.992) (-356.739) -- 0:01:06
      57500 -- (-355.929) (-358.176) (-358.271) [-355.061] * (-354.737) (-355.282) [-359.319] (-356.194) -- 0:01:05
      58000 -- (-356.127) (-359.791) (-359.807) [-354.614] * (-359.277) (-355.878) (-357.207) [-357.535] -- 0:01:04
      58500 -- (-355.033) (-360.022) [-357.357] (-355.627) * [-355.815] (-354.491) (-356.356) (-355.485) -- 0:01:04
      59000 -- (-359.433) [-355.669] (-355.562) (-356.845) * (-358.778) [-355.525] (-355.423) (-355.589) -- 0:01:03
      59500 -- (-357.844) (-355.808) [-355.930] (-355.335) * (-355.519) [-356.236] (-356.272) (-356.316) -- 0:01:03
      60000 -- (-355.380) (-358.311) [-357.754] (-355.649) * (-355.052) (-354.615) [-356.684] (-356.511) -- 0:01:02

      Average standard deviation of split frequencies: 0.028491

      60500 -- (-356.420) (-356.788) (-354.729) [-357.923] * (-354.107) [-356.531] (-356.074) (-358.653) -- 0:01:02
      61000 -- [-356.666] (-360.273) (-361.673) (-356.267) * (-358.615) (-355.497) [-356.092] (-358.742) -- 0:01:01
      61500 -- [-357.885] (-355.952) (-356.799) (-355.137) * (-358.179) (-361.316) [-356.932] (-354.728) -- 0:01:01
      62000 -- [-354.768] (-355.656) (-356.601) (-359.367) * (-359.723) (-359.872) [-355.261] (-356.086) -- 0:01:00
      62500 -- (-356.877) [-360.654] (-357.600) (-359.515) * (-355.658) (-360.536) [-354.973] (-354.959) -- 0:01:00
      63000 -- [-358.408] (-355.680) (-358.805) (-359.757) * [-355.494] (-357.868) (-359.244) (-354.161) -- 0:00:59
      63500 -- [-354.789] (-356.349) (-358.001) (-357.055) * [-354.941] (-362.849) (-360.713) (-355.504) -- 0:00:58
      64000 -- (-354.714) [-356.813] (-357.555) (-357.073) * [-357.072] (-354.790) (-356.924) (-355.640) -- 0:00:58
      64500 -- (-354.931) [-354.377] (-360.218) (-358.876) * (-354.048) [-354.778] (-355.202) (-354.704) -- 0:00:58
      65000 -- [-354.485] (-357.614) (-361.125) (-356.847) * (-354.249) (-356.429) (-355.427) [-356.743] -- 0:00:57

      Average standard deviation of split frequencies: 0.031201

      65500 -- [-354.262] (-355.600) (-355.295) (-359.115) * [-355.066] (-354.932) (-356.073) (-358.662) -- 0:00:57
      66000 -- (-358.558) (-355.741) [-356.315] (-362.086) * (-360.159) (-358.651) (-354.608) [-357.874] -- 0:00:56
      66500 -- (-358.872) [-356.339] (-358.494) (-361.133) * (-354.950) [-354.860] (-355.451) (-360.999) -- 0:00:56
      67000 -- (-357.004) [-356.837] (-357.228) (-357.942) * (-354.405) (-355.930) (-361.271) [-355.295] -- 0:00:55
      67500 -- (-357.568) (-354.936) (-361.326) [-356.176] * (-354.727) (-356.469) [-356.987] (-356.568) -- 0:00:55
      68000 -- (-358.225) (-357.543) [-354.843] (-354.871) * (-357.368) [-355.940] (-356.176) (-358.754) -- 0:00:54
      68500 -- (-364.177) [-356.371] (-356.247) (-358.264) * [-356.989] (-355.451) (-355.932) (-355.793) -- 0:00:54
      69000 -- (-360.574) (-356.854) (-357.507) [-355.145] * (-354.512) (-354.923) [-357.513] (-355.556) -- 0:00:53
      69500 -- (-358.752) (-355.642) [-355.266] (-358.147) * (-356.233) (-355.257) (-360.039) [-355.819] -- 0:00:53
      70000 -- [-356.327] (-356.541) (-354.246) (-354.775) * (-354.871) [-354.833] (-359.050) (-358.072) -- 0:00:53

      Average standard deviation of split frequencies: 0.032652

      70500 -- (-354.978) (-355.149) [-355.579] (-358.121) * (-354.534) [-358.561] (-355.206) (-355.756) -- 0:00:52
      71000 -- (-354.570) (-360.475) [-354.042] (-355.439) * [-355.969] (-356.863) (-354.906) (-356.062) -- 0:00:52
      71500 -- (-356.454) (-356.174) (-358.186) [-357.913] * [-357.948] (-358.322) (-355.001) (-362.529) -- 0:00:51
      72000 -- (-354.579) (-354.181) [-356.497] (-358.774) * (-360.428) [-355.955] (-356.865) (-360.331) -- 0:01:04
      72500 -- (-356.428) (-360.827) [-355.824] (-359.444) * (-361.088) (-358.083) [-359.367] (-355.936) -- 0:01:03
      73000 -- (-355.621) [-355.710] (-354.200) (-355.358) * (-357.815) (-357.923) [-360.027] (-355.540) -- 0:01:03
      73500 -- [-356.416] (-356.914) (-354.887) (-357.807) * (-356.514) (-360.850) [-357.961] (-355.761) -- 0:01:03
      74000 -- [-355.304] (-357.621) (-354.309) (-356.487) * (-356.905) (-359.907) (-356.004) [-357.425] -- 0:01:02
      74500 -- [-359.731] (-355.816) (-355.635) (-356.131) * (-354.972) (-355.161) [-358.661] (-356.789) -- 0:01:02
      75000 -- (-359.398) [-355.458] (-356.467) (-355.553) * (-357.006) [-358.811] (-355.719) (-354.841) -- 0:01:01

      Average standard deviation of split frequencies: 0.028257

      75500 -- [-357.252] (-358.068) (-354.629) (-355.607) * (-356.518) [-355.668] (-358.317) (-355.904) -- 0:01:01
      76000 -- [-357.352] (-358.187) (-355.052) (-357.717) * (-355.535) [-356.777] (-357.253) (-355.116) -- 0:01:00
      76500 -- (-359.554) (-356.185) [-356.523] (-356.688) * (-355.476) [-355.198] (-359.795) (-359.983) -- 0:01:00
      77000 -- (-356.891) (-356.914) [-354.840] (-357.773) * (-354.833) (-355.166) [-355.337] (-357.658) -- 0:00:59
      77500 -- (-355.753) (-356.278) [-356.297] (-360.124) * [-355.284] (-356.824) (-356.117) (-360.252) -- 0:00:59
      78000 -- (-355.267) (-359.960) [-360.726] (-356.471) * (-358.559) (-356.094) [-357.025] (-355.868) -- 0:00:59
      78500 -- (-353.946) [-355.312] (-358.012) (-360.366) * (-355.350) [-357.030] (-356.409) (-355.955) -- 0:00:58
      79000 -- (-357.652) (-355.402) (-355.526) [-358.550] * [-354.918] (-359.596) (-357.172) (-359.059) -- 0:00:58
      79500 -- (-356.708) (-356.924) (-354.701) [-359.674] * (-355.323) (-356.530) (-355.039) [-358.105] -- 0:00:57
      80000 -- (-355.340) (-355.753) [-356.233] (-356.067) * (-354.807) (-355.040) [-357.491] (-358.653) -- 0:00:57

      Average standard deviation of split frequencies: 0.026947

      80500 -- (-354.889) (-355.439) [-357.959] (-356.529) * (-356.229) (-355.884) [-355.400] (-355.002) -- 0:00:57
      81000 -- (-355.024) (-354.750) (-355.888) [-356.806] * (-355.158) [-358.550] (-355.207) (-356.649) -- 0:00:56
      81500 -- (-356.658) [-356.457] (-355.827) (-357.537) * (-354.901) (-359.687) [-355.306] (-356.065) -- 0:00:56
      82000 -- (-356.053) [-356.409] (-359.711) (-355.639) * (-355.307) [-361.233] (-356.561) (-356.434) -- 0:00:55
      82500 -- [-355.623] (-356.652) (-358.327) (-356.449) * (-354.465) [-363.447] (-354.643) (-354.897) -- 0:00:55
      83000 -- (-358.142) (-356.343) [-355.831] (-356.528) * [-357.600] (-356.254) (-355.604) (-354.933) -- 0:00:55
      83500 -- (-358.352) (-357.399) [-356.160] (-356.104) * [-354.983] (-359.544) (-354.400) (-355.631) -- 0:00:54
      84000 -- (-357.690) (-359.368) (-359.962) [-354.563] * (-355.687) (-354.985) (-356.891) [-355.984] -- 0:00:54
      84500 -- [-355.778] (-358.832) (-357.343) (-356.040) * (-357.353) (-355.363) [-355.290] (-356.433) -- 0:00:54
      85000 -- (-357.191) (-355.420) (-363.418) [-354.862] * (-356.304) (-355.253) (-356.580) [-357.086] -- 0:00:53

      Average standard deviation of split frequencies: 0.029600

      85500 -- (-358.555) (-359.213) [-355.774] (-354.896) * (-357.238) (-357.469) (-355.571) [-354.681] -- 0:00:53
      86000 -- (-363.073) (-355.307) (-356.369) [-354.618] * (-355.806) (-356.210) [-358.012] (-356.258) -- 0:00:53
      86500 -- (-360.166) [-355.595] (-358.198) (-356.860) * [-356.740] (-358.350) (-359.520) (-355.768) -- 0:00:52
      87000 -- (-356.833) [-358.415] (-355.784) (-354.870) * [-358.219] (-355.366) (-356.163) (-356.321) -- 0:00:52
      87500 -- (-361.278) (-360.317) (-356.887) [-355.198] * (-363.243) [-357.117] (-355.639) (-356.203) -- 0:00:52
      88000 -- (-355.769) (-358.107) (-356.577) [-357.063] * (-362.979) [-359.237] (-357.200) (-355.397) -- 0:00:51
      88500 -- (-355.170) (-356.641) (-355.032) [-356.762] * (-358.080) (-355.080) (-356.687) [-357.428] -- 0:00:51
      89000 -- (-356.443) (-356.253) (-354.796) [-354.403] * (-356.423) [-355.278] (-363.197) (-357.738) -- 0:00:51
      89500 -- [-359.171] (-355.019) (-357.914) (-356.628) * (-355.322) (-357.818) [-357.445] (-356.558) -- 0:01:01
      90000 -- (-359.974) (-356.005) (-354.899) [-355.305] * [-357.183] (-357.865) (-355.135) (-356.007) -- 0:01:00

      Average standard deviation of split frequencies: 0.024355

      90500 -- [-356.451] (-358.370) (-357.687) (-357.766) * (-355.471) [-356.961] (-356.733) (-358.166) -- 0:01:00
      91000 -- (-361.322) (-356.205) (-355.885) [-355.617] * (-355.509) (-355.943) (-357.015) [-355.625] -- 0:00:59
      91500 -- [-354.937] (-363.580) (-355.273) (-354.911) * [-356.264] (-360.512) (-355.580) (-355.635) -- 0:00:59
      92000 -- (-355.868) (-356.759) [-356.389] (-356.737) * [-359.331] (-358.426) (-355.698) (-356.924) -- 0:00:59
      92500 -- (-355.163) (-355.890) [-355.499] (-355.288) * (-355.236) [-355.432] (-356.840) (-356.075) -- 0:00:58
      93000 -- (-360.470) [-359.361] (-355.128) (-358.051) * [-357.012] (-356.084) (-355.586) (-354.933) -- 0:00:58
      93500 -- (-355.167) (-355.289) [-355.652] (-355.181) * (-355.680) (-357.375) [-355.619] (-356.180) -- 0:00:58
      94000 -- (-354.818) (-356.792) (-357.437) [-355.147] * (-354.985) (-354.355) [-355.244] (-354.540) -- 0:00:57
      94500 -- [-356.519] (-355.351) (-357.138) (-358.541) * (-355.679) (-354.715) [-355.834] (-357.020) -- 0:00:57
      95000 -- [-355.505] (-356.555) (-362.252) (-354.798) * (-355.067) [-355.017] (-355.800) (-358.266) -- 0:00:57

      Average standard deviation of split frequencies: 0.022485

      95500 -- (-368.537) (-358.237) (-361.367) [-358.439] * (-355.704) [-354.174] (-359.251) (-356.488) -- 0:00:56
      96000 -- (-365.098) (-358.427) (-365.415) [-357.531] * [-355.543] (-354.583) (-360.675) (-355.374) -- 0:00:56
      96500 -- [-363.596] (-355.748) (-357.792) (-355.537) * (-358.504) (-360.292) (-364.023) [-354.716] -- 0:00:56
      97000 -- [-354.918] (-357.717) (-358.689) (-355.452) * (-354.551) (-354.351) (-357.496) [-354.954] -- 0:00:55
      97500 -- (-356.863) (-357.201) [-355.556] (-356.581) * (-356.336) (-356.367) (-355.949) [-354.974] -- 0:00:55
      98000 -- (-357.620) [-356.870] (-358.049) (-355.904) * (-358.377) (-354.621) [-354.730] (-357.349) -- 0:00:55
      98500 -- (-356.971) [-355.246] (-356.415) (-358.181) * (-361.285) [-356.095] (-360.889) (-357.446) -- 0:00:54
      99000 -- (-355.348) [-356.264] (-356.005) (-358.498) * (-360.418) (-358.262) (-356.087) [-354.567] -- 0:00:54
      99500 -- [-356.634] (-354.756) (-356.216) (-356.799) * (-358.445) (-359.527) [-355.842] (-355.298) -- 0:00:54
      100000 -- [-355.696] (-356.404) (-356.900) (-355.897) * (-357.597) [-354.350] (-356.116) (-357.510) -- 0:00:54

      Average standard deviation of split frequencies: 0.023414

      100500 -- (-355.181) (-356.684) [-355.088] (-355.349) * (-357.784) [-355.200] (-357.923) (-356.663) -- 0:00:53
      101000 -- [-355.290] (-356.960) (-354.320) (-355.232) * (-357.460) (-358.551) (-363.190) [-357.275] -- 0:00:53
      101500 -- (-357.423) (-356.390) (-355.299) [-356.618] * (-360.159) (-358.362) (-359.790) [-355.495] -- 0:00:53
      102000 -- [-355.241] (-357.062) (-355.152) (-357.570) * [-355.941] (-358.047) (-356.198) (-356.126) -- 0:00:52
      102500 -- [-357.270] (-356.543) (-355.727) (-357.039) * (-355.980) (-358.567) [-354.475] (-357.137) -- 0:00:52
      103000 -- (-355.235) [-355.819] (-357.063) (-355.920) * (-359.714) (-356.843) (-356.561) [-355.842] -- 0:00:52
      103500 -- (-356.569) (-355.989) (-356.552) [-356.118] * (-356.057) (-357.555) (-356.340) [-359.172] -- 0:00:51
      104000 -- (-360.004) (-356.115) (-356.707) [-356.388] * (-354.477) (-358.276) (-355.105) [-355.686] -- 0:00:51
      104500 -- [-355.736] (-355.513) (-355.185) (-356.556) * (-359.456) [-357.011] (-356.534) (-356.262) -- 0:00:51
      105000 -- (-360.344) (-355.067) [-355.066] (-358.562) * (-358.419) [-357.002] (-357.770) (-355.328) -- 0:00:51

      Average standard deviation of split frequencies: 0.022002

      105500 -- (-357.489) (-356.944) [-355.487] (-355.231) * (-355.710) [-356.262] (-359.867) (-359.256) -- 0:00:50
      106000 -- [-355.153] (-356.480) (-355.535) (-354.638) * (-358.803) [-356.793] (-355.570) (-355.512) -- 0:00:59
      106500 -- (-355.739) (-354.543) [-357.637] (-356.858) * [-358.512] (-359.118) (-356.159) (-356.749) -- 0:00:58
      107000 -- (-357.265) (-355.772) (-357.101) [-358.530] * (-354.978) (-355.488) [-357.097] (-356.253) -- 0:00:58
      107500 -- (-359.020) (-356.508) (-356.730) [-360.278] * (-354.276) [-355.372] (-355.762) (-357.208) -- 0:00:58
      108000 -- (-356.143) (-357.180) (-359.157) [-357.094] * (-357.300) (-358.890) [-356.716] (-358.678) -- 0:00:57
      108500 -- (-355.015) [-356.509] (-355.044) (-357.903) * (-354.695) (-355.276) (-354.862) [-355.488] -- 0:00:57
      109000 -- [-355.391] (-356.424) (-358.732) (-358.165) * [-360.166] (-354.636) (-354.714) (-355.691) -- 0:00:57
      109500 -- (-355.139) [-358.836] (-357.162) (-357.806) * (-358.505) (-355.183) [-354.548] (-357.970) -- 0:00:56
      110000 -- [-356.353] (-356.957) (-356.279) (-356.957) * (-357.559) [-355.822] (-355.814) (-357.183) -- 0:00:56

      Average standard deviation of split frequencies: 0.021523

      110500 -- (-356.121) (-356.889) [-354.899] (-356.916) * (-358.641) [-355.350] (-359.458) (-356.245) -- 0:00:56
      111000 -- (-355.096) [-355.424] (-355.078) (-355.811) * (-354.539) (-358.286) (-355.628) [-356.433] -- 0:00:56
      111500 -- (-357.931) (-355.839) (-355.151) [-356.239] * [-356.796] (-359.024) (-355.606) (-356.142) -- 0:00:55
      112000 -- (-355.363) [-357.231] (-356.833) (-358.358) * [-355.258] (-358.714) (-357.500) (-356.604) -- 0:00:55
      112500 -- (-356.548) (-356.245) (-356.834) [-355.011] * [-356.373] (-356.429) (-355.498) (-357.100) -- 0:00:55
      113000 -- [-354.921] (-356.329) (-358.191) (-357.487) * (-357.921) [-357.907] (-359.503) (-354.512) -- 0:00:54
      113500 -- (-355.497) [-355.954] (-359.972) (-357.319) * (-356.969) (-358.652) [-355.747] (-360.373) -- 0:00:54
      114000 -- (-358.241) [-355.852] (-357.641) (-355.976) * (-356.615) (-356.856) [-354.568] (-357.268) -- 0:00:54
      114500 -- (-358.329) (-356.026) (-356.337) [-359.366] * (-356.067) (-356.014) [-355.251] (-356.268) -- 0:00:54
      115000 -- (-357.797) (-355.710) (-355.564) [-354.592] * [-358.462] (-355.007) (-356.078) (-355.585) -- 0:00:53

      Average standard deviation of split frequencies: 0.020961

      115500 -- (-354.866) [-354.972] (-355.394) (-356.588) * (-359.445) [-354.936] (-359.668) (-358.080) -- 0:00:53
      116000 -- [-357.134] (-355.995) (-356.717) (-358.415) * (-358.426) (-354.986) (-363.332) [-356.026] -- 0:00:53
      116500 -- (-357.418) [-355.810] (-360.362) (-362.398) * (-361.929) (-357.762) (-357.861) [-356.508] -- 0:00:53
      117000 -- (-361.031) (-363.917) [-357.280] (-366.604) * (-360.653) (-356.589) (-358.240) [-355.048] -- 0:00:52
      117500 -- (-356.235) (-357.360) (-355.310) [-362.217] * (-356.691) (-357.906) [-356.317] (-355.697) -- 0:00:52
      118000 -- (-354.761) (-357.018) [-357.490] (-356.777) * (-355.050) (-356.616) [-355.076] (-355.229) -- 0:00:52
      118500 -- [-357.593] (-355.975) (-355.653) (-356.844) * (-354.692) (-354.828) (-355.128) [-355.663] -- 0:00:52
      119000 -- [-357.132] (-358.985) (-355.152) (-355.556) * [-355.096] (-355.566) (-356.049) (-356.204) -- 0:00:51
      119500 -- (-358.369) (-356.689) [-356.045] (-357.462) * [-355.430] (-355.050) (-355.034) (-357.470) -- 0:00:51
      120000 -- (-360.311) (-355.978) (-354.943) [-356.924] * (-356.287) (-357.992) [-356.436] (-355.857) -- 0:00:51

      Average standard deviation of split frequencies: 0.018711

      120500 -- (-360.432) [-355.772] (-356.592) (-355.344) * (-356.751) (-355.757) [-355.298] (-354.952) -- 0:00:51
      121000 -- (-357.036) (-357.005) (-357.603) [-355.341] * (-356.028) [-356.690] (-356.173) (-359.236) -- 0:00:50
      121500 -- (-355.752) (-355.253) (-354.953) [-356.053] * (-354.891) [-357.716] (-361.438) (-355.630) -- 0:00:50
      122000 -- (-359.389) (-354.163) (-358.867) [-356.329] * (-354.581) (-354.536) [-356.550] (-356.691) -- 0:00:50
      122500 -- (-355.411) (-354.619) (-359.710) [-355.357] * (-355.091) (-360.044) [-354.105] (-355.569) -- 0:00:50
      123000 -- (-357.137) [-355.270] (-357.178) (-354.125) * (-356.425) (-357.518) [-355.100] (-356.488) -- 0:00:57
      123500 -- (-355.049) (-354.884) [-355.546] (-356.277) * (-355.954) (-363.811) [-354.975] (-359.656) -- 0:00:56
      124000 -- [-358.951] (-356.840) (-357.041) (-355.619) * (-356.182) (-357.499) (-354.112) [-355.304] -- 0:00:56
      124500 -- [-356.258] (-354.774) (-357.012) (-361.767) * (-356.753) (-359.045) (-356.754) [-356.968] -- 0:00:56
      125000 -- (-357.633) (-358.207) (-357.074) [-359.869] * (-357.213) (-357.628) [-356.841] (-357.022) -- 0:00:56

      Average standard deviation of split frequencies: 0.017584

      125500 -- (-356.117) [-363.134] (-357.861) (-363.915) * (-356.502) (-360.420) (-357.062) [-357.457] -- 0:00:55
      126000 -- [-355.418] (-354.519) (-355.570) (-356.282) * (-356.631) (-356.258) (-356.660) [-358.322] -- 0:00:55
      126500 -- (-356.921) (-356.270) (-357.359) [-358.963] * [-355.711] (-359.203) (-355.971) (-356.262) -- 0:00:55
      127000 -- (-357.394) [-355.184] (-355.719) (-356.305) * (-355.079) (-355.503) (-354.732) [-357.561] -- 0:00:54
      127500 -- (-357.479) (-357.657) [-355.187] (-355.031) * (-356.825) [-356.785] (-355.195) (-358.183) -- 0:00:54
      128000 -- [-356.409] (-354.740) (-357.305) (-356.337) * [-356.455] (-355.400) (-355.535) (-355.912) -- 0:00:54
      128500 -- (-360.871) (-355.950) [-354.373] (-357.580) * (-355.794) (-355.550) (-357.410) [-354.559] -- 0:00:54
      129000 -- (-357.658) [-355.791] (-359.094) (-357.614) * [-355.716] (-355.844) (-355.615) (-357.414) -- 0:00:54
      129500 -- (-358.001) [-356.490] (-359.606) (-356.984) * (-356.642) (-355.782) (-355.272) [-354.564] -- 0:00:53
      130000 -- (-357.727) (-368.678) (-354.817) [-354.442] * (-362.023) (-357.866) (-354.688) [-356.575] -- 0:00:53

      Average standard deviation of split frequencies: 0.014972

      130500 -- (-356.786) (-366.191) [-356.284] (-357.363) * (-356.444) (-360.189) [-357.025] (-354.707) -- 0:00:53
      131000 -- (-357.193) (-354.938) (-355.984) [-355.764] * (-356.814) [-355.847] (-355.954) (-355.449) -- 0:00:53
      131500 -- (-356.593) (-358.200) (-356.314) [-355.591] * (-358.541) [-355.044] (-355.786) (-357.400) -- 0:00:52
      132000 -- (-357.014) (-355.229) (-357.383) [-356.583] * (-356.360) (-354.530) [-357.656] (-356.564) -- 0:00:52
      132500 -- (-356.728) (-356.671) (-355.909) [-358.052] * (-356.522) [-354.956] (-356.827) (-359.569) -- 0:00:52
      133000 -- [-360.199] (-358.327) (-356.376) (-357.941) * (-357.655) [-354.929] (-354.342) (-354.736) -- 0:00:52
      133500 -- (-358.597) (-357.860) (-356.429) [-356.465] * (-354.530) (-358.202) (-354.876) [-355.118] -- 0:00:51
      134000 -- [-358.269] (-357.764) (-355.830) (-354.827) * [-356.502] (-358.332) (-358.791) (-355.964) -- 0:00:51
      134500 -- (-356.249) (-361.499) (-355.371) [-356.543] * (-359.958) [-358.161] (-357.828) (-355.190) -- 0:00:51
      135000 -- (-355.234) (-357.935) (-361.995) [-356.748] * [-357.232] (-355.611) (-357.042) (-358.908) -- 0:00:51

      Average standard deviation of split frequencies: 0.013518

      135500 -- (-358.401) (-355.571) [-362.526] (-359.320) * (-359.081) [-357.000] (-357.516) (-360.068) -- 0:00:51
      136000 -- [-359.002] (-356.010) (-357.985) (-355.439) * (-354.689) (-356.156) (-354.383) [-355.315] -- 0:00:50
      136500 -- (-358.075) [-357.256] (-355.733) (-357.925) * [-355.983] (-355.057) (-355.337) (-356.902) -- 0:00:50
      137000 -- [-356.816] (-357.513) (-359.932) (-362.556) * (-356.422) (-354.989) (-355.094) [-356.125] -- 0:00:50
      137500 -- (-358.968) [-360.868] (-358.597) (-355.508) * [-354.553] (-357.856) (-355.652) (-358.986) -- 0:00:50
      138000 -- [-354.895] (-357.155) (-355.772) (-356.661) * (-358.089) [-360.501] (-355.130) (-357.130) -- 0:00:49
      138500 -- [-354.740] (-361.341) (-360.026) (-357.882) * (-361.435) (-356.470) [-357.061] (-355.911) -- 0:00:49
      139000 -- (-357.822) [-355.884] (-355.864) (-359.646) * [-358.025] (-356.282) (-359.057) (-357.291) -- 0:00:49
      139500 -- (-354.930) (-355.005) [-355.081] (-358.410) * (-357.954) [-356.262] (-357.190) (-354.934) -- 0:00:49
      140000 -- (-356.636) (-355.584) [-354.817] (-356.640) * (-355.474) [-355.972] (-355.985) (-357.674) -- 0:00:55

      Average standard deviation of split frequencies: 0.011227

      140500 -- (-356.914) (-357.145) [-356.192] (-356.011) * (-356.976) (-356.548) (-355.274) [-355.115] -- 0:00:55
      141000 -- (-356.831) [-354.726] (-359.607) (-358.861) * [-360.373] (-358.068) (-356.552) (-354.938) -- 0:00:54
      141500 -- (-357.206) [-358.967] (-358.774) (-356.735) * (-359.680) (-357.536) [-354.335] (-354.990) -- 0:00:54
      142000 -- (-355.658) (-354.719) [-355.295] (-354.505) * (-358.115) (-360.215) [-357.954] (-356.009) -- 0:00:54
      142500 -- (-355.724) [-354.511] (-358.135) (-361.244) * [-355.657] (-357.363) (-356.723) (-356.793) -- 0:00:54
      143000 -- (-356.971) (-354.845) [-354.488] (-360.316) * (-354.700) (-356.385) [-354.243] (-359.444) -- 0:00:53
      143500 -- (-355.066) [-357.038] (-356.520) (-357.429) * (-355.472) (-357.316) [-356.865] (-354.852) -- 0:00:53
      144000 -- (-355.469) (-355.802) (-354.370) [-354.644] * (-356.629) [-357.120] (-358.696) (-357.324) -- 0:00:53
      144500 -- (-356.358) [-357.581] (-354.534) (-355.193) * (-357.142) (-356.930) [-355.160] (-355.122) -- 0:00:53
      145000 -- (-356.573) (-360.322) (-356.006) [-355.438] * (-356.592) [-355.377] (-355.669) (-355.493) -- 0:00:53

      Average standard deviation of split frequencies: 0.011947

      145500 -- (-355.967) (-357.235) [-354.405] (-360.590) * (-355.568) (-357.079) [-354.857] (-354.910) -- 0:00:52
      146000 -- (-354.807) [-356.712] (-354.762) (-357.521) * (-358.153) (-356.186) (-356.101) [-356.007] -- 0:00:52
      146500 -- (-355.650) (-356.890) (-356.069) [-357.102] * (-354.286) (-354.783) (-355.148) [-356.173] -- 0:00:52
      147000 -- (-357.465) [-354.136] (-356.598) (-356.815) * (-358.504) [-357.928] (-363.160) (-362.083) -- 0:00:52
      147500 -- [-355.188] (-355.097) (-354.646) (-354.508) * (-359.756) (-356.685) [-360.025] (-357.031) -- 0:00:52
      148000 -- (-358.226) [-354.599] (-355.137) (-354.786) * [-358.955] (-360.013) (-355.663) (-357.288) -- 0:00:51
      148500 -- (-357.800) (-354.596) (-355.817) [-355.626] * (-357.403) (-357.871) (-361.843) [-355.965] -- 0:00:51
      149000 -- [-357.648] (-357.120) (-355.230) (-356.354) * (-357.022) (-358.831) [-356.679] (-355.289) -- 0:00:51
      149500 -- (-357.423) [-356.929] (-358.534) (-358.258) * (-356.663) [-354.224] (-354.516) (-358.625) -- 0:00:51
      150000 -- (-355.340) (-354.645) (-358.309) [-361.712] * (-355.977) (-354.581) (-358.192) [-358.275] -- 0:00:51

      Average standard deviation of split frequencies: 0.012845

      150500 -- (-355.679) (-356.300) [-355.432] (-358.342) * (-356.296) [-355.958] (-355.333) (-355.579) -- 0:00:50
      151000 -- (-354.679) [-357.275] (-355.400) (-358.831) * [-357.094] (-356.569) (-357.951) (-356.262) -- 0:00:50
      151500 -- (-357.037) (-358.840) (-355.168) [-356.515] * (-356.413) (-356.658) [-355.102] (-357.400) -- 0:00:50
      152000 -- (-357.560) (-356.043) (-356.261) [-355.495] * (-354.990) (-355.491) [-355.614] (-355.301) -- 0:00:50
      152500 -- (-355.810) [-355.469] (-358.567) (-356.064) * (-359.242) (-363.029) [-357.903] (-356.768) -- 0:00:50
      153000 -- (-358.572) (-354.688) (-355.567) [-355.830] * [-357.626] (-358.459) (-356.497) (-355.472) -- 0:00:49
      153500 -- [-355.725] (-357.277) (-357.313) (-357.786) * (-359.173) (-360.051) [-357.595] (-357.053) -- 0:00:49
      154000 -- (-358.163) (-356.406) [-356.210] (-356.904) * [-355.586] (-356.712) (-354.944) (-358.091) -- 0:00:49
      154500 -- (-355.280) [-355.714] (-359.519) (-355.098) * [-356.695] (-361.165) (-362.425) (-357.683) -- 0:00:49
      155000 -- (-358.189) [-354.645] (-361.547) (-357.170) * (-355.675) (-358.375) (-358.751) [-357.819] -- 0:00:49

      Average standard deviation of split frequencies: 0.012927

      155500 -- (-362.751) (-357.316) (-356.488) [-357.290] * (-356.314) (-356.638) (-357.613) [-360.331] -- 0:00:48
      156000 -- (-355.099) (-355.766) (-358.118) [-357.123] * (-358.337) (-357.275) [-355.198] (-356.035) -- 0:00:48
      156500 -- (-358.957) (-355.809) (-357.368) [-354.409] * (-357.592) (-356.873) [-358.010] (-359.751) -- 0:00:48
      157000 -- (-355.033) [-355.207] (-355.897) (-354.950) * [-358.014] (-358.354) (-356.292) (-355.473) -- 0:00:48
      157500 -- (-354.822) (-354.970) (-356.575) [-355.645] * (-356.470) (-358.672) (-355.637) [-355.083] -- 0:00:53
      158000 -- (-358.046) [-360.271] (-359.081) (-356.611) * (-355.096) (-355.998) (-357.374) [-355.961] -- 0:00:53
      158500 -- (-355.821) (-354.622) (-355.987) [-356.146] * (-354.221) (-354.810) (-354.453) [-356.916] -- 0:00:53
      159000 -- [-355.820] (-356.435) (-355.238) (-358.318) * (-357.960) (-354.671) (-356.912) [-357.145] -- 0:00:52
      159500 -- [-357.081] (-355.055) (-354.451) (-357.096) * (-358.241) (-355.796) (-360.355) [-358.166] -- 0:00:52
      160000 -- [-360.486] (-354.973) (-356.418) (-356.479) * (-357.772) [-356.404] (-357.859) (-358.146) -- 0:00:52

      Average standard deviation of split frequencies: 0.013280

      160500 -- (-361.949) [-356.526] (-357.063) (-355.700) * (-357.653) [-356.575] (-354.729) (-356.248) -- 0:00:52
      161000 -- [-356.115] (-358.581) (-357.174) (-355.872) * (-358.616) (-357.102) [-354.685] (-355.325) -- 0:00:52
      161500 -- [-356.540] (-359.484) (-355.683) (-360.922) * (-357.658) (-357.285) (-356.076) [-355.201] -- 0:00:51
      162000 -- (-358.031) [-355.582] (-354.352) (-356.143) * (-356.879) (-357.784) (-355.894) [-356.946] -- 0:00:51
      162500 -- [-355.937] (-359.313) (-360.289) (-360.694) * [-355.070] (-358.226) (-355.340) (-355.925) -- 0:00:51
      163000 -- (-355.385) [-357.792] (-355.183) (-356.504) * [-357.866] (-356.653) (-360.880) (-355.350) -- 0:00:51
      163500 -- (-357.618) (-354.918) (-358.099) [-355.422] * (-355.108) [-355.277] (-356.420) (-354.691) -- 0:00:51
      164000 -- (-354.357) (-354.066) [-357.556] (-355.039) * (-354.472) (-358.629) [-355.791] (-355.097) -- 0:00:50
      164500 -- (-354.753) [-355.085] (-358.261) (-356.184) * [-354.806] (-357.933) (-356.221) (-357.587) -- 0:00:50
      165000 -- (-357.658) [-355.548] (-360.530) (-355.799) * [-356.551] (-355.715) (-355.672) (-355.989) -- 0:00:50

      Average standard deviation of split frequencies: 0.012621

      165500 -- (-357.472) (-356.145) (-359.672) [-357.379] * [-354.401] (-355.408) (-356.750) (-356.973) -- 0:00:50
      166000 -- (-358.149) (-356.280) (-357.361) [-354.534] * (-355.911) (-355.387) [-355.030] (-357.299) -- 0:00:50
      166500 -- [-358.863] (-356.065) (-356.076) (-354.826) * [-359.443] (-356.052) (-357.416) (-356.409) -- 0:00:50
      167000 -- (-356.074) (-357.757) [-357.810] (-356.062) * (-358.319) [-356.150] (-358.213) (-355.477) -- 0:00:49
      167500 -- (-359.106) [-357.327] (-355.703) (-355.868) * (-355.872) (-357.427) [-356.999] (-355.138) -- 0:00:49
      168000 -- (-356.935) (-354.263) [-355.681] (-357.428) * (-355.811) [-354.537] (-356.495) (-355.029) -- 0:00:49
      168500 -- (-354.712) (-355.192) [-356.514] (-358.309) * (-354.938) (-358.411) [-355.619] (-357.205) -- 0:00:49
      169000 -- (-356.204) (-356.903) [-357.833] (-359.979) * (-354.766) [-356.880] (-357.000) (-355.665) -- 0:00:49
      169500 -- (-356.631) (-359.874) (-355.153) [-355.526] * (-358.812) (-356.177) [-355.269] (-355.760) -- 0:00:48
      170000 -- (-357.629) (-355.963) [-354.597] (-356.356) * (-356.798) [-357.426] (-356.319) (-357.984) -- 0:00:48

      Average standard deviation of split frequencies: 0.010724

      170500 -- (-356.190) (-355.677) (-354.627) [-356.937] * (-355.627) [-356.601] (-356.093) (-362.001) -- 0:00:48
      171000 -- (-355.823) (-356.220) [-355.922] (-355.976) * (-356.907) (-355.581) [-356.888] (-364.133) -- 0:00:48
      171500 -- [-355.957] (-358.125) (-357.053) (-355.180) * [-355.245] (-354.877) (-357.125) (-357.466) -- 0:00:48
      172000 -- [-355.404] (-358.194) (-355.058) (-356.275) * [-356.143] (-355.929) (-361.657) (-362.115) -- 0:00:48
      172500 -- (-355.547) (-360.336) (-357.190) [-357.314] * (-357.079) (-357.138) (-356.717) [-355.569] -- 0:00:47
      173000 -- (-355.073) (-358.181) [-356.991] (-354.832) * [-355.131] (-354.852) (-359.445) (-355.607) -- 0:00:47
      173500 -- (-358.338) (-356.887) [-355.002] (-358.452) * (-356.593) (-358.481) (-358.252) [-356.059] -- 0:00:47
      174000 -- (-356.199) (-357.892) (-358.552) [-355.988] * (-355.202) (-357.109) [-357.926] (-357.920) -- 0:00:47
      174500 -- (-357.625) (-361.898) (-354.914) [-356.382] * [-357.215] (-359.847) (-357.180) (-356.484) -- 0:00:47
      175000 -- [-355.200] (-355.328) (-354.888) (-357.173) * (-355.097) (-356.332) [-357.322] (-355.017) -- 0:00:51

      Average standard deviation of split frequencies: 0.011502

      175500 -- (-357.328) (-354.680) (-356.886) [-359.744] * (-355.591) (-355.959) (-358.743) [-354.324] -- 0:00:51
      176000 -- (-354.809) (-361.793) [-354.050] (-355.349) * [-356.870] (-355.334) (-357.442) (-357.198) -- 0:00:51
      176500 -- (-355.247) [-361.703] (-354.148) (-358.118) * [-357.807] (-355.412) (-355.179) (-358.414) -- 0:00:51
      177000 -- (-357.287) (-355.358) (-359.561) [-355.327] * (-357.606) (-357.074) (-358.420) [-357.143] -- 0:00:51
      177500 -- (-355.721) (-356.799) [-354.086] (-356.148) * (-360.236) [-354.880] (-354.956) (-356.163) -- 0:00:50
      178000 -- (-358.041) [-355.728] (-355.791) (-358.543) * (-354.869) [-356.094] (-354.699) (-357.258) -- 0:00:50
      178500 -- (-355.098) (-356.258) (-355.382) [-354.776] * (-355.323) [-354.703] (-357.570) (-357.870) -- 0:00:50
      179000 -- [-358.679] (-356.966) (-354.737) (-355.823) * (-358.869) [-359.068] (-357.679) (-354.513) -- 0:00:50
      179500 -- (-355.042) (-354.755) [-355.212] (-357.843) * (-355.908) (-355.294) [-355.285] (-355.968) -- 0:00:50
      180000 -- [-355.702] (-354.948) (-355.242) (-357.865) * (-358.145) (-357.787) [-355.238] (-356.949) -- 0:00:50

      Average standard deviation of split frequencies: 0.012125

      180500 -- [-359.277] (-361.275) (-357.733) (-357.292) * (-356.583) (-361.523) (-359.544) [-356.000] -- 0:00:49
      181000 -- [-357.351] (-354.624) (-356.743) (-356.785) * [-358.799] (-361.836) (-355.583) (-355.004) -- 0:00:49
      181500 -- (-354.810) (-354.811) (-357.878) [-356.556] * (-357.357) (-357.716) [-355.760] (-357.581) -- 0:00:49
      182000 -- (-356.478) (-356.092) [-355.426] (-359.058) * (-357.776) [-354.979] (-355.288) (-357.146) -- 0:00:49
      182500 -- (-356.235) (-357.691) (-356.197) [-363.892] * (-356.673) [-356.998] (-360.076) (-354.628) -- 0:00:49
      183000 -- (-357.380) [-356.350] (-356.464) (-358.128) * [-357.891] (-361.417) (-355.476) (-354.738) -- 0:00:49
      183500 -- (-354.765) (-356.387) [-358.543] (-361.557) * (-355.288) [-358.145] (-354.921) (-354.836) -- 0:00:48
      184000 -- (-355.430) [-356.075] (-355.224) (-355.793) * [-357.737] (-356.002) (-356.825) (-358.860) -- 0:00:48
      184500 -- (-356.449) (-356.270) (-355.213) [-356.624] * (-357.258) [-355.827] (-361.177) (-354.876) -- 0:00:48
      185000 -- [-356.231] (-355.026) (-357.290) (-355.854) * (-356.656) [-356.185] (-355.745) (-357.724) -- 0:00:48

      Average standard deviation of split frequencies: 0.011629

      185500 -- [-355.119] (-358.402) (-361.197) (-358.972) * (-365.598) [-357.459] (-357.856) (-359.321) -- 0:00:48
      186000 -- [-358.143] (-356.404) (-355.967) (-357.020) * (-359.530) (-356.503) (-361.260) [-358.319] -- 0:00:48
      186500 -- [-356.329] (-361.361) (-356.717) (-357.216) * [-354.559] (-354.296) (-360.327) (-357.172) -- 0:00:47
      187000 -- (-355.764) (-361.107) (-357.023) [-354.539] * [-355.936] (-356.330) (-359.514) (-356.843) -- 0:00:47
      187500 -- (-357.005) (-356.304) (-356.438) [-356.389] * (-357.905) (-356.898) [-356.385] (-355.265) -- 0:00:47
      188000 -- [-354.791] (-356.808) (-354.649) (-354.213) * (-355.205) (-355.895) (-358.381) [-356.846] -- 0:00:47
      188500 -- (-358.537) (-358.956) [-354.730] (-356.348) * [-357.493] (-357.622) (-357.342) (-355.247) -- 0:00:47
      189000 -- (-359.098) (-356.205) [-355.430] (-356.842) * (-357.179) (-357.488) [-354.715] (-355.850) -- 0:00:47
      189500 -- (-355.928) (-355.839) [-356.442] (-361.334) * [-355.746] (-355.993) (-356.253) (-355.103) -- 0:00:47
      190000 -- (-355.132) (-356.288) [-355.393] (-359.626) * (-357.029) (-359.291) [-358.283] (-357.292) -- 0:00:46

      Average standard deviation of split frequencies: 0.011635

      190500 -- (-360.439) (-356.271) [-359.750] (-359.291) * (-360.420) (-363.985) [-363.091] (-356.076) -- 0:00:46
      191000 -- (-355.175) (-356.665) (-359.747) [-355.785] * [-356.100] (-366.817) (-359.924) (-354.607) -- 0:00:46
      191500 -- (-356.384) [-355.050] (-355.758) (-358.673) * (-357.405) (-364.868) (-355.573) [-357.865] -- 0:00:50
      192000 -- (-355.107) (-354.959) (-358.172) [-354.269] * (-356.799) (-362.481) [-355.489] (-355.289) -- 0:00:50
      192500 -- (-358.344) [-356.715] (-354.942) (-355.054) * (-356.342) (-356.453) (-356.958) [-359.622] -- 0:00:50
      193000 -- (-360.213) (-354.361) [-354.381] (-356.861) * (-357.558) (-356.541) (-355.925) [-356.720] -- 0:00:50
      193500 -- (-355.712) (-355.004) (-354.657) [-355.750] * (-357.985) (-356.249) [-356.765] (-357.331) -- 0:00:50
      194000 -- (-355.957) [-356.816] (-356.574) (-356.786) * (-356.589) [-357.100] (-358.427) (-355.815) -- 0:00:49
      194500 -- [-356.949] (-356.087) (-355.394) (-356.412) * [-354.810] (-360.607) (-358.506) (-356.669) -- 0:00:49
      195000 -- (-356.911) [-355.778] (-356.041) (-356.437) * (-354.433) (-360.540) [-356.298] (-355.522) -- 0:00:49

      Average standard deviation of split frequencies: 0.011384

      195500 -- (-359.337) (-355.639) (-355.511) [-356.647] * (-355.781) [-357.980] (-356.318) (-355.451) -- 0:00:49
      196000 -- (-362.015) (-355.582) (-354.731) [-356.156] * (-356.118) (-357.220) (-356.241) [-356.124] -- 0:00:49
      196500 -- (-368.994) (-355.456) (-357.587) [-357.469] * [-358.599] (-354.587) (-355.657) (-355.930) -- 0:00:49
      197000 -- [-355.249] (-356.757) (-357.717) (-357.114) * (-356.906) (-354.987) (-355.957) [-356.550] -- 0:00:48
      197500 -- [-355.257] (-354.867) (-356.199) (-355.623) * (-361.586) [-355.362] (-355.386) (-360.686) -- 0:00:48
      198000 -- (-361.929) (-356.264) (-357.357) [-358.321] * (-358.197) (-357.086) (-357.813) [-354.292] -- 0:00:48
      198500 -- (-357.609) (-357.398) (-356.896) [-356.452] * (-356.386) (-360.276) [-357.132] (-357.048) -- 0:00:48
      199000 -- (-356.521) [-357.681] (-357.800) (-357.250) * (-356.938) (-358.911) (-355.780) [-364.222] -- 0:00:48
      199500 -- (-354.611) (-354.684) [-356.185] (-355.697) * (-356.556) [-355.488] (-355.428) (-359.971) -- 0:00:48
      200000 -- (-356.840) (-357.925) [-354.420] (-356.439) * (-358.884) [-354.850] (-357.023) (-359.058) -- 0:00:48

      Average standard deviation of split frequencies: 0.012774

      200500 -- [-355.754] (-354.878) (-354.493) (-354.787) * (-356.652) (-356.623) (-354.913) [-355.950] -- 0:00:47
      201000 -- [-354.923] (-356.785) (-354.689) (-354.743) * (-356.390) [-356.488] (-356.568) (-357.368) -- 0:00:47
      201500 -- [-354.283] (-354.970) (-355.539) (-355.507) * (-354.875) [-355.972] (-358.239) (-357.502) -- 0:00:47
      202000 -- [-354.464] (-356.783) (-357.503) (-359.435) * [-354.411] (-356.082) (-355.312) (-357.384) -- 0:00:47
      202500 -- (-356.488) (-355.450) (-356.347) [-356.737] * (-358.947) (-357.402) [-356.927] (-361.146) -- 0:00:47
      203000 -- (-356.116) [-356.062] (-356.821) (-359.612) * [-354.863] (-355.810) (-358.392) (-356.870) -- 0:00:47
      203500 -- [-357.159] (-358.146) (-354.829) (-355.146) * (-357.138) [-354.849] (-355.584) (-357.292) -- 0:00:46
      204000 -- (-355.808) [-359.099] (-356.218) (-360.799) * [-357.070] (-356.180) (-359.072) (-354.655) -- 0:00:46
      204500 -- (-356.282) [-358.054] (-358.206) (-359.636) * (-358.024) (-358.559) (-361.318) [-354.891] -- 0:00:46
      205000 -- [-355.245] (-355.837) (-356.435) (-355.217) * (-356.612) (-354.630) [-355.795] (-357.752) -- 0:00:46

      Average standard deviation of split frequencies: 0.012250

      205500 -- (-355.173) (-357.804) [-355.397] (-355.126) * (-356.119) [-355.050] (-356.009) (-355.506) -- 0:00:46
      206000 -- (-356.768) (-358.430) (-357.450) [-355.032] * (-355.130) (-356.287) (-354.969) [-354.872] -- 0:00:46
      206500 -- (-357.338) [-354.866] (-355.363) (-357.695) * (-358.565) [-357.875] (-360.101) (-355.181) -- 0:00:46
      207000 -- (-361.352) (-356.685) [-355.091] (-360.081) * (-361.336) (-355.438) [-357.957] (-354.964) -- 0:00:45
      207500 -- (-355.972) (-355.431) [-355.520] (-358.226) * (-354.917) (-354.460) (-359.263) [-356.927] -- 0:00:45
      208000 -- (-356.286) (-359.468) (-358.801) [-358.543] * (-359.275) [-354.890] (-356.556) (-357.328) -- 0:00:45
      208500 -- (-357.686) [-354.589] (-356.574) (-357.506) * (-358.976) [-360.277] (-357.418) (-358.867) -- 0:00:49
      209000 -- [-359.939] (-354.709) (-359.160) (-355.832) * (-356.937) (-357.628) [-356.738] (-354.914) -- 0:00:49
      209500 -- (-355.356) [-354.849] (-354.663) (-359.299) * (-357.452) [-355.653] (-357.451) (-354.772) -- 0:00:49
      210000 -- [-356.512] (-354.504) (-356.993) (-356.925) * (-356.905) [-354.579] (-357.541) (-357.081) -- 0:00:48

      Average standard deviation of split frequencies: 0.014296

      210500 -- [-357.840] (-355.818) (-357.442) (-357.156) * (-356.798) (-355.098) [-357.045] (-355.208) -- 0:00:48
      211000 -- (-357.935) (-354.847) [-355.516] (-355.704) * [-354.502] (-357.374) (-356.677) (-360.093) -- 0:00:48
      211500 -- (-357.053) (-357.149) [-354.459] (-354.938) * [-356.095] (-357.337) (-355.980) (-355.909) -- 0:00:48
      212000 -- (-358.345) [-354.902] (-355.623) (-357.651) * (-355.284) [-356.852] (-356.211) (-360.037) -- 0:00:48
      212500 -- (-356.793) (-354.489) [-357.591] (-357.713) * (-355.813) (-357.017) (-358.458) [-357.163] -- 0:00:48
      213000 -- (-355.521) (-354.710) [-359.457] (-357.109) * [-357.386] (-356.321) (-357.480) (-355.820) -- 0:00:48
      213500 -- [-355.438] (-355.804) (-361.109) (-358.543) * (-355.774) [-354.782] (-357.251) (-358.526) -- 0:00:47
      214000 -- (-354.071) [-355.473] (-361.622) (-354.908) * [-356.776] (-355.574) (-356.495) (-356.327) -- 0:00:47
      214500 -- (-354.534) (-356.712) (-357.464) [-356.446] * (-355.964) (-359.510) [-356.397] (-356.417) -- 0:00:47
      215000 -- (-355.457) (-357.463) [-356.342] (-357.903) * [-358.336] (-356.174) (-359.367) (-356.887) -- 0:00:47

      Average standard deviation of split frequencies: 0.015791

      215500 -- [-359.489] (-355.366) (-356.925) (-359.041) * (-355.314) [-357.427] (-355.582) (-355.486) -- 0:00:47
      216000 -- (-356.724) [-354.925] (-354.916) (-358.313) * (-362.449) [-355.419] (-355.842) (-356.099) -- 0:00:47
      216500 -- (-354.574) (-355.636) [-355.084] (-355.681) * (-357.782) [-360.263] (-360.266) (-363.857) -- 0:00:47
      217000 -- (-358.365) [-357.473] (-357.513) (-356.727) * (-355.582) (-357.879) [-355.825] (-357.658) -- 0:00:46
      217500 -- (-354.688) (-355.634) [-355.260] (-355.551) * [-355.897] (-360.517) (-354.834) (-354.237) -- 0:00:46
      218000 -- (-354.639) [-354.265] (-357.122) (-355.977) * [-356.172] (-360.385) (-356.517) (-356.329) -- 0:00:46
      218500 -- [-356.013] (-354.363) (-357.281) (-358.249) * (-357.310) [-357.490] (-360.202) (-357.836) -- 0:00:46
      219000 -- (-354.742) [-356.001] (-356.501) (-356.992) * (-355.631) [-354.681] (-358.797) (-355.012) -- 0:00:46
      219500 -- [-357.379] (-356.573) (-355.206) (-357.166) * (-359.494) (-355.855) (-354.950) [-354.896] -- 0:00:46
      220000 -- (-356.795) (-355.616) (-356.547) [-354.560] * (-358.434) [-356.363] (-355.835) (-358.560) -- 0:00:46

      Average standard deviation of split frequencies: 0.014954

      220500 -- (-358.160) [-355.706] (-355.552) (-357.574) * (-357.777) (-355.633) [-361.831] (-361.717) -- 0:00:45
      221000 -- (-358.770) [-356.529] (-356.699) (-356.661) * [-355.661] (-356.217) (-356.487) (-355.925) -- 0:00:45
      221500 -- (-357.076) (-354.878) (-359.181) [-356.311] * (-354.495) (-356.253) [-354.843] (-355.963) -- 0:00:45
      222000 -- (-354.551) [-357.268] (-355.697) (-358.965) * (-356.544) [-356.954] (-356.981) (-359.553) -- 0:00:45
      222500 -- (-354.470) (-357.831) (-354.475) [-354.698] * (-355.801) (-356.338) (-356.095) [-355.163] -- 0:00:45
      223000 -- (-357.364) [-359.198] (-355.798) (-355.280) * [-360.227] (-355.989) (-354.889) (-355.685) -- 0:00:45
      223500 -- [-355.980] (-356.957) (-356.755) (-356.557) * [-359.114] (-355.688) (-355.417) (-356.119) -- 0:00:45
      224000 -- (-362.972) (-356.286) [-356.341] (-356.766) * (-355.361) (-355.780) (-355.771) [-355.278] -- 0:00:45
      224500 -- (-356.289) (-357.152) [-357.432] (-359.910) * [-354.331] (-356.264) (-355.666) (-356.362) -- 0:00:44
      225000 -- (-358.260) (-357.171) (-357.246) [-363.393] * [-355.628] (-356.212) (-354.871) (-358.366) -- 0:00:44

      Average standard deviation of split frequencies: 0.014110

      225500 -- (-357.735) (-364.500) [-358.002] (-355.422) * (-357.242) (-358.300) [-361.272] (-355.796) -- 0:00:44
      226000 -- [-357.976] (-357.494) (-360.204) (-359.229) * (-357.614) (-358.428) [-356.441] (-356.245) -- 0:00:44
      226500 -- (-355.925) [-354.617] (-359.202) (-356.152) * (-354.504) (-355.052) (-357.520) [-360.592] -- 0:00:47
      227000 -- (-357.680) (-354.663) (-358.071) [-355.743] * [-356.539] (-354.386) (-355.727) (-355.253) -- 0:00:47
      227500 -- (-356.290) [-356.976] (-361.566) (-354.174) * (-356.376) [-354.325] (-355.849) (-357.310) -- 0:00:47
      228000 -- (-354.551) (-357.313) (-364.355) [-354.407] * (-355.711) (-355.721) [-358.104] (-357.408) -- 0:00:47
      228500 -- (-354.355) [-356.346] (-361.520) (-357.377) * (-354.895) (-355.533) [-357.629] (-358.258) -- 0:00:47
      229000 -- [-355.454] (-359.935) (-357.666) (-356.769) * (-356.900) [-356.007] (-358.784) (-355.990) -- 0:00:47
      229500 -- (-356.205) (-356.071) (-355.904) [-355.128] * (-358.236) (-356.437) [-358.467] (-355.777) -- 0:00:47
      230000 -- (-356.544) (-357.100) (-356.597) [-356.415] * (-355.588) (-356.746) (-358.004) [-356.036] -- 0:00:46

      Average standard deviation of split frequencies: 0.013539

      230500 -- (-357.021) [-357.982] (-357.230) (-356.190) * (-358.119) (-355.689) (-359.973) [-354.265] -- 0:00:46
      231000 -- [-356.290] (-355.790) (-359.093) (-356.390) * (-355.793) (-356.172) (-358.734) [-355.138] -- 0:00:46
      231500 -- (-364.056) [-354.565] (-358.522) (-356.716) * (-356.166) (-355.367) [-355.852] (-356.379) -- 0:00:46
      232000 -- [-356.891] (-355.004) (-356.309) (-359.274) * [-354.453] (-359.372) (-357.838) (-356.759) -- 0:00:46
      232500 -- [-358.817] (-362.018) (-356.398) (-355.165) * [-358.012] (-356.427) (-358.792) (-355.730) -- 0:00:46
      233000 -- (-361.038) (-357.991) (-357.401) [-355.484] * (-355.766) (-358.038) (-362.806) [-355.098] -- 0:00:46
      233500 -- (-356.171) (-358.056) (-356.763) [-355.648] * [-357.433] (-356.687) (-357.110) (-355.134) -- 0:00:45
      234000 -- (-356.178) [-355.607] (-356.956) (-356.284) * (-357.782) [-355.749] (-356.299) (-356.463) -- 0:00:45
      234500 -- (-358.573) [-356.558] (-354.885) (-358.210) * (-358.151) (-355.804) [-355.970] (-357.067) -- 0:00:45
      235000 -- (-363.483) (-354.889) [-355.767] (-355.930) * (-355.769) (-357.801) (-354.585) [-355.888] -- 0:00:45

      Average standard deviation of split frequencies: 0.014731

      235500 -- (-357.214) (-357.968) (-368.994) [-356.446] * (-357.285) (-354.968) (-355.617) [-354.886] -- 0:00:45
      236000 -- [-354.683] (-358.728) (-355.359) (-355.057) * (-357.599) (-355.759) (-355.310) [-354.794] -- 0:00:45
      236500 -- (-360.009) (-354.443) [-356.696] (-356.901) * (-355.678) (-354.746) [-355.482] (-357.455) -- 0:00:45
      237000 -- (-359.619) (-355.248) [-357.487] (-357.197) * (-355.549) [-354.200] (-360.061) (-354.438) -- 0:00:45
      237500 -- (-354.188) (-356.536) [-357.186] (-355.267) * (-359.934) (-356.605) (-357.122) [-357.446] -- 0:00:44
      238000 -- (-356.683) (-355.580) [-355.532] (-355.483) * (-360.043) [-356.490] (-357.198) (-358.357) -- 0:00:44
      238500 -- (-356.470) [-356.251] (-355.504) (-355.663) * (-356.077) (-356.068) (-357.067) [-356.038] -- 0:00:44
      239000 -- (-356.275) (-357.289) [-356.747] (-355.616) * (-356.280) [-355.605] (-357.273) (-354.915) -- 0:00:44
      239500 -- (-355.389) [-357.866] (-356.752) (-357.725) * [-355.175] (-357.911) (-354.987) (-356.171) -- 0:00:44
      240000 -- (-355.171) (-359.907) (-356.298) [-358.267] * (-356.332) (-359.753) (-354.297) [-355.633] -- 0:00:44

      Average standard deviation of split frequencies: 0.013344

      240500 -- (-354.570) [-359.424] (-355.310) (-358.897) * (-355.483) [-357.785] (-355.527) (-355.424) -- 0:00:44
      241000 -- [-355.295] (-354.337) (-356.630) (-357.459) * [-355.122] (-356.893) (-355.806) (-358.543) -- 0:00:44
      241500 -- (-355.357) (-357.209) (-357.702) [-358.753] * (-356.471) [-355.105] (-354.967) (-357.183) -- 0:00:43
      242000 -- [-356.196] (-355.835) (-358.869) (-357.404) * (-355.124) [-356.742] (-357.777) (-355.874) -- 0:00:43
      242500 -- (-359.677) (-354.947) [-357.789] (-360.455) * [-355.460] (-359.183) (-357.146) (-354.466) -- 0:00:43
      243000 -- (-357.892) (-355.594) [-355.860] (-358.871) * (-354.609) (-355.390) [-354.263] (-355.114) -- 0:00:43
      243500 -- (-356.606) (-355.727) [-355.174] (-359.564) * (-358.939) (-355.054) (-356.310) [-356.874] -- 0:00:46
      244000 -- (-355.130) [-354.893] (-356.679) (-355.489) * (-355.407) (-355.883) [-354.516] (-355.237) -- 0:00:46
      244500 -- (-356.152) (-355.969) (-355.750) [-356.186] * (-363.957) (-356.592) [-356.769] (-357.066) -- 0:00:46
      245000 -- [-357.346] (-357.909) (-355.300) (-357.860) * (-360.682) [-355.500] (-355.377) (-355.057) -- 0:00:46

      Average standard deviation of split frequencies: 0.014252

      245500 -- [-355.013] (-359.904) (-357.707) (-356.442) * (-358.020) (-364.531) (-355.065) [-357.941] -- 0:00:46
      246000 -- (-357.414) (-356.070) [-355.244] (-355.921) * (-355.730) (-361.109) (-357.362) [-356.929] -- 0:00:45
      246500 -- (-359.460) (-359.766) [-354.835] (-355.767) * (-357.661) (-360.751) (-362.070) [-356.939] -- 0:00:45
      247000 -- (-361.285) (-360.078) (-356.223) [-357.566] * (-355.937) (-354.861) [-358.551] (-358.525) -- 0:00:45
      247500 -- (-354.678) (-355.436) [-355.756] (-354.874) * (-361.976) (-355.167) (-355.850) [-358.139] -- 0:00:45
      248000 -- [-354.296] (-356.660) (-357.344) (-355.509) * (-357.158) (-355.261) (-356.209) [-354.750] -- 0:00:45
      248500 -- (-355.937) [-355.221] (-357.149) (-354.698) * (-363.340) (-360.195) [-355.894] (-354.880) -- 0:00:45
      249000 -- [-356.882] (-356.728) (-354.806) (-357.677) * [-356.730] (-358.258) (-357.218) (-355.354) -- 0:00:45
      249500 -- (-361.241) (-357.641) (-355.242) [-357.005] * (-358.055) (-355.854) [-356.963] (-356.726) -- 0:00:45
      250000 -- [-363.799] (-354.933) (-360.674) (-355.310) * (-354.651) [-356.443] (-354.947) (-356.086) -- 0:00:45

      Average standard deviation of split frequencies: 0.014340

      250500 -- (-355.392) (-355.565) (-358.280) [-358.678] * [-355.764] (-356.491) (-354.520) (-359.452) -- 0:00:44
      251000 -- [-358.437] (-360.482) (-357.676) (-357.644) * (-356.664) [-355.097] (-354.367) (-356.340) -- 0:00:44
      251500 -- (-359.792) (-355.831) (-354.845) [-356.817] * [-358.792] (-356.912) (-355.781) (-354.175) -- 0:00:44
      252000 -- (-361.318) (-356.467) [-356.383] (-357.291) * (-354.960) [-357.697] (-358.503) (-354.708) -- 0:00:44
      252500 -- (-358.068) (-355.607) [-356.848] (-362.193) * [-356.637] (-363.203) (-354.839) (-358.881) -- 0:00:44
      253000 -- [-356.677] (-356.454) (-355.383) (-359.495) * [-355.705] (-356.572) (-354.360) (-360.830) -- 0:00:44
      253500 -- (-355.900) (-358.258) (-354.950) [-358.641] * (-355.432) [-355.498] (-354.522) (-356.325) -- 0:00:44
      254000 -- [-355.324] (-358.540) (-357.653) (-357.677) * (-357.850) (-355.963) [-358.276] (-357.593) -- 0:00:44
      254500 -- (-359.243) [-355.442] (-355.395) (-362.349) * [-358.737] (-356.771) (-359.525) (-355.855) -- 0:00:43
      255000 -- [-357.452] (-355.080) (-362.118) (-358.037) * (-360.834) (-354.376) (-361.256) [-357.702] -- 0:00:43

      Average standard deviation of split frequencies: 0.012890

      255500 -- [-354.690] (-356.926) (-360.228) (-363.014) * (-359.828) [-357.692] (-355.772) (-355.791) -- 0:00:43
      256000 -- (-354.794) (-356.750) [-354.829] (-357.528) * (-358.303) [-355.630] (-358.545) (-358.193) -- 0:00:43
      256500 -- [-356.233] (-354.824) (-357.035) (-356.853) * (-356.932) (-355.319) [-361.542] (-355.193) -- 0:00:43
      257000 -- (-356.815) (-355.124) (-358.532) [-355.568] * (-357.441) [-357.188] (-356.171) (-354.450) -- 0:00:43
      257500 -- (-358.787) (-355.572) (-356.804) [-356.972] * (-355.260) [-355.303] (-355.455) (-355.185) -- 0:00:43
      258000 -- (-354.926) (-356.562) [-355.347] (-355.780) * [-355.726] (-358.535) (-355.418) (-355.133) -- 0:00:43
      258500 -- [-356.107] (-354.954) (-357.158) (-356.709) * (-356.867) (-354.668) (-354.770) [-357.917] -- 0:00:43
      259000 -- (-356.727) [-357.044] (-355.033) (-365.662) * [-356.974] (-356.259) (-358.922) (-355.735) -- 0:00:42
      259500 -- [-354.366] (-356.412) (-357.578) (-359.820) * (-356.903) [-356.058] (-355.688) (-355.506) -- 0:00:42
      260000 -- [-357.898] (-356.259) (-355.478) (-361.413) * (-357.884) [-358.443] (-356.111) (-356.526) -- 0:00:42

      Average standard deviation of split frequencies: 0.010964

      260500 -- (-359.844) (-358.000) [-355.370] (-358.358) * [-356.734] (-359.588) (-356.833) (-355.015) -- 0:00:42
      261000 -- (-357.076) (-356.330) (-356.710) [-357.334] * (-358.695) (-355.741) (-359.374) [-354.947] -- 0:00:45
      261500 -- (-358.331) (-355.380) (-356.934) [-357.278] * (-355.294) (-356.302) (-355.152) [-358.585] -- 0:00:45
      262000 -- [-357.796] (-354.458) (-357.112) (-355.153) * (-358.013) (-357.028) [-354.720] (-355.590) -- 0:00:45
      262500 -- (-360.075) (-358.497) (-354.374) [-355.037] * (-356.593) [-354.671] (-355.091) (-357.705) -- 0:00:44
      263000 -- (-362.170) [-357.080] (-355.812) (-354.795) * (-356.270) [-355.296] (-358.897) (-356.087) -- 0:00:44
      263500 -- (-358.114) (-357.860) (-355.249) [-354.716] * (-356.919) [-356.483] (-357.986) (-358.587) -- 0:00:44
      264000 -- (-359.205) (-355.194) [-357.521] (-358.123) * (-356.518) (-355.879) [-354.581] (-357.503) -- 0:00:44
      264500 -- (-359.625) (-356.942) [-355.677] (-357.826) * (-356.112) [-356.065] (-354.758) (-355.952) -- 0:00:44
      265000 -- (-359.473) (-355.288) [-355.342] (-356.111) * (-358.807) (-359.388) [-356.116] (-354.563) -- 0:00:44

      Average standard deviation of split frequencies: 0.011741

      265500 -- (-356.585) (-360.182) (-356.708) [-355.048] * (-356.466) (-355.805) [-355.755] (-356.123) -- 0:00:44
      266000 -- (-358.590) (-356.555) [-354.711] (-354.182) * (-355.458) (-356.627) (-361.158) [-355.752] -- 0:00:44
      266500 -- (-357.097) [-356.072] (-356.149) (-357.324) * (-356.630) (-356.245) [-357.634] (-360.327) -- 0:00:44
      267000 -- [-355.222] (-356.915) (-359.830) (-358.848) * (-357.992) (-354.357) (-359.855) [-354.955] -- 0:00:43
      267500 -- (-361.826) (-354.424) (-357.580) [-359.743] * (-354.590) (-355.285) (-357.346) [-357.243] -- 0:00:43
      268000 -- (-357.999) [-355.665] (-356.046) (-355.439) * (-356.865) (-356.637) (-358.942) [-356.997] -- 0:00:43
      268500 -- [-357.984] (-355.922) (-359.968) (-355.584) * (-355.681) (-359.552) [-356.362] (-358.474) -- 0:00:43
      269000 -- (-359.758) [-356.650] (-356.792) (-355.981) * (-357.868) (-363.538) (-359.539) [-358.002] -- 0:00:43
      269500 -- (-355.815) [-355.167] (-360.981) (-354.766) * [-355.090] (-358.710) (-355.606) (-358.990) -- 0:00:43
      270000 -- (-356.254) [-356.885] (-358.115) (-356.874) * (-355.618) (-358.910) (-357.743) [-355.556] -- 0:00:43

      Average standard deviation of split frequencies: 0.011756

      270500 -- [-356.182] (-354.740) (-356.687) (-356.246) * (-356.353) (-358.598) [-356.796] (-355.305) -- 0:00:43
      271000 -- (-354.922) (-359.197) [-356.616] (-355.635) * [-355.429] (-356.951) (-355.829) (-358.009) -- 0:00:43
      271500 -- [-357.804] (-359.165) (-355.113) (-357.903) * [-355.442] (-354.777) (-355.118) (-357.749) -- 0:00:42
      272000 -- [-355.205] (-357.394) (-359.157) (-355.834) * (-357.484) (-355.718) [-354.876] (-357.718) -- 0:00:42
      272500 -- (-355.845) (-359.725) [-359.107] (-355.610) * [-357.489] (-356.283) (-356.899) (-356.185) -- 0:00:42
      273000 -- (-356.366) (-358.021) (-356.814) [-355.210] * (-356.560) (-354.214) [-355.880] (-357.044) -- 0:00:42
      273500 -- [-355.491] (-357.607) (-356.765) (-354.660) * (-355.477) (-355.492) (-359.350) [-356.337] -- 0:00:42
      274000 -- (-354.788) (-357.798) (-355.438) [-362.548] * (-358.077) (-354.905) [-356.949] (-354.871) -- 0:00:42
      274500 -- (-354.849) (-359.773) [-356.095] (-359.031) * (-358.709) (-356.662) [-355.176] (-357.218) -- 0:00:42
      275000 -- [-355.006] (-354.485) (-357.655) (-354.793) * (-360.770) (-358.695) [-355.773] (-355.121) -- 0:00:42

      Average standard deviation of split frequencies: 0.011209

      275500 -- [-356.993] (-355.595) (-356.430) (-356.294) * [-357.578] (-358.584) (-355.011) (-358.018) -- 0:00:42
      276000 -- (-358.108) [-356.710] (-356.794) (-357.567) * (-356.685) (-358.531) [-356.057] (-357.920) -- 0:00:41
      276500 -- [-357.765] (-355.774) (-357.164) (-359.758) * (-356.362) (-356.569) [-356.817] (-355.943) -- 0:00:41
      277000 -- (-354.811) (-357.586) [-354.705] (-356.442) * [-356.113] (-356.711) (-357.431) (-357.073) -- 0:00:41
      277500 -- (-356.053) (-356.440) [-354.262] (-357.363) * (-362.114) (-355.155) [-357.092] (-357.131) -- 0:00:41
      278000 -- (-355.730) (-354.862) [-356.156] (-354.643) * (-357.557) [-360.489] (-354.879) (-358.228) -- 0:00:44
      278500 -- (-356.338) (-356.443) (-355.237) [-358.836] * (-356.708) [-356.913] (-355.319) (-356.480) -- 0:00:44
      279000 -- (-357.696) (-356.361) (-357.167) [-356.103] * (-359.540) (-355.582) (-355.522) [-356.008] -- 0:00:43
      279500 -- (-361.590) (-357.199) [-355.631] (-357.971) * (-356.222) (-361.253) [-358.464] (-355.759) -- 0:00:43
      280000 -- (-359.743) (-356.867) (-355.173) [-356.901] * (-355.924) (-354.593) [-362.031] (-355.925) -- 0:00:43

      Average standard deviation of split frequencies: 0.010707

      280500 -- (-357.526) (-355.269) (-356.017) [-356.708] * (-356.426) (-354.811) (-359.701) [-356.689] -- 0:00:43
      281000 -- [-355.896] (-355.619) (-357.160) (-360.501) * (-356.413) [-355.474] (-360.114) (-354.622) -- 0:00:43
      281500 -- (-359.166) [-355.130] (-357.722) (-356.802) * (-357.106) [-356.708] (-363.111) (-358.611) -- 0:00:43
      282000 -- [-355.362] (-358.275) (-357.583) (-357.290) * (-357.724) (-357.328) (-357.798) [-356.614] -- 0:00:43
      282500 -- (-357.231) (-358.478) [-357.032] (-356.993) * [-357.369] (-355.841) (-358.304) (-356.834) -- 0:00:43
      283000 -- (-355.012) [-356.715] (-356.821) (-356.770) * (-354.872) [-355.098] (-355.302) (-356.085) -- 0:00:43
      283500 -- (-357.981) (-355.080) [-356.744] (-362.891) * [-356.501] (-357.702) (-355.765) (-357.612) -- 0:00:42
      284000 -- (-357.030) (-359.055) (-356.057) [-355.495] * (-354.104) (-360.097) (-356.677) [-356.131] -- 0:00:42
      284500 -- (-356.812) (-354.764) [-355.418] (-358.352) * (-356.261) (-356.279) (-356.092) [-359.632] -- 0:00:42
      285000 -- (-356.115) (-355.555) [-355.924] (-354.756) * [-357.625] (-357.252) (-358.077) (-356.865) -- 0:00:42

      Average standard deviation of split frequencies: 0.009890

      285500 -- (-358.264) [-356.604] (-357.985) (-354.864) * (-357.737) [-356.363] (-358.811) (-359.249) -- 0:00:42
      286000 -- [-356.410] (-355.548) (-356.470) (-354.309) * [-362.266] (-356.347) (-358.929) (-356.964) -- 0:00:42
      286500 -- (-356.114) [-356.228] (-354.595) (-358.467) * [-358.325] (-358.161) (-361.020) (-356.443) -- 0:00:42
      287000 -- (-361.589) (-355.259) [-356.419] (-355.459) * (-355.167) (-359.261) (-356.720) [-357.473] -- 0:00:42
      287500 -- (-358.627) (-356.568) (-355.843) [-355.258] * (-358.272) [-359.800] (-355.979) (-361.201) -- 0:00:42
      288000 -- (-357.738) [-356.585] (-356.156) (-357.004) * (-356.117) [-355.605] (-358.394) (-356.224) -- 0:00:42
      288500 -- (-356.549) [-356.072] (-360.484) (-358.703) * (-355.685) (-356.025) (-354.791) [-354.533] -- 0:00:41
      289000 -- (-354.976) [-355.954] (-355.627) (-355.118) * (-355.256) (-358.151) (-360.010) [-354.674] -- 0:00:41
      289500 -- [-356.955] (-358.135) (-355.775) (-355.331) * (-356.868) [-356.434] (-355.002) (-354.755) -- 0:00:41
      290000 -- [-357.119] (-357.625) (-357.068) (-355.934) * (-356.370) (-354.954) (-355.824) [-354.647] -- 0:00:41

      Average standard deviation of split frequencies: 0.010542

      290500 -- (-357.511) (-358.754) (-358.039) [-358.241] * (-358.289) [-355.407] (-355.228) (-360.878) -- 0:00:41
      291000 -- (-356.530) (-356.427) (-355.537) [-356.650] * [-356.170] (-359.161) (-356.254) (-358.846) -- 0:00:41
      291500 -- (-357.295) (-354.902) [-356.545] (-356.699) * [-354.441] (-356.972) (-354.750) (-355.846) -- 0:00:41
      292000 -- (-355.836) (-358.097) (-356.755) [-354.959] * [-355.125] (-359.007) (-355.582) (-356.226) -- 0:00:41
      292500 -- [-357.566] (-359.394) (-359.085) (-355.654) * (-356.610) (-364.483) [-355.890] (-357.579) -- 0:00:41
      293000 -- (-355.507) [-355.526] (-358.923) (-355.872) * (-357.765) (-355.292) (-355.258) [-356.913] -- 0:00:41
      293500 -- (-357.527) (-355.034) (-356.073) [-358.872] * [-356.007] (-357.095) (-356.840) (-355.786) -- 0:00:40
      294000 -- [-357.088] (-355.874) (-355.575) (-356.001) * (-356.511) (-357.536) [-362.355] (-357.123) -- 0:00:40
      294500 -- [-356.637] (-357.100) (-354.440) (-356.952) * (-359.005) (-357.840) [-355.836] (-356.143) -- 0:00:40
      295000 -- (-354.288) (-358.870) [-356.052] (-356.839) * (-357.550) [-358.071] (-355.916) (-359.468) -- 0:00:40

      Average standard deviation of split frequencies: 0.010949

      295500 -- [-354.632] (-356.019) (-357.893) (-355.368) * (-354.784) (-357.864) [-358.271] (-357.238) -- 0:00:42
      296000 -- [-354.795] (-355.816) (-357.308) (-357.172) * (-357.375) (-356.838) (-355.529) [-361.928] -- 0:00:42
      296500 -- [-355.122] (-355.582) (-364.151) (-360.119) * (-358.387) [-355.371] (-355.142) (-357.922) -- 0:00:42
      297000 -- (-356.675) [-355.662] (-356.520) (-357.417) * (-355.287) [-356.410] (-356.814) (-355.846) -- 0:00:42
      297500 -- (-356.512) [-355.852] (-355.973) (-364.786) * [-355.619] (-355.072) (-356.680) (-355.535) -- 0:00:42
      298000 -- (-354.122) (-356.930) (-356.480) [-357.374] * [-357.461] (-354.110) (-358.071) (-355.460) -- 0:00:42
      298500 -- (-354.796) (-356.269) (-357.198) [-357.215] * [-356.603] (-357.392) (-356.925) (-355.953) -- 0:00:42
      299000 -- (-358.769) [-356.110] (-360.403) (-356.742) * (-355.052) (-355.209) (-354.475) [-357.203] -- 0:00:42
      299500 -- [-356.014] (-356.245) (-356.670) (-354.453) * (-355.796) (-357.105) (-355.990) [-358.788] -- 0:00:42
      300000 -- [-356.828] (-356.297) (-355.314) (-354.846) * (-354.752) (-354.353) (-356.495) [-356.073] -- 0:00:42

      Average standard deviation of split frequencies: 0.012249

      300500 -- (-359.877) (-354.557) [-355.995] (-355.027) * (-357.690) (-355.139) (-360.551) [-354.178] -- 0:00:41
      301000 -- (-356.390) (-354.612) (-358.687) [-355.671] * (-357.032) [-354.142] (-355.463) (-354.432) -- 0:00:41
      301500 -- (-354.309) (-356.599) [-356.553] (-356.207) * (-354.932) [-354.099] (-357.682) (-355.677) -- 0:00:41
      302000 -- [-354.422] (-354.978) (-357.543) (-356.207) * (-355.319) (-356.786) (-357.725) [-355.832] -- 0:00:41
      302500 -- (-355.266) (-358.713) [-357.930] (-356.335) * [-355.085] (-357.646) (-358.492) (-354.777) -- 0:00:41
      303000 -- (-356.765) [-359.637] (-355.393) (-358.549) * (-354.360) [-355.747] (-357.958) (-355.427) -- 0:00:41
      303500 -- (-355.427) [-356.510] (-358.677) (-357.066) * [-354.718] (-358.014) (-355.553) (-358.100) -- 0:00:41
      304000 -- (-355.305) (-360.621) (-355.402) [-354.575] * (-355.057) [-356.048] (-356.078) (-357.000) -- 0:00:41
      304500 -- (-356.938) (-357.125) (-357.328) [-354.173] * (-355.950) (-356.862) [-355.694] (-357.116) -- 0:00:41
      305000 -- (-357.728) (-355.262) [-354.951] (-357.402) * [-354.801] (-358.396) (-354.962) (-356.106) -- 0:00:41

      Average standard deviation of split frequencies: 0.012517

      305500 -- [-358.675] (-354.733) (-357.611) (-355.236) * [-355.501] (-356.760) (-354.864) (-357.631) -- 0:00:40
      306000 -- (-359.834) [-356.002] (-357.327) (-355.116) * (-354.815) [-355.449] (-355.513) (-358.296) -- 0:00:40
      306500 -- [-358.701] (-356.377) (-356.396) (-364.060) * [-356.212] (-360.351) (-359.131) (-359.516) -- 0:00:40
      307000 -- [-355.041] (-355.160) (-357.250) (-355.490) * (-356.994) (-357.995) (-358.012) [-356.566] -- 0:00:40
      307500 -- (-358.989) (-357.932) [-357.360] (-357.427) * (-355.049) (-355.553) [-356.589] (-356.582) -- 0:00:40
      308000 -- [-357.528] (-362.856) (-357.929) (-356.236) * (-358.929) (-355.383) [-358.879] (-356.533) -- 0:00:40
      308500 -- (-357.417) (-361.804) (-356.885) [-357.078] * (-355.849) (-356.663) (-359.081) [-354.672] -- 0:00:40
      309000 -- (-355.023) [-356.787] (-356.839) (-356.612) * (-354.931) [-356.943] (-362.958) (-359.603) -- 0:00:40
      309500 -- (-355.429) (-356.646) [-355.841] (-357.851) * [-354.773] (-357.042) (-354.733) (-357.516) -- 0:00:40
      310000 -- (-356.416) (-357.951) [-355.448] (-356.964) * (-355.623) (-360.565) (-355.012) [-356.316] -- 0:00:40

      Average standard deviation of split frequencies: 0.012519

      310500 -- (-354.680) [-354.763] (-354.643) (-355.957) * (-355.347) (-358.592) (-359.401) [-360.987] -- 0:00:39
      311000 -- (-358.005) [-355.725] (-355.991) (-354.791) * [-356.373] (-357.523) (-358.832) (-359.100) -- 0:00:39
      311500 -- [-358.131] (-357.866) (-355.236) (-356.816) * (-356.268) (-356.136) (-354.579) [-355.839] -- 0:00:39
      312000 -- (-360.374) (-362.596) (-355.542) [-354.353] * (-359.107) (-356.400) (-355.371) [-356.394] -- 0:00:41
      312500 -- (-357.219) (-356.824) [-355.441] (-356.042) * (-358.288) (-361.088) [-355.188] (-356.888) -- 0:00:41
      313000 -- (-356.528) (-360.680) [-356.452] (-358.249) * [-355.112] (-358.815) (-358.716) (-356.205) -- 0:00:41
      313500 -- [-355.956] (-356.539) (-356.782) (-357.274) * (-357.041) [-356.752] (-358.583) (-357.266) -- 0:00:41
      314000 -- [-354.650] (-361.758) (-357.755) (-357.949) * (-359.196) [-359.701] (-357.708) (-356.969) -- 0:00:41
      314500 -- (-357.121) (-362.462) [-355.375] (-357.989) * (-360.051) (-359.415) (-358.194) [-358.374] -- 0:00:41
      315000 -- (-355.730) [-356.576] (-355.521) (-354.901) * (-356.615) [-358.301] (-360.022) (-355.492) -- 0:00:41

      Average standard deviation of split frequencies: 0.012494

      315500 -- (-356.599) (-358.212) [-355.584] (-357.355) * (-355.987) (-358.566) [-355.000] (-356.465) -- 0:00:41
      316000 -- (-355.808) [-354.686] (-358.743) (-356.702) * (-355.245) [-357.203] (-359.534) (-357.816) -- 0:00:41
      316500 -- [-355.741] (-359.698) (-357.107) (-361.964) * (-355.473) (-357.724) (-356.869) [-357.569] -- 0:00:41
      317000 -- (-357.495) [-360.358] (-358.785) (-357.861) * [-355.280] (-357.668) (-357.903) (-358.814) -- 0:00:40
      317500 -- (-358.029) (-357.454) (-358.285) [-354.320] * [-356.827] (-356.640) (-362.544) (-356.494) -- 0:00:40
      318000 -- (-355.429) [-355.662] (-355.507) (-355.700) * (-356.362) (-356.434) (-361.036) [-354.992] -- 0:00:40
      318500 -- (-357.104) [-355.449] (-359.541) (-359.394) * (-356.383) (-359.792) [-357.124] (-355.851) -- 0:00:40
      319000 -- [-356.505] (-358.104) (-359.249) (-360.417) * [-355.729] (-355.265) (-356.676) (-355.869) -- 0:00:40
      319500 -- (-355.645) (-357.303) [-355.999] (-356.537) * (-356.906) [-358.619] (-357.150) (-358.763) -- 0:00:40
      320000 -- [-356.723] (-356.074) (-358.038) (-354.658) * (-356.789) (-356.288) [-355.288] (-360.207) -- 0:00:40

      Average standard deviation of split frequencies: 0.012404

      320500 -- (-355.838) [-356.708] (-357.234) (-354.761) * [-354.706] (-356.218) (-354.424) (-357.244) -- 0:00:40
      321000 -- [-356.090] (-358.040) (-356.001) (-356.900) * (-356.341) (-355.996) (-357.103) [-358.480] -- 0:00:40
      321500 -- [-355.579] (-360.751) (-355.580) (-355.759) * [-358.670] (-355.615) (-357.744) (-356.584) -- 0:00:40
      322000 -- [-355.726] (-355.867) (-356.851) (-358.913) * (-355.396) (-357.573) (-357.566) [-356.392] -- 0:00:40
      322500 -- [-356.795] (-354.820) (-357.493) (-358.771) * (-355.724) (-357.923) (-357.106) [-358.034] -- 0:00:39
      323000 -- (-355.675) (-357.781) (-358.282) [-356.693] * (-355.176) (-354.130) (-356.428) [-355.281] -- 0:00:39
      323500 -- (-357.266) (-359.373) [-355.198] (-357.056) * [-354.986] (-356.178) (-359.691) (-355.605) -- 0:00:39
      324000 -- (-355.888) [-357.225] (-354.717) (-355.756) * (-355.012) (-360.737) [-355.727] (-355.662) -- 0:00:39
      324500 -- (-354.393) [-356.242] (-356.622) (-359.664) * (-355.210) (-359.096) (-355.003) [-356.554] -- 0:00:39
      325000 -- (-359.539) (-355.235) (-355.505) [-355.863] * (-357.072) [-360.516] (-355.432) (-355.084) -- 0:00:39

      Average standard deviation of split frequencies: 0.011659

      325500 -- (-359.968) [-354.232] (-356.430) (-358.096) * [-357.151] (-361.146) (-357.333) (-365.380) -- 0:00:39
      326000 -- (-355.731) (-356.337) (-354.866) [-358.670] * (-357.922) (-358.358) (-357.624) [-354.749] -- 0:00:39
      326500 -- (-357.567) [-356.792] (-355.663) (-359.298) * (-361.043) [-356.176] (-355.146) (-357.374) -- 0:00:39
      327000 -- (-360.041) (-356.812) [-356.903] (-360.091) * [-356.638] (-360.270) (-359.729) (-356.168) -- 0:00:39
      327500 -- (-358.388) (-358.029) [-356.697] (-354.494) * (-360.764) (-360.056) (-355.495) [-356.198] -- 0:00:39
      328000 -- (-357.970) [-356.248] (-355.723) (-356.383) * (-356.843) [-355.268] (-357.842) (-356.183) -- 0:00:38
      328500 -- [-355.397] (-355.297) (-355.193) (-356.583) * [-356.115] (-355.858) (-355.777) (-356.164) -- 0:00:38
      329000 -- [-355.075] (-355.112) (-357.016) (-356.752) * (-356.751) [-357.168] (-355.726) (-356.846) -- 0:00:38
      329500 -- [-355.308] (-356.298) (-355.364) (-355.479) * (-355.378) [-356.135] (-358.086) (-355.471) -- 0:00:40
      330000 -- (-355.142) [-355.227] (-355.754) (-358.570) * (-358.869) (-356.245) [-357.561] (-355.841) -- 0:00:40

      Average standard deviation of split frequencies: 0.010603

      330500 -- (-355.841) (-355.250) (-355.535) [-355.764] * [-358.744] (-355.502) (-355.261) (-356.291) -- 0:00:40
      331000 -- (-356.638) (-357.347) (-358.073) [-357.434] * (-357.250) (-355.941) (-355.397) [-358.780] -- 0:00:40
      331500 -- (-358.144) [-358.200] (-357.540) (-357.567) * (-358.372) [-355.634] (-357.949) (-355.996) -- 0:00:40
      332000 -- [-356.434] (-357.325) (-357.621) (-357.581) * (-359.884) [-356.730] (-354.983) (-358.492) -- 0:00:40
      332500 -- [-355.138] (-358.480) (-359.366) (-357.342) * (-357.004) [-354.912] (-357.469) (-355.466) -- 0:00:40
      333000 -- (-356.173) [-356.075] (-357.305) (-356.108) * [-356.483] (-355.567) (-355.741) (-356.856) -- 0:00:40
      333500 -- (-357.968) [-357.674] (-357.372) (-355.437) * (-355.135) (-358.210) (-358.348) [-357.681] -- 0:00:39
      334000 -- (-354.731) (-356.859) (-356.390) [-355.290] * (-354.827) (-356.271) (-359.101) [-357.124] -- 0:00:39
      334500 -- [-356.287] (-355.829) (-356.106) (-355.960) * [-354.244] (-355.588) (-356.137) (-354.325) -- 0:00:39
      335000 -- (-355.904) (-358.844) [-363.162] (-357.657) * (-357.120) (-354.746) [-354.943] (-356.461) -- 0:00:39

      Average standard deviation of split frequencies: 0.010961

      335500 -- (-356.632) [-355.355] (-357.808) (-356.576) * [-358.807] (-356.007) (-356.166) (-354.822) -- 0:00:39
      336000 -- (-356.401) (-356.826) (-355.825) [-356.439] * [-357.568] (-356.860) (-356.582) (-356.897) -- 0:00:39
      336500 -- (-356.301) (-355.160) [-354.517] (-355.746) * (-355.715) [-358.593] (-355.203) (-355.173) -- 0:00:39
      337000 -- (-356.104) (-354.535) [-354.638] (-357.451) * (-359.194) (-354.584) [-358.390] (-356.755) -- 0:00:39
      337500 -- (-355.760) (-356.323) (-354.353) [-354.805] * (-358.614) (-356.217) (-357.720) [-358.445] -- 0:00:39
      338000 -- (-356.807) (-358.987) [-356.109] (-355.429) * (-357.185) (-358.652) [-354.707] (-356.074) -- 0:00:39
      338500 -- (-356.447) (-356.712) (-357.454) [-357.747] * (-355.829) [-358.859] (-357.855) (-357.381) -- 0:00:39
      339000 -- (-357.953) (-356.475) (-357.071) [-355.930] * (-356.740) (-355.197) (-356.416) [-356.993] -- 0:00:38
      339500 -- [-354.998] (-355.230) (-359.539) (-358.405) * [-361.438] (-357.815) (-356.448) (-358.644) -- 0:00:38
      340000 -- (-355.676) (-354.142) [-356.241] (-356.813) * (-356.448) (-355.222) [-354.600] (-355.942) -- 0:00:38

      Average standard deviation of split frequencies: 0.010978

      340500 -- (-356.408) (-354.116) [-355.594] (-356.283) * (-361.255) [-354.885] (-357.097) (-355.424) -- 0:00:38
      341000 -- (-354.425) (-361.009) [-361.008] (-355.699) * (-357.794) (-355.680) [-355.221] (-355.332) -- 0:00:38
      341500 -- (-355.990) (-359.454) (-356.156) [-354.342] * (-356.654) [-356.976] (-356.117) (-355.795) -- 0:00:38
      342000 -- [-355.418] (-358.149) (-356.127) (-356.059) * (-355.991) (-362.806) (-354.691) [-355.159] -- 0:00:38
      342500 -- [-359.232] (-354.892) (-354.721) (-356.643) * (-354.300) (-358.180) [-358.451] (-355.919) -- 0:00:38
      343000 -- (-357.401) (-358.365) (-357.014) [-357.126] * [-354.398] (-356.577) (-356.221) (-359.653) -- 0:00:38
      343500 -- (-356.378) (-357.238) (-358.905) [-356.070] * (-356.882) [-358.008] (-355.466) (-355.236) -- 0:00:38
      344000 -- (-358.114) (-356.173) (-356.669) [-355.021] * (-354.304) [-357.349] (-354.501) (-355.475) -- 0:00:38
      344500 -- (-358.232) [-355.440] (-357.608) (-357.339) * (-355.535) (-356.364) (-355.236) [-355.273] -- 0:00:38
      345000 -- (-360.230) (-354.769) (-356.258) [-356.107] * (-357.478) (-357.471) (-356.274) [-355.726] -- 0:00:37

      Average standard deviation of split frequencies: 0.010173

      345500 -- (-357.642) (-354.514) [-357.364] (-356.528) * (-360.330) (-356.840) [-356.564] (-354.667) -- 0:00:37
      346000 -- (-358.864) (-356.287) (-358.412) [-358.380] * (-355.895) [-355.671] (-354.866) (-356.002) -- 0:00:37
      346500 -- [-355.233] (-360.701) (-355.790) (-355.986) * (-355.227) (-356.245) [-355.869] (-355.066) -- 0:00:37
      347000 -- [-355.406] (-355.512) (-355.379) (-359.223) * [-355.113] (-355.879) (-358.250) (-358.136) -- 0:00:39
      347500 -- [-360.078] (-356.681) (-354.992) (-356.706) * (-357.124) (-360.957) [-356.462] (-355.024) -- 0:00:39
      348000 -- (-355.812) [-356.182] (-355.187) (-356.124) * (-359.286) [-357.080] (-356.052) (-355.740) -- 0:00:39
      348500 -- (-355.027) (-362.765) (-356.446) [-356.828] * (-354.451) (-357.231) [-356.563] (-356.314) -- 0:00:39
      349000 -- (-357.213) [-356.248] (-357.066) (-358.165) * (-356.586) (-358.305) [-360.351] (-356.875) -- 0:00:39
      349500 -- (-359.032) (-357.210) (-356.694) [-356.352] * (-356.033) [-356.049] (-358.813) (-357.381) -- 0:00:39
      350000 -- (-355.727) (-358.534) (-357.428) [-354.548] * [-355.652] (-358.739) (-356.510) (-356.408) -- 0:00:39

      Average standard deviation of split frequencies: 0.010396

      350500 -- (-355.617) (-358.864) (-357.060) [-354.613] * (-355.573) (-355.475) [-355.827] (-356.269) -- 0:00:38
      351000 -- (-355.799) (-363.466) [-356.213] (-356.323) * [-355.775] (-360.525) (-355.328) (-357.522) -- 0:00:38
      351500 -- [-356.208] (-358.686) (-360.284) (-355.565) * (-356.802) (-363.195) [-355.690] (-359.506) -- 0:00:38
      352000 -- (-354.812) (-356.244) [-360.621] (-354.668) * (-357.230) [-358.253] (-355.616) (-355.020) -- 0:00:38
      352500 -- [-359.321] (-354.849) (-356.563) (-356.593) * (-355.802) (-354.524) (-360.766) [-355.627] -- 0:00:38
      353000 -- (-356.291) (-358.619) (-357.124) [-354.555] * (-356.807) [-357.317] (-356.454) (-357.930) -- 0:00:38
      353500 -- (-356.254) [-355.561] (-355.326) (-356.809) * (-356.657) [-356.746] (-358.787) (-355.037) -- 0:00:38
      354000 -- (-354.487) (-355.211) [-356.443] (-357.689) * (-354.245) [-355.537] (-355.414) (-354.825) -- 0:00:38
      354500 -- (-356.658) (-359.087) [-354.669] (-356.617) * [-356.992] (-354.819) (-354.489) (-357.888) -- 0:00:38
      355000 -- (-360.046) (-357.343) [-355.285] (-355.966) * (-357.207) (-355.511) (-355.440) [-355.265] -- 0:00:38

      Average standard deviation of split frequencies: 0.011476

      355500 -- [-357.847] (-358.113) (-356.158) (-357.977) * (-359.717) (-354.714) (-354.524) [-356.177] -- 0:00:38
      356000 -- (-356.771) (-355.890) [-359.998] (-356.023) * (-356.239) (-356.312) (-358.531) [-357.862] -- 0:00:37
      356500 -- (-355.083) [-355.352] (-357.180) (-356.643) * (-357.696) [-356.205] (-355.586) (-357.022) -- 0:00:37
      357000 -- [-355.310] (-358.453) (-357.253) (-357.672) * (-360.251) [-354.944] (-355.607) (-356.606) -- 0:00:37
      357500 -- [-357.179] (-355.844) (-359.204) (-360.781) * (-356.816) (-356.769) (-357.560) [-356.036] -- 0:00:37
      358000 -- [-356.374] (-357.331) (-357.528) (-357.555) * (-357.603) [-357.899] (-356.765) (-357.114) -- 0:00:37
      358500 -- [-355.687] (-355.724) (-360.295) (-360.462) * (-357.611) [-355.153] (-357.222) (-355.822) -- 0:00:37
      359000 -- [-355.848] (-357.561) (-358.225) (-357.014) * [-358.096] (-355.231) (-356.780) (-356.623) -- 0:00:37
      359500 -- (-357.080) [-358.377] (-355.226) (-358.570) * [-356.149] (-361.536) (-355.965) (-360.108) -- 0:00:37
      360000 -- [-359.430] (-354.985) (-355.358) (-355.182) * (-356.625) (-356.911) (-359.853) [-358.498] -- 0:00:37

      Average standard deviation of split frequencies: 0.011502

      360500 -- (-356.576) [-357.324] (-356.082) (-357.595) * (-355.909) (-355.829) (-355.689) [-355.818] -- 0:00:37
      361000 -- (-359.709) (-355.775) (-357.853) [-355.359] * (-363.280) (-354.553) (-358.772) [-355.998] -- 0:00:37
      361500 -- [-357.177] (-356.631) (-356.911) (-355.964) * (-359.015) (-360.275) [-354.877] (-356.854) -- 0:00:37
      362000 -- (-357.747) (-357.999) (-356.451) [-355.903] * (-356.511) (-357.352) (-358.707) [-355.322] -- 0:00:37
      362500 -- (-355.517) (-355.350) (-360.501) [-356.356] * (-355.405) (-354.783) [-360.778] (-360.599) -- 0:00:36
      363000 -- (-354.575) (-354.770) [-357.687] (-355.504) * (-355.337) (-356.471) [-356.969] (-356.334) -- 0:00:36
      363500 -- (-357.957) (-357.662) (-354.598) [-355.085] * (-355.763) (-355.957) (-356.103) [-356.037] -- 0:00:36
      364000 -- (-357.484) (-360.282) (-356.471) [-355.835] * (-356.721) [-358.599] (-355.464) (-357.637) -- 0:00:38
      364500 -- (-357.426) [-356.874] (-356.230) (-358.349) * (-356.455) (-356.409) [-357.097] (-355.932) -- 0:00:38
      365000 -- (-357.812) (-358.849) [-354.670] (-356.960) * (-354.637) [-354.351] (-358.933) (-356.729) -- 0:00:38

      Average standard deviation of split frequencies: 0.010787

      365500 -- (-355.143) [-358.334] (-355.314) (-356.029) * (-356.931) (-354.615) [-358.086] (-357.910) -- 0:00:38
      366000 -- (-358.110) (-365.318) [-355.779] (-357.757) * (-355.123) [-355.551] (-357.289) (-355.178) -- 0:00:38
      366500 -- (-360.504) (-360.825) (-359.402) [-357.257] * (-354.329) [-356.249] (-356.294) (-361.667) -- 0:00:38
      367000 -- (-358.705) (-355.314) (-357.511) [-357.433] * (-356.480) [-354.666] (-355.084) (-356.488) -- 0:00:37
      367500 -- (-354.163) (-357.807) [-355.736] (-355.069) * (-360.060) [-355.308] (-358.881) (-358.217) -- 0:00:37
      368000 -- (-354.958) (-356.469) [-356.306] (-356.723) * [-355.125] (-354.812) (-355.554) (-356.435) -- 0:00:37
      368500 -- (-362.543) (-355.128) [-360.381] (-357.561) * (-358.963) (-357.156) [-356.493] (-355.186) -- 0:00:37
      369000 -- (-355.765) (-356.163) [-354.861] (-354.830) * (-358.813) (-354.178) [-356.416] (-358.500) -- 0:00:37
      369500 -- (-356.280) (-356.885) [-355.272] (-357.717) * (-356.960) [-357.203] (-354.425) (-362.920) -- 0:00:37
      370000 -- (-356.476) [-354.452] (-356.132) (-356.739) * (-355.815) [-355.637] (-357.109) (-358.566) -- 0:00:37

      Average standard deviation of split frequencies: 0.010731

      370500 -- (-356.145) [-358.313] (-354.956) (-356.987) * [-354.920] (-360.107) (-357.720) (-355.648) -- 0:00:37
      371000 -- (-355.715) [-355.654] (-360.256) (-357.187) * [-357.336] (-354.793) (-355.905) (-355.371) -- 0:00:37
      371500 -- [-360.727] (-355.892) (-355.671) (-355.490) * (-358.922) [-354.198] (-356.502) (-356.425) -- 0:00:37
      372000 -- (-356.678) (-355.520) [-361.416] (-358.089) * (-357.381) (-355.468) (-355.187) [-355.047] -- 0:00:37
      372500 -- (-356.344) [-354.418] (-360.547) (-362.397) * (-359.149) (-354.536) (-356.370) [-356.696] -- 0:00:37
      373000 -- (-356.633) (-355.011) [-354.628] (-359.067) * (-355.659) (-356.929) [-356.743] (-357.255) -- 0:00:36
      373500 -- (-358.884) (-360.831) (-357.056) [-355.376] * (-355.636) (-357.931) (-357.188) [-357.996] -- 0:00:36
      374000 -- [-355.224] (-356.204) (-359.247) (-356.045) * (-358.828) [-358.182] (-355.648) (-356.153) -- 0:00:36
      374500 -- (-354.742) [-355.303] (-358.206) (-355.940) * (-358.037) [-355.654] (-357.316) (-359.371) -- 0:00:36
      375000 -- (-354.768) [-358.351] (-357.199) (-354.558) * (-356.184) [-354.390] (-356.653) (-354.985) -- 0:00:36

      Average standard deviation of split frequencies: 0.010892

      375500 -- (-357.018) (-358.143) (-358.082) [-355.259] * (-359.173) (-355.656) [-357.585] (-355.810) -- 0:00:36
      376000 -- [-354.156] (-354.316) (-359.591) (-356.130) * [-355.746] (-355.517) (-360.435) (-355.357) -- 0:00:36
      376500 -- [-355.466] (-354.891) (-360.223) (-355.417) * (-355.727) [-357.179] (-355.700) (-358.243) -- 0:00:36
      377000 -- (-355.596) (-355.913) (-361.076) [-354.612] * (-358.700) (-355.035) [-354.933] (-355.473) -- 0:00:36
      377500 -- [-355.891] (-355.807) (-358.966) (-358.915) * (-355.547) (-355.489) [-354.349] (-354.370) -- 0:00:36
      378000 -- (-360.747) (-360.386) (-358.228) [-356.116] * [-358.348] (-356.742) (-357.324) (-355.650) -- 0:00:36
      378500 -- (-358.119) [-356.616] (-356.546) (-355.880) * (-361.936) (-356.808) (-357.457) [-358.663] -- 0:00:36
      379000 -- (-356.751) [-356.918] (-358.105) (-356.781) * (-356.677) (-355.307) [-355.418] (-359.669) -- 0:00:36
      379500 -- (-360.693) (-355.770) [-355.418] (-356.869) * [-355.805] (-357.469) (-356.100) (-357.713) -- 0:00:35
      380000 -- (-361.632) (-357.113) (-356.667) [-357.522] * (-357.542) (-354.420) [-355.774] (-360.018) -- 0:00:35

      Average standard deviation of split frequencies: 0.011764

      380500 -- (-359.159) (-355.236) [-359.792] (-354.607) * (-356.971) [-361.116] (-357.523) (-354.593) -- 0:00:35
      381000 -- (-356.170) [-358.065] (-355.672) (-360.650) * (-356.439) (-357.127) (-356.562) [-355.161] -- 0:00:35
      381500 -- (-355.813) (-359.598) [-354.574] (-356.253) * (-354.769) (-356.716) [-357.145] (-355.964) -- 0:00:37
      382000 -- (-354.724) (-358.804) [-355.657] (-355.635) * (-354.831) (-360.993) [-355.874] (-357.992) -- 0:00:37
      382500 -- (-355.914) [-354.757] (-357.686) (-359.129) * (-354.464) (-357.971) [-358.190] (-355.755) -- 0:00:37
      383000 -- (-355.535) (-357.183) (-355.735) [-356.513] * (-354.464) (-358.465) [-355.262] (-356.866) -- 0:00:37
      383500 -- (-358.696) [-357.090] (-356.093) (-355.440) * [-357.182] (-354.845) (-356.482) (-356.090) -- 0:00:36
      384000 -- [-354.737] (-355.806) (-355.636) (-358.966) * [-356.723] (-357.968) (-357.684) (-356.119) -- 0:00:36
      384500 -- [-355.167] (-357.954) (-355.171) (-356.840) * (-356.471) (-355.897) [-354.569] (-357.621) -- 0:00:36
      385000 -- (-355.671) (-354.575) [-355.234] (-356.277) * [-357.471] (-355.284) (-357.611) (-354.261) -- 0:00:36

      Average standard deviation of split frequencies: 0.010839

      385500 -- [-355.236] (-354.790) (-356.131) (-355.101) * (-361.375) (-356.835) (-355.318) [-357.749] -- 0:00:36
      386000 -- [-356.177] (-356.019) (-355.648) (-354.783) * (-356.885) (-356.805) [-354.683] (-355.593) -- 0:00:36
      386500 -- (-354.605) (-356.770) (-356.559) [-355.249] * [-355.929] (-358.104) (-356.535) (-356.540) -- 0:00:36
      387000 -- (-360.169) (-354.557) (-355.259) [-358.166] * (-356.171) [-357.266] (-359.489) (-358.522) -- 0:00:36
      387500 -- (-359.805) [-357.772] (-360.601) (-355.791) * [-358.196] (-355.831) (-362.483) (-355.920) -- 0:00:36
      388000 -- (-355.722) (-355.043) (-363.442) [-357.196] * [-355.628] (-357.557) (-358.725) (-354.702) -- 0:00:36
      388500 -- (-355.632) [-355.146] (-355.260) (-357.178) * (-359.673) (-358.804) (-355.769) [-354.970] -- 0:00:36
      389000 -- [-354.853] (-357.572) (-355.810) (-356.208) * [-358.556] (-354.541) (-357.919) (-356.438) -- 0:00:36
      389500 -- (-355.136) (-356.579) [-357.813] (-354.712) * (-356.389) (-357.619) [-356.151] (-358.589) -- 0:00:36
      390000 -- (-356.206) (-357.157) (-357.649) [-355.183] * (-355.228) (-360.130) [-356.416] (-358.223) -- 0:00:35

      Average standard deviation of split frequencies: 0.011825

      390500 -- (-355.127) (-355.909) [-355.200] (-356.818) * (-358.969) (-360.743) [-354.611] (-356.564) -- 0:00:35
      391000 -- (-357.552) (-355.376) (-355.748) [-357.879] * (-356.976) (-359.122) (-355.969) [-357.205] -- 0:00:35
      391500 -- [-363.088] (-354.406) (-354.838) (-357.334) * (-356.164) (-354.684) [-355.207] (-359.712) -- 0:00:35
      392000 -- (-354.711) (-358.552) [-357.423] (-358.614) * [-357.059] (-355.712) (-356.695) (-357.713) -- 0:00:35
      392500 -- (-356.282) (-360.298) [-354.969] (-354.182) * [-356.621] (-354.303) (-358.655) (-355.183) -- 0:00:35
      393000 -- (-357.671) (-355.368) [-357.846] (-354.833) * [-358.080] (-354.447) (-357.518) (-355.545) -- 0:00:35
      393500 -- (-354.482) [-355.024] (-358.873) (-355.257) * (-354.628) (-355.978) (-359.019) [-358.461] -- 0:00:35
      394000 -- (-355.617) (-357.411) (-356.756) [-357.915] * (-360.014) (-355.973) [-356.654] (-356.815) -- 0:00:35
      394500 -- (-355.954) (-355.897) (-355.545) [-355.999] * (-358.308) [-354.541] (-355.254) (-357.178) -- 0:00:35
      395000 -- (-363.872) (-356.896) [-355.334] (-355.869) * (-360.866) [-354.678] (-359.218) (-360.798) -- 0:00:35

      Average standard deviation of split frequencies: 0.012460

      395500 -- (-357.321) (-356.962) (-356.068) [-355.719] * [-358.100] (-355.182) (-360.468) (-357.252) -- 0:00:35
      396000 -- (-356.671) [-355.056] (-359.738) (-354.603) * (-355.388) (-357.391) (-357.778) [-359.399] -- 0:00:35
      396500 -- (-358.136) (-356.229) (-356.320) [-359.356] * [-355.713] (-356.981) (-355.575) (-357.784) -- 0:00:35
      397000 -- (-358.526) [-357.306] (-355.307) (-356.075) * (-354.690) (-359.167) (-357.385) [-357.540] -- 0:00:34
      397500 -- (-362.407) (-356.062) (-357.971) [-358.286] * [-355.920] (-357.420) (-354.967) (-355.191) -- 0:00:34
      398000 -- (-356.848) (-356.458) (-356.649) [-355.170] * (-358.739) [-354.617] (-357.295) (-355.704) -- 0:00:34
      398500 -- (-356.311) (-355.710) [-355.924] (-355.848) * (-359.663) [-356.091] (-355.763) (-359.316) -- 0:00:34
      399000 -- (-355.508) [-356.191] (-359.691) (-355.320) * (-356.674) (-359.070) [-358.852] (-360.589) -- 0:00:36
      399500 -- (-357.475) (-360.246) (-356.672) [-355.285] * (-355.820) (-356.646) (-356.925) [-356.144] -- 0:00:36
      400000 -- [-356.444] (-357.581) (-355.513) (-355.897) * (-355.161) (-360.827) (-356.588) [-355.799] -- 0:00:36

      Average standard deviation of split frequencies: 0.012795

      400500 -- [-354.516] (-356.092) (-355.726) (-359.746) * (-355.059) (-361.422) (-357.073) [-356.498] -- 0:00:35
      401000 -- (-354.849) (-354.675) [-356.064] (-355.364) * (-358.477) [-354.341] (-356.290) (-356.071) -- 0:00:35
      401500 -- (-358.885) [-355.508] (-356.371) (-357.858) * (-358.925) [-358.850] (-356.245) (-355.713) -- 0:00:35
      402000 -- (-358.290) [-354.987] (-356.777) (-358.656) * (-358.191) (-354.873) [-356.310] (-356.948) -- 0:00:35
      402500 -- (-355.299) (-354.307) (-356.543) [-355.784] * (-362.482) (-354.773) (-356.440) [-354.677] -- 0:00:35
      403000 -- (-357.685) [-355.566] (-355.714) (-356.357) * (-357.452) [-354.811] (-363.022) (-355.526) -- 0:00:35
      403500 -- (-356.194) [-354.956] (-354.155) (-356.998) * (-357.712) [-354.598] (-360.343) (-354.248) -- 0:00:35
      404000 -- (-356.581) (-356.652) [-354.231] (-359.823) * [-357.588] (-355.891) (-358.545) (-355.926) -- 0:00:35
      404500 -- (-356.849) [-356.078] (-357.437) (-355.794) * (-354.850) (-355.193) (-356.775) [-358.687] -- 0:00:35
      405000 -- (-355.791) [-356.209] (-357.750) (-356.029) * [-357.115] (-356.814) (-356.825) (-357.342) -- 0:00:35

      Average standard deviation of split frequencies: 0.012046

      405500 -- (-356.658) (-355.185) (-356.579) [-358.062] * (-357.557) [-356.338] (-357.335) (-355.036) -- 0:00:35
      406000 -- [-355.448] (-355.039) (-356.373) (-360.079) * [-357.817] (-355.764) (-357.861) (-356.860) -- 0:00:35
      406500 -- [-357.886] (-354.616) (-354.942) (-358.123) * (-356.094) [-355.559] (-355.772) (-358.758) -- 0:00:35
      407000 -- (-363.255) (-354.498) [-355.240] (-359.184) * (-358.045) (-356.568) [-356.793] (-354.907) -- 0:00:34
      407500 -- (-360.450) [-356.896] (-357.463) (-355.256) * [-360.561] (-356.843) (-356.802) (-355.085) -- 0:00:34
      408000 -- (-357.434) (-356.443) (-357.567) [-356.686] * (-354.835) (-357.319) (-355.055) [-354.015] -- 0:00:34
      408500 -- (-357.310) (-354.700) (-356.523) [-357.237] * (-358.406) (-355.881) (-354.948) [-356.290] -- 0:00:34
      409000 -- (-360.546) (-358.923) [-356.209] (-357.419) * (-360.151) (-357.121) [-358.354] (-356.366) -- 0:00:34
      409500 -- (-358.847) [-354.741] (-355.057) (-357.173) * (-356.527) (-357.244) (-357.823) [-357.003] -- 0:00:34
      410000 -- (-356.741) [-354.642] (-361.049) (-355.317) * (-356.984) (-356.818) (-357.507) [-354.959] -- 0:00:34

      Average standard deviation of split frequencies: 0.011336

      410500 -- (-360.085) (-356.746) [-356.297] (-356.277) * [-356.133] (-359.808) (-359.989) (-358.216) -- 0:00:34
      411000 -- (-357.894) [-358.591] (-355.925) (-359.703) * (-355.260) [-357.175] (-356.294) (-357.138) -- 0:00:34
      411500 -- (-356.447) (-361.834) [-356.740] (-354.525) * (-355.591) (-355.970) (-355.566) [-356.784] -- 0:00:34
      412000 -- (-354.629) [-358.805] (-356.694) (-355.007) * (-356.015) (-356.976) [-356.450] (-361.516) -- 0:00:34
      412500 -- (-357.063) (-358.150) [-354.861] (-355.407) * [-357.055] (-361.402) (-356.327) (-355.848) -- 0:00:34
      413000 -- (-363.020) (-357.386) [-358.134] (-358.127) * (-358.547) (-354.998) (-355.147) [-355.868] -- 0:00:34
      413500 -- [-359.138] (-358.115) (-356.914) (-355.607) * [-357.090] (-356.259) (-356.098) (-354.645) -- 0:00:34
      414000 -- (-355.407) [-355.893] (-356.525) (-354.486) * (-357.288) (-358.555) [-355.899] (-356.853) -- 0:00:33
      414500 -- (-356.012) [-356.898] (-355.975) (-355.885) * [-354.545] (-355.596) (-356.168) (-362.125) -- 0:00:33
      415000 -- [-354.884] (-358.715) (-356.397) (-355.445) * (-357.787) [-356.389] (-359.556) (-356.557) -- 0:00:33

      Average standard deviation of split frequencies: 0.011181

      415500 -- [-355.935] (-355.459) (-356.481) (-359.392) * (-356.671) (-354.314) [-356.463] (-354.739) -- 0:00:33
      416000 -- (-355.073) (-356.114) [-355.882] (-356.901) * (-359.880) (-357.904) (-362.351) [-355.565] -- 0:00:35
      416500 -- (-357.698) [-356.159] (-354.936) (-359.439) * [-355.057] (-357.811) (-355.278) (-355.593) -- 0:00:35
      417000 -- (-358.036) (-357.173) [-356.946] (-354.356) * (-355.155) (-355.689) [-354.631] (-356.311) -- 0:00:34
      417500 -- (-355.772) [-355.641] (-359.148) (-356.127) * (-356.543) (-357.402) [-354.959] (-354.517) -- 0:00:34
      418000 -- (-356.758) (-361.774) [-355.127] (-355.522) * (-362.417) [-355.381] (-355.947) (-358.089) -- 0:00:34
      418500 -- (-356.406) (-360.898) [-355.139] (-354.373) * (-358.960) (-356.030) (-356.087) [-355.232] -- 0:00:34
      419000 -- (-354.865) (-357.427) [-356.934] (-355.026) * (-356.015) (-356.623) (-356.252) [-359.264] -- 0:00:34
      419500 -- (-357.565) (-360.164) (-355.825) [-356.897] * (-356.067) [-355.544] (-355.387) (-358.065) -- 0:00:34
      420000 -- (-355.008) (-364.571) [-356.870] (-355.074) * [-354.597] (-360.166) (-356.703) (-354.567) -- 0:00:34

      Average standard deviation of split frequencies: 0.010907

      420500 -- (-357.046) (-354.433) (-355.019) [-358.104] * [-357.582] (-355.651) (-363.027) (-356.845) -- 0:00:34
      421000 -- [-357.054] (-356.734) (-356.114) (-355.972) * (-360.161) (-356.216) (-356.363) [-358.735] -- 0:00:34
      421500 -- (-358.112) (-357.361) (-355.470) [-355.321] * (-360.596) (-354.438) [-355.359] (-361.211) -- 0:00:34
      422000 -- (-355.902) (-356.534) (-360.239) [-355.142] * (-356.469) [-355.595] (-355.813) (-355.954) -- 0:00:34
      422500 -- (-356.562) (-356.064) [-354.943] (-356.754) * [-355.903] (-355.739) (-357.487) (-356.985) -- 0:00:34
      423000 -- (-355.737) (-359.853) [-355.015] (-357.551) * [-358.797] (-356.382) (-355.370) (-356.410) -- 0:00:34
      423500 -- [-357.483] (-357.816) (-357.591) (-359.427) * [-357.686] (-357.523) (-354.597) (-356.565) -- 0:00:34
      424000 -- [-356.803] (-362.009) (-355.293) (-358.649) * (-355.346) (-355.784) [-354.107] (-357.156) -- 0:00:33
      424500 -- [-356.987] (-355.886) (-356.893) (-357.977) * [-355.520] (-357.793) (-354.715) (-359.425) -- 0:00:33
      425000 -- (-355.175) (-356.014) (-356.364) [-356.261] * (-354.429) [-355.648] (-354.570) (-361.514) -- 0:00:33

      Average standard deviation of split frequencies: 0.010720

      425500 -- (-356.360) [-355.770] (-355.362) (-355.831) * [-354.900] (-357.218) (-355.132) (-359.286) -- 0:00:33
      426000 -- [-358.634] (-360.861) (-357.340) (-356.212) * (-354.853) [-355.421] (-355.534) (-357.190) -- 0:00:33
      426500 -- (-355.250) (-355.451) [-355.771] (-355.553) * (-354.535) [-355.074] (-357.407) (-355.826) -- 0:00:33
      427000 -- (-356.455) [-357.886] (-356.601) (-355.939) * (-357.163) [-355.274] (-360.438) (-355.970) -- 0:00:33
      427500 -- (-358.488) (-358.279) (-356.949) [-357.679] * (-359.642) [-358.615] (-357.006) (-355.343) -- 0:00:33
      428000 -- (-355.204) [-358.396] (-356.181) (-356.365) * [-357.342] (-360.689) (-356.194) (-355.814) -- 0:00:33
      428500 -- (-355.117) [-359.033] (-357.816) (-358.161) * [-355.438] (-356.658) (-357.219) (-355.417) -- 0:00:33
      429000 -- (-354.495) [-355.547] (-356.106) (-362.905) * (-355.295) [-355.199] (-357.056) (-355.219) -- 0:00:33
      429500 -- (-355.105) (-357.401) (-360.766) [-356.795] * [-355.416] (-356.656) (-358.574) (-355.774) -- 0:00:33
      430000 -- (-354.988) (-354.805) (-357.146) [-356.276] * (-357.714) (-355.893) [-356.941] (-360.118) -- 0:00:33

      Average standard deviation of split frequencies: 0.010672

      430500 -- [-356.028] (-357.088) (-356.836) (-359.208) * (-355.705) (-357.911) [-357.396] (-356.205) -- 0:00:33
      431000 -- (-358.623) (-355.424) [-355.330] (-356.582) * [-356.137] (-356.140) (-354.755) (-359.429) -- 0:00:33
      431500 -- (-356.116) [-355.182] (-355.052) (-356.627) * (-357.355) (-355.449) [-359.494] (-355.894) -- 0:00:32
      432000 -- [-357.313] (-356.591) (-357.582) (-354.750) * (-358.438) (-357.360) [-359.081] (-355.436) -- 0:00:32
      432500 -- (-354.631) [-354.201] (-357.655) (-357.241) * (-356.076) (-359.145) [-355.486] (-355.143) -- 0:00:32
      433000 -- (-358.572) (-354.326) [-358.389] (-355.619) * [-359.262] (-364.818) (-356.131) (-357.639) -- 0:00:32
      433500 -- (-357.592) [-354.228] (-359.458) (-358.153) * [-355.343] (-357.599) (-354.354) (-357.356) -- 0:00:33
      434000 -- (-361.663) [-358.510] (-354.901) (-357.515) * (-355.926) (-354.691) (-357.399) [-356.216] -- 0:00:33
      434500 -- (-355.454) [-356.264] (-356.841) (-355.778) * [-357.555] (-358.266) (-355.947) (-357.288) -- 0:00:33
      435000 -- (-355.908) [-356.970] (-357.332) (-357.317) * (-354.538) [-356.916] (-357.181) (-357.206) -- 0:00:33

      Average standard deviation of split frequencies: 0.011015

      435500 -- [-356.298] (-358.963) (-356.953) (-355.773) * (-356.778) (-368.876) (-355.482) [-356.654] -- 0:00:33
      436000 -- (-356.527) [-357.268] (-359.046) (-356.473) * (-356.404) (-367.127) [-355.562] (-354.172) -- 0:00:33
      436500 -- (-355.215) (-355.455) (-357.050) [-358.284] * (-356.963) [-356.707] (-356.125) (-354.704) -- 0:00:33
      437000 -- (-357.562) (-356.412) [-358.257] (-356.050) * (-355.806) (-357.326) [-355.328] (-361.108) -- 0:00:33
      437500 -- (-359.462) [-359.408] (-357.970) (-354.382) * (-354.792) [-355.429] (-358.398) (-359.211) -- 0:00:33
      438000 -- (-361.206) (-359.487) (-356.065) [-356.148] * (-355.573) [-357.314] (-357.854) (-359.933) -- 0:00:33
      438500 -- (-355.661) (-356.036) (-354.942) [-354.664] * (-355.433) (-355.663) (-356.847) [-357.093] -- 0:00:33
      439000 -- (-356.609) (-354.695) [-356.819] (-356.442) * (-356.711) (-355.322) [-358.097] (-356.607) -- 0:00:33
      439500 -- (-359.935) (-355.325) [-356.173] (-355.931) * [-355.520] (-356.705) (-358.552) (-357.036) -- 0:00:33
      440000 -- [-357.628] (-355.605) (-354.743) (-355.789) * (-355.940) [-356.909] (-356.748) (-355.817) -- 0:00:33

      Average standard deviation of split frequencies: 0.010698

      440500 -- [-355.360] (-355.237) (-354.141) (-355.999) * [-360.180] (-356.093) (-356.883) (-355.700) -- 0:00:33
      441000 -- [-355.269] (-355.608) (-355.395) (-356.542) * (-354.935) (-355.726) [-356.055] (-354.480) -- 0:00:32
      441500 -- [-354.888] (-355.195) (-357.243) (-355.316) * (-355.943) (-359.911) [-354.773] (-357.411) -- 0:00:32
      442000 -- (-355.883) (-356.310) [-356.261] (-355.661) * (-354.721) (-355.389) [-355.615] (-356.381) -- 0:00:32
      442500 -- (-354.505) [-356.908] (-356.108) (-354.574) * (-358.004) (-355.082) [-359.520] (-357.162) -- 0:00:32
      443000 -- [-355.977] (-358.171) (-355.716) (-354.864) * (-359.843) (-354.269) [-356.844] (-363.835) -- 0:00:32
      443500 -- [-354.975] (-357.962) (-355.093) (-356.647) * (-356.224) [-358.001] (-356.051) (-358.121) -- 0:00:32
      444000 -- (-357.040) (-356.309) (-357.496) [-357.034] * [-356.186] (-358.259) (-355.764) (-358.073) -- 0:00:32
      444500 -- (-354.803) (-355.339) [-354.641] (-355.821) * (-355.977) [-356.969] (-357.109) (-358.369) -- 0:00:32
      445000 -- (-356.445) (-356.503) (-357.548) [-356.493] * (-359.699) (-356.945) [-356.647] (-355.091) -- 0:00:32

      Average standard deviation of split frequencies: 0.010768

      445500 -- [-356.671] (-355.220) (-357.238) (-355.245) * [-357.872] (-357.173) (-358.239) (-357.380) -- 0:00:32
      446000 -- (-355.346) (-356.238) (-354.754) [-354.676] * (-357.294) [-356.454] (-355.321) (-357.246) -- 0:00:32
      446500 -- (-362.491) (-356.915) (-355.190) [-356.749] * [-354.965] (-355.317) (-359.647) (-356.292) -- 0:00:32
      447000 -- (-356.818) (-357.249) (-355.694) [-355.103] * (-356.382) (-357.463) (-357.857) [-355.116] -- 0:00:32
      447500 -- [-355.883] (-356.521) (-358.106) (-359.506) * (-356.653) [-355.692] (-356.531) (-357.548) -- 0:00:32
      448000 -- (-356.419) (-358.009) (-357.825) [-356.627] * (-357.916) [-355.304] (-354.246) (-356.318) -- 0:00:32
      448500 -- [-354.821] (-357.391) (-355.735) (-358.843) * [-356.570] (-355.631) (-356.753) (-357.733) -- 0:00:31
      449000 -- (-358.502) (-355.580) (-360.561) [-355.509] * (-358.009) [-360.077] (-356.789) (-354.375) -- 0:00:31
      449500 -- (-357.128) [-354.428] (-360.521) (-355.848) * (-355.258) (-357.023) [-355.452] (-356.392) -- 0:00:31
      450000 -- [-357.207] (-357.468) (-356.715) (-358.430) * (-356.096) [-356.193] (-355.782) (-357.519) -- 0:00:31

      Average standard deviation of split frequencies: 0.010983

      450500 -- [-356.240] (-360.633) (-355.975) (-360.218) * [-356.797] (-357.186) (-355.225) (-356.829) -- 0:00:32
      451000 -- (-357.714) (-358.892) [-355.238] (-357.132) * (-356.280) (-357.891) [-355.963] (-356.962) -- 0:00:32
      451500 -- [-357.168] (-357.179) (-362.844) (-356.484) * (-355.527) (-356.089) [-355.463] (-356.622) -- 0:00:32
      452000 -- [-355.480] (-357.726) (-356.897) (-361.121) * (-356.293) (-361.233) (-355.023) [-355.375] -- 0:00:32
      452500 -- [-354.618] (-357.180) (-356.300) (-355.604) * (-355.786) (-361.629) [-355.960] (-355.351) -- 0:00:32
      453000 -- [-356.314] (-357.248) (-355.452) (-355.856) * (-356.212) (-356.651) [-359.265] (-354.695) -- 0:00:32
      453500 -- [-356.099] (-356.622) (-356.795) (-355.526) * (-354.913) (-356.635) [-356.116] (-354.965) -- 0:00:32
      454000 -- (-354.693) (-356.226) (-357.017) [-358.316] * (-356.080) (-355.362) (-357.174) [-354.760] -- 0:00:32
      454500 -- (-357.156) (-357.477) [-355.057] (-357.530) * (-358.761) (-358.552) [-356.266] (-355.548) -- 0:00:32
      455000 -- (-357.663) (-355.058) [-354.380] (-354.814) * (-357.077) (-354.653) [-355.517] (-354.886) -- 0:00:32

      Average standard deviation of split frequencies: 0.011630

      455500 -- (-358.353) (-357.897) [-355.695] (-357.980) * (-357.401) [-355.981] (-354.786) (-356.723) -- 0:00:32
      456000 -- (-357.137) (-357.077) (-358.222) [-357.129] * (-355.109) (-358.192) [-354.287] (-355.500) -- 0:00:32
      456500 -- [-355.304] (-355.916) (-354.772) (-355.296) * (-358.266) (-355.579) (-356.817) [-355.526] -- 0:00:32
      457000 -- (-363.336) (-355.218) (-355.561) [-354.884] * (-356.140) (-357.595) [-355.298] (-359.118) -- 0:00:32
      457500 -- (-359.215) [-355.479] (-357.172) (-356.951) * (-355.974) (-355.574) (-358.244) [-357.642] -- 0:00:32
      458000 -- (-355.368) [-360.168] (-354.899) (-354.796) * [-356.275] (-355.340) (-358.126) (-356.895) -- 0:00:31
      458500 -- [-355.952] (-354.448) (-356.230) (-357.505) * (-360.103) [-355.235] (-355.822) (-355.465) -- 0:00:31
      459000 -- (-355.087) [-357.029] (-355.293) (-359.388) * [-357.506] (-355.301) (-357.240) (-354.534) -- 0:00:31
      459500 -- (-357.257) (-354.921) [-355.829] (-355.236) * (-356.698) [-354.844] (-355.682) (-354.886) -- 0:00:31
      460000 -- (-357.858) (-355.692) (-357.662) [-354.211] * [-359.856] (-356.919) (-355.902) (-358.318) -- 0:00:31

      Average standard deviation of split frequencies: 0.011960

      460500 -- (-356.846) (-357.616) [-355.792] (-354.980) * (-356.432) [-356.161] (-356.594) (-356.343) -- 0:00:31
      461000 -- (-356.640) (-355.228) [-355.773] (-355.958) * (-356.519) (-356.787) [-355.501] (-358.346) -- 0:00:31
      461500 -- (-355.342) (-359.487) (-356.774) [-356.142] * (-355.519) (-354.930) (-355.597) [-355.981] -- 0:00:31
      462000 -- (-355.113) (-355.209) [-355.159] (-359.190) * [-356.601] (-355.905) (-355.856) (-354.628) -- 0:00:31
      462500 -- (-358.776) (-357.236) [-357.662] (-355.785) * [-357.498] (-357.704) (-357.608) (-354.312) -- 0:00:31
      463000 -- (-358.077) (-358.632) (-358.132) [-355.129] * (-359.391) (-358.948) (-355.748) [-354.976] -- 0:00:31
      463500 -- (-356.212) (-355.767) (-358.332) [-355.282] * (-358.665) (-356.382) (-358.408) [-355.780] -- 0:00:31
      464000 -- (-358.540) [-356.466] (-356.590) (-354.010) * [-358.622] (-354.925) (-360.365) (-355.647) -- 0:00:31
      464500 -- (-357.874) (-357.257) [-358.155] (-358.348) * (-359.436) (-354.802) (-355.978) [-356.391] -- 0:00:31
      465000 -- (-359.653) [-354.687] (-356.158) (-357.613) * (-355.257) [-356.256] (-356.557) (-359.395) -- 0:00:31

      Average standard deviation of split frequencies: 0.011901

      465500 -- (-354.514) (-355.022) [-354.642] (-355.210) * (-357.489) (-356.054) (-355.065) [-355.143] -- 0:00:31
      466000 -- (-355.695) (-356.136) [-354.952] (-354.919) * (-356.303) (-357.411) [-357.380] (-355.248) -- 0:00:30
      466500 -- (-357.995) (-354.205) (-357.982) [-355.682] * [-355.943] (-355.623) (-355.595) (-355.424) -- 0:00:30
      467000 -- [-356.169] (-359.464) (-357.674) (-355.937) * (-356.678) (-359.805) [-354.924] (-355.449) -- 0:00:30
      467500 -- (-355.956) (-356.784) [-355.432] (-362.489) * (-356.494) [-355.169] (-355.900) (-355.433) -- 0:00:30
      468000 -- (-356.040) [-358.149] (-357.175) (-362.534) * (-355.329) (-356.590) [-354.801] (-354.924) -- 0:00:31
      468500 -- (-355.252) [-355.478] (-356.055) (-356.650) * (-357.212) (-357.918) [-354.457] (-354.868) -- 0:00:31
      469000 -- [-357.822] (-357.310) (-356.772) (-356.156) * (-356.553) (-355.112) (-356.200) [-355.346] -- 0:00:31
      469500 -- [-354.807] (-354.978) (-356.408) (-354.772) * [-355.914] (-356.598) (-358.739) (-356.046) -- 0:00:31
      470000 -- (-355.291) (-356.655) [-356.423] (-357.600) * [-355.880] (-354.600) (-356.831) (-356.706) -- 0:00:31

      Average standard deviation of split frequencies: 0.012457

      470500 -- (-356.169) (-356.366) (-361.100) [-356.825] * (-357.089) [-355.486] (-358.368) (-356.464) -- 0:00:31
      471000 -- (-359.480) (-356.512) [-357.780] (-354.450) * (-356.513) [-356.198] (-355.316) (-358.008) -- 0:00:31
      471500 -- (-354.122) (-355.037) [-354.904] (-354.799) * [-362.279] (-359.011) (-355.364) (-356.800) -- 0:00:31
      472000 -- (-359.260) [-356.893] (-357.832) (-357.693) * [-358.445] (-354.372) (-357.295) (-355.151) -- 0:00:31
      472500 -- (-355.689) [-357.641] (-357.531) (-359.349) * (-355.459) (-356.630) [-358.637] (-355.901) -- 0:00:31
      473000 -- (-359.395) [-355.632] (-358.914) (-355.334) * (-358.194) (-355.836) (-357.361) [-357.556] -- 0:00:31
      473500 -- [-354.562] (-358.807) (-358.718) (-355.448) * (-362.579) (-356.179) (-354.592) [-355.445] -- 0:00:31
      474000 -- (-356.242) [-354.892] (-354.309) (-355.380) * (-355.755) (-356.750) (-355.103) [-356.263] -- 0:00:31
      474500 -- (-356.269) [-355.451] (-357.705) (-362.055) * [-355.215] (-358.546) (-354.945) (-354.522) -- 0:00:31
      475000 -- (-355.882) (-357.540) (-355.627) [-356.225] * (-354.333) (-359.575) (-357.145) [-355.506] -- 0:00:30

      Average standard deviation of split frequencies: 0.012256

      475500 -- (-356.288) (-357.014) (-356.626) [-356.766] * (-354.518) (-355.712) [-356.432] (-355.695) -- 0:00:30
      476000 -- (-356.772) (-357.871) [-354.739] (-358.709) * (-357.958) (-362.307) [-355.536] (-358.966) -- 0:00:30
      476500 -- (-362.057) [-355.358] (-355.452) (-356.918) * (-356.724) (-365.131) (-356.325) [-355.983] -- 0:00:30
      477000 -- [-357.547] (-358.047) (-355.485) (-358.047) * (-360.101) (-359.610) (-357.486) [-355.387] -- 0:00:30
      477500 -- [-360.000] (-360.023) (-355.640) (-360.281) * (-355.960) (-355.434) [-358.538] (-355.384) -- 0:00:30
      478000 -- (-358.066) [-361.441] (-355.964) (-357.545) * [-355.218] (-357.078) (-356.504) (-355.704) -- 0:00:30
      478500 -- (-356.930) (-354.810) (-357.907) [-355.497] * (-357.358) (-355.854) [-355.828] (-359.751) -- 0:00:30
      479000 -- (-354.347) (-355.489) (-357.947) [-356.567] * (-356.309) (-358.795) [-355.034] (-357.599) -- 0:00:30
      479500 -- (-357.486) [-357.738] (-360.723) (-357.542) * (-356.817) (-356.395) (-355.605) [-356.756] -- 0:00:30
      480000 -- (-363.046) (-357.519) [-357.999] (-355.590) * (-361.702) (-356.044) [-355.995] (-355.632) -- 0:00:30

      Average standard deviation of split frequencies: 0.012137

      480500 -- (-363.120) (-357.861) (-356.047) [-354.961] * (-354.894) [-354.327] (-356.118) (-356.479) -- 0:00:30
      481000 -- (-356.669) (-356.672) (-358.176) [-358.029] * [-357.809] (-355.774) (-357.344) (-356.886) -- 0:00:30
      481500 -- (-355.655) (-358.626) [-356.394] (-356.397) * (-361.031) [-355.828] (-357.251) (-358.866) -- 0:00:30
      482000 -- (-357.890) [-357.716] (-358.502) (-359.460) * (-354.860) [-357.698] (-356.059) (-357.396) -- 0:00:30
      482500 -- (-356.298) (-354.543) (-356.237) [-357.239] * (-356.199) (-355.508) (-356.515) [-357.287] -- 0:00:30
      483000 -- [-355.670] (-356.240) (-356.387) (-358.856) * [-356.370] (-359.962) (-357.729) (-358.045) -- 0:00:29
      483500 -- (-354.623) [-354.910] (-354.516) (-359.320) * (-356.071) (-356.640) (-358.172) [-356.044] -- 0:00:29
      484000 -- (-354.828) (-355.800) [-354.976] (-355.146) * (-357.516) (-358.550) (-355.121) [-355.351] -- 0:00:29
      484500 -- (-357.779) (-358.452) (-354.993) [-356.904] * (-359.718) (-357.170) (-354.648) [-355.155] -- 0:00:29
      485000 -- (-355.283) (-356.755) (-356.636) [-358.884] * (-356.333) (-356.856) (-354.253) [-358.107] -- 0:00:29

      Average standard deviation of split frequencies: 0.011821

      485500 -- (-357.409) [-356.145] (-355.831) (-357.943) * (-355.123) (-356.174) [-354.654] (-357.924) -- 0:00:30
      486000 -- (-355.897) (-358.436) [-358.161] (-359.726) * (-354.517) (-356.209) (-356.399) [-355.876] -- 0:00:30
      486500 -- [-354.832] (-356.328) (-354.733) (-357.181) * (-354.887) (-359.323) (-357.412) [-356.502] -- 0:00:30
      487000 -- (-357.518) (-357.997) (-359.318) [-355.029] * (-354.947) [-359.493] (-355.806) (-360.190) -- 0:00:30
      487500 -- (-354.293) (-357.416) [-360.504] (-360.036) * (-354.437) [-356.566] (-357.766) (-361.925) -- 0:00:30
      488000 -- (-354.823) (-356.657) [-359.393] (-357.343) * (-355.554) [-364.062] (-355.369) (-356.780) -- 0:00:30
      488500 -- (-357.513) [-355.243] (-361.518) (-354.883) * (-355.454) (-361.054) [-354.972] (-355.740) -- 0:00:30
      489000 -- (-357.287) (-355.364) [-359.693] (-363.208) * (-355.929) (-356.186) [-355.935] (-355.754) -- 0:00:30
      489500 -- (-361.236) (-356.062) [-358.906] (-358.534) * [-355.422] (-354.752) (-357.138) (-356.709) -- 0:00:30
      490000 -- (-354.483) (-354.977) [-357.474] (-356.854) * (-356.070) (-356.942) [-355.488] (-359.821) -- 0:00:30

      Average standard deviation of split frequencies: 0.011709

      490500 -- (-355.526) (-356.009) (-359.914) [-354.968] * (-356.687) (-355.624) [-357.164] (-356.899) -- 0:00:30
      491000 -- [-354.248] (-355.694) (-358.335) (-356.668) * (-358.108) [-358.660] (-355.337) (-355.411) -- 0:00:30
      491500 -- (-356.185) (-356.149) (-356.867) [-355.985] * (-358.345) (-360.706) (-355.977) [-354.912] -- 0:00:30
      492000 -- [-354.345] (-356.360) (-357.244) (-355.003) * (-358.177) (-354.987) [-356.511] (-355.948) -- 0:00:29
      492500 -- (-354.256) [-357.394] (-360.505) (-356.682) * (-357.090) [-355.603] (-359.740) (-355.076) -- 0:00:29
      493000 -- (-355.662) [-359.493] (-357.260) (-355.579) * [-356.174] (-354.671) (-358.984) (-357.514) -- 0:00:29
      493500 -- (-356.045) (-355.821) [-358.457] (-354.412) * [-354.494] (-355.869) (-354.923) (-355.409) -- 0:00:29
      494000 -- [-355.694] (-358.963) (-354.454) (-356.166) * [-356.329] (-358.688) (-356.576) (-359.657) -- 0:00:29
      494500 -- [-356.895] (-360.435) (-355.370) (-361.258) * (-357.802) (-356.850) [-357.437] (-359.958) -- 0:00:29
      495000 -- (-355.745) (-358.397) [-357.916] (-361.436) * (-360.029) (-354.976) [-357.690] (-355.560) -- 0:00:29

      Average standard deviation of split frequencies: 0.011293

      495500 -- (-358.112) [-355.016] (-358.737) (-358.175) * (-354.805) (-358.568) (-357.836) [-355.826] -- 0:00:29
      496000 -- (-362.051) (-354.645) (-357.519) [-358.383] * (-357.208) (-357.601) (-357.905) [-360.296] -- 0:00:29
      496500 -- [-357.403] (-354.256) (-355.868) (-357.804) * (-358.843) (-356.669) [-358.674] (-360.122) -- 0:00:29
      497000 -- (-355.040) [-354.187] (-356.495) (-356.252) * (-355.375) (-354.910) (-357.143) [-357.598] -- 0:00:29
      497500 -- (-356.687) [-356.871] (-356.145) (-361.588) * [-355.628] (-357.614) (-358.897) (-356.246) -- 0:00:29
      498000 -- (-355.448) (-356.949) (-354.690) [-356.109] * (-354.908) (-358.887) [-356.395] (-355.666) -- 0:00:29
      498500 -- [-356.252] (-355.157) (-358.049) (-354.506) * [-357.870] (-355.396) (-356.690) (-356.615) -- 0:00:29
      499000 -- (-354.815) (-359.044) [-355.598] (-355.140) * [-356.348] (-355.630) (-355.175) (-356.767) -- 0:00:29
      499500 -- [-355.733] (-356.560) (-356.597) (-355.720) * (-360.501) (-357.539) [-354.856] (-356.793) -- 0:00:29
      500000 -- (-354.587) [-361.829] (-356.196) (-355.377) * (-355.798) (-357.674) [-356.601] (-357.072) -- 0:00:29

      Average standard deviation of split frequencies: 0.011534

      500500 -- [-354.400] (-357.118) (-355.270) (-355.828) * (-359.049) [-354.940] (-356.130) (-356.590) -- 0:00:28
      501000 -- (-355.465) (-356.997) [-359.028] (-355.077) * [-355.143] (-355.406) (-357.735) (-356.023) -- 0:00:28
      501500 -- (-356.099) (-356.199) [-361.871] (-357.776) * (-360.795) (-357.032) (-359.782) [-356.196] -- 0:00:28
      502000 -- (-355.532) (-357.757) [-359.355] (-359.104) * (-357.966) (-354.759) [-354.635] (-358.713) -- 0:00:28
      502500 -- (-356.718) (-357.835) (-362.921) [-356.989] * (-361.528) (-361.728) (-358.859) [-355.888] -- 0:00:29
      503000 -- (-356.429) (-356.286) (-362.563) [-357.925] * (-354.189) (-355.536) (-357.731) [-355.812] -- 0:00:29
      503500 -- (-356.619) (-355.952) [-354.780] (-355.556) * (-355.243) (-360.200) (-356.120) [-358.113] -- 0:00:29
      504000 -- (-356.997) [-356.048] (-357.635) (-355.339) * (-356.099) (-358.872) [-355.413] (-354.519) -- 0:00:29
      504500 -- (-354.803) [-356.475] (-357.335) (-357.253) * (-356.533) (-358.507) (-356.750) [-354.829] -- 0:00:29
      505000 -- (-354.974) (-361.257) [-358.230] (-356.739) * (-358.199) (-358.355) (-358.539) [-359.196] -- 0:00:29

      Average standard deviation of split frequencies: 0.011471

      505500 -- [-358.069] (-355.655) (-357.118) (-356.261) * (-357.857) [-354.046] (-356.852) (-358.417) -- 0:00:29
      506000 -- (-355.751) [-354.835] (-355.518) (-361.449) * (-358.966) (-354.189) [-356.342] (-357.928) -- 0:00:29
      506500 -- (-356.043) [-355.660] (-354.889) (-356.695) * (-356.199) (-357.415) (-355.858) [-356.972] -- 0:00:29
      507000 -- (-356.053) [-359.802] (-356.863) (-357.025) * (-356.023) [-356.791] (-356.165) (-355.678) -- 0:00:29
      507500 -- (-357.602) (-358.476) (-355.726) [-356.959] * (-357.333) (-355.944) [-355.750] (-355.475) -- 0:00:29
      508000 -- (-358.879) (-358.125) (-356.428) [-357.249] * (-360.104) [-354.430] (-355.496) (-356.899) -- 0:00:29
      508500 -- (-359.190) (-356.319) [-354.895] (-354.841) * (-355.481) (-355.106) (-355.000) [-357.304] -- 0:00:28
      509000 -- [-354.903] (-357.751) (-359.114) (-358.338) * (-356.564) (-356.326) [-355.689] (-355.056) -- 0:00:28
      509500 -- (-359.563) [-356.585] (-354.674) (-355.907) * (-356.018) (-356.070) (-355.951) [-355.207] -- 0:00:28
      510000 -- [-355.411] (-354.853) (-355.602) (-356.395) * [-355.988] (-357.863) (-356.051) (-356.870) -- 0:00:28

      Average standard deviation of split frequencies: 0.011366

      510500 -- (-355.069) [-355.351] (-355.232) (-356.811) * [-358.694] (-358.637) (-357.651) (-357.312) -- 0:00:28
      511000 -- (-355.907) [-354.417] (-355.435) (-355.480) * (-359.012) (-356.035) (-354.897) [-356.470] -- 0:00:28
      511500 -- (-358.667) (-357.246) (-357.689) [-358.362] * [-357.959] (-356.601) (-363.686) (-355.555) -- 0:00:28
      512000 -- [-356.536] (-356.224) (-355.878) (-354.625) * (-359.597) (-358.434) [-363.790] (-355.240) -- 0:00:28
      512500 -- (-358.754) (-354.958) [-356.811] (-356.272) * [-359.321] (-356.488) (-355.886) (-356.189) -- 0:00:28
      513000 -- (-359.274) [-360.414] (-361.564) (-354.533) * (-357.037) (-355.161) (-357.080) [-355.818] -- 0:00:28
      513500 -- (-361.307) [-357.586] (-356.092) (-357.983) * [-356.104] (-355.840) (-355.469) (-359.438) -- 0:00:28
      514000 -- (-357.652) (-354.011) (-354.806) [-354.634] * (-356.273) (-358.602) (-357.988) [-355.736] -- 0:00:28
      514500 -- (-355.475) [-355.606] (-356.269) (-356.580) * (-355.804) [-355.810] (-356.664) (-355.358) -- 0:00:28
      515000 -- (-356.077) (-363.009) [-357.550] (-354.552) * (-356.899) (-355.928) [-356.179] (-355.483) -- 0:00:28

      Average standard deviation of split frequencies: 0.010392

      515500 -- (-356.299) [-360.214] (-355.046) (-354.522) * [-357.417] (-355.632) (-357.513) (-356.128) -- 0:00:28
      516000 -- (-357.897) [-358.411] (-355.779) (-357.632) * (-355.987) (-355.723) [-355.014] (-357.161) -- 0:00:28
      516500 -- (-355.480) (-357.175) (-354.532) [-355.193] * (-354.470) (-355.275) [-356.345] (-355.834) -- 0:00:28
      517000 -- [-354.543] (-356.281) (-354.647) (-355.119) * (-357.858) (-360.806) (-358.508) [-354.652] -- 0:00:28
      517500 -- (-355.453) (-356.589) [-357.317] (-356.434) * (-358.050) (-356.455) (-354.668) [-354.886] -- 0:00:27
      518000 -- (-354.826) [-356.246] (-355.874) (-356.796) * (-355.651) (-355.796) [-356.926] (-355.005) -- 0:00:27
      518500 -- (-355.400) (-354.608) (-355.439) [-355.514] * [-356.779] (-355.059) (-356.647) (-354.769) -- 0:00:27
      519000 -- (-357.044) [-356.481] (-355.183) (-355.952) * (-355.642) [-354.220] (-354.768) (-357.787) -- 0:00:27
      519500 -- (-357.903) (-357.995) [-355.360] (-357.513) * (-356.775) (-354.571) [-359.722] (-360.242) -- 0:00:27
      520000 -- [-356.864] (-355.853) (-357.552) (-358.941) * (-357.278) (-355.325) (-356.601) [-356.614] -- 0:00:28

      Average standard deviation of split frequencies: 0.009959

      520500 -- (-358.908) [-356.590] (-357.137) (-356.124) * (-358.466) [-359.184] (-357.319) (-360.852) -- 0:00:28
      521000 -- [-356.480] (-355.265) (-357.053) (-356.337) * (-361.540) (-354.821) [-357.276] (-354.780) -- 0:00:28
      521500 -- (-357.635) (-355.719) [-356.689] (-356.858) * (-354.649) [-354.605] (-358.089) (-355.843) -- 0:00:28
      522000 -- [-364.951] (-356.299) (-355.052) (-354.656) * (-356.412) (-355.974) (-360.373) [-355.017] -- 0:00:28
      522500 -- (-359.705) (-357.929) [-357.193] (-356.437) * [-356.906] (-356.131) (-359.616) (-358.371) -- 0:00:28
      523000 -- (-355.398) (-357.158) (-354.674) [-355.655] * (-358.133) (-355.184) [-357.248] (-355.454) -- 0:00:28
      523500 -- [-358.633] (-355.766) (-355.581) (-356.593) * (-356.675) (-355.373) (-354.889) [-355.185] -- 0:00:28
      524000 -- (-357.062) (-354.513) [-355.914] (-358.688) * [-355.385] (-355.144) (-358.337) (-354.225) -- 0:00:28
      524500 -- (-354.746) [-354.933] (-357.202) (-356.636) * (-355.764) [-354.785] (-355.554) (-355.225) -- 0:00:28
      525000 -- (-354.970) (-358.549) [-356.663] (-363.372) * (-356.751) (-356.375) (-355.395) [-354.581] -- 0:00:28

      Average standard deviation of split frequencies: 0.009354

      525500 -- [-354.945] (-358.946) (-357.067) (-357.023) * (-357.323) [-357.002] (-365.157) (-354.167) -- 0:00:27
      526000 -- (-356.281) (-355.391) (-355.942) [-356.716] * (-357.412) [-358.592] (-358.283) (-354.728) -- 0:00:27
      526500 -- (-357.092) [-355.678] (-354.628) (-356.565) * (-360.301) (-356.213) (-356.294) [-355.153] -- 0:00:27
      527000 -- [-358.163] (-355.382) (-354.160) (-356.426) * (-355.201) [-357.059] (-356.027) (-358.322) -- 0:00:27
      527500 -- (-355.711) (-359.455) [-357.971] (-358.079) * (-355.468) (-357.106) (-355.143) [-355.013] -- 0:00:27
      528000 -- (-358.855) [-357.349] (-355.055) (-354.547) * [-355.481] (-357.253) (-357.792) (-356.091) -- 0:00:27
      528500 -- (-355.106) [-356.846] (-355.840) (-354.999) * [-355.229] (-359.157) (-360.108) (-355.614) -- 0:00:27
      529000 -- (-356.068) (-355.662) (-355.815) [-356.700] * (-355.444) (-354.984) [-355.236] (-354.722) -- 0:00:27
      529500 -- [-357.235] (-355.775) (-361.542) (-354.835) * (-355.938) (-356.183) [-357.259] (-354.238) -- 0:00:27
      530000 -- (-357.879) [-356.894] (-358.458) (-355.918) * (-355.558) [-355.087] (-355.685) (-357.001) -- 0:00:27

      Average standard deviation of split frequencies: 0.009605

      530500 -- (-354.968) (-357.820) (-360.578) [-355.234] * (-356.785) (-357.721) [-355.276] (-354.627) -- 0:00:27
      531000 -- (-357.753) [-356.790] (-357.098) (-355.262) * [-354.844] (-356.357) (-357.004) (-355.496) -- 0:00:27
      531500 -- [-356.733] (-355.869) (-355.131) (-354.755) * (-356.118) (-354.739) (-355.972) [-355.187] -- 0:00:27
      532000 -- (-357.166) [-358.761] (-356.114) (-356.835) * [-355.819] (-355.491) (-357.960) (-357.226) -- 0:00:27
      532500 -- (-356.799) (-355.419) [-362.381] (-355.624) * (-355.936) (-355.369) (-354.696) [-354.693] -- 0:00:27
      533000 -- (-355.926) (-355.419) (-358.272) [-356.037] * [-358.251] (-355.461) (-355.014) (-357.578) -- 0:00:27
      533500 -- (-357.692) (-355.539) (-358.973) [-356.178] * [-361.134] (-356.695) (-357.528) (-356.676) -- 0:00:27
      534000 -- [-355.288] (-356.813) (-359.770) (-356.503) * [-356.096] (-356.413) (-358.103) (-356.996) -- 0:00:27
      534500 -- [-356.391] (-358.060) (-359.572) (-357.215) * (-355.397) (-355.326) (-354.975) [-359.196] -- 0:00:26
      535000 -- [-358.492] (-354.985) (-358.826) (-356.912) * (-355.853) [-356.354] (-358.592) (-356.903) -- 0:00:26

      Average standard deviation of split frequencies: 0.009205

      535500 -- (-355.135) (-355.100) (-357.410) [-358.148] * (-360.080) (-356.269) (-355.504) [-355.138] -- 0:00:27
      536000 -- (-359.661) (-355.378) [-358.141] (-356.720) * (-357.571) [-355.560] (-362.087) (-356.959) -- 0:00:27
      536500 -- (-359.622) (-354.508) (-356.843) [-354.636] * [-356.378] (-354.805) (-357.192) (-356.612) -- 0:00:27
      537000 -- [-357.707] (-355.390) (-355.624) (-355.496) * (-358.065) (-356.733) [-356.315] (-354.757) -- 0:00:27
      537500 -- (-355.083) (-355.769) [-357.529] (-355.115) * [-354.748] (-358.917) (-356.791) (-355.329) -- 0:00:27
      538000 -- (-355.184) (-359.566) [-355.744] (-355.303) * [-357.569] (-358.994) (-355.555) (-356.072) -- 0:00:27
      538500 -- [-359.016] (-355.164) (-356.323) (-358.800) * (-356.142) [-358.650] (-356.204) (-356.480) -- 0:00:27
      539000 -- (-357.161) (-355.174) (-360.443) [-355.077] * [-354.118] (-358.111) (-356.451) (-355.494) -- 0:00:27
      539500 -- [-354.353] (-354.898) (-357.760) (-357.845) * (-357.487) [-357.926] (-355.019) (-355.078) -- 0:00:27
      540000 -- (-356.930) (-354.943) [-359.669] (-359.734) * [-357.037] (-355.012) (-356.068) (-359.575) -- 0:00:27

      Average standard deviation of split frequencies: 0.008991

      540500 -- (-358.402) [-358.272] (-362.043) (-357.598) * [-354.797] (-358.414) (-354.539) (-358.704) -- 0:00:27
      541000 -- (-356.569) (-355.816) (-355.336) [-354.968] * (-354.243) [-356.638] (-354.602) (-355.877) -- 0:00:27
      541500 -- (-357.492) [-355.001] (-358.346) (-356.217) * [-357.410] (-358.920) (-357.602) (-356.650) -- 0:00:27
      542000 -- [-355.162] (-365.254) (-356.613) (-356.406) * [-356.600] (-356.913) (-354.985) (-358.859) -- 0:00:27
      542500 -- (-354.761) [-355.984] (-357.229) (-355.085) * (-355.286) (-355.416) (-355.133) [-356.172] -- 0:00:26
      543000 -- [-357.469] (-355.596) (-356.042) (-356.415) * (-355.158) (-354.827) [-358.224] (-356.001) -- 0:00:26
      543500 -- (-355.990) (-357.755) [-357.162] (-358.597) * [-354.986] (-355.629) (-355.383) (-362.073) -- 0:00:26
      544000 -- (-355.397) [-355.544] (-357.932) (-356.708) * [-354.439] (-355.195) (-355.600) (-354.242) -- 0:00:26
      544500 -- [-358.223] (-357.193) (-357.377) (-357.837) * (-356.347) (-357.019) (-356.944) [-355.919] -- 0:00:26
      545000 -- (-356.432) [-356.999] (-356.337) (-355.176) * (-356.995) (-357.527) (-355.532) [-357.857] -- 0:00:26

      Average standard deviation of split frequencies: 0.009497

      545500 -- (-356.306) (-356.395) (-358.060) [-356.056] * [-354.697] (-357.460) (-358.029) (-356.839) -- 0:00:26
      546000 -- [-357.110] (-355.843) (-359.627) (-354.964) * [-354.788] (-356.385) (-355.904) (-355.543) -- 0:00:26
      546500 -- [-357.511] (-356.543) (-358.072) (-354.976) * (-354.588) (-358.550) (-355.711) [-356.591] -- 0:00:26
      547000 -- (-360.913) (-356.730) [-357.724] (-357.379) * (-355.666) (-355.906) (-355.438) [-358.840] -- 0:00:26
      547500 -- (-358.591) (-356.762) [-357.261] (-358.101) * (-357.557) (-354.393) (-355.697) [-356.438] -- 0:00:26
      548000 -- [-355.375] (-355.663) (-356.492) (-362.656) * [-355.119] (-356.263) (-356.376) (-360.604) -- 0:00:26
      548500 -- (-365.451) [-357.649] (-356.652) (-357.670) * [-354.701] (-358.965) (-354.268) (-357.395) -- 0:00:26
      549000 -- (-355.711) [-354.588] (-359.384) (-357.766) * (-357.667) (-356.954) [-356.729] (-355.581) -- 0:00:26
      549500 -- (-355.329) [-356.107] (-355.616) (-354.040) * (-357.258) (-357.488) (-356.921) [-355.075] -- 0:00:26
      550000 -- (-354.933) [-354.986] (-355.944) (-356.786) * (-355.320) (-355.706) (-364.500) [-355.795] -- 0:00:26

      Average standard deviation of split frequencies: 0.009930

      550500 -- (-360.680) [-356.868] (-356.023) (-356.265) * (-354.527) [-356.362] (-354.934) (-357.072) -- 0:00:26
      551000 -- (-354.827) (-357.270) (-359.153) [-358.359] * (-355.378) (-357.759) (-355.406) [-355.924] -- 0:00:26
      551500 -- (-357.036) (-356.290) [-355.722] (-354.733) * [-354.850] (-360.361) (-354.885) (-354.506) -- 0:00:26
      552000 -- (-357.327) [-355.953] (-358.253) (-355.465) * (-358.530) (-354.080) [-357.390] (-356.528) -- 0:00:25
      552500 -- (-358.982) (-356.768) (-357.953) [-354.545] * (-354.640) (-357.632) (-356.461) [-356.843] -- 0:00:26
      553000 -- (-357.907) (-361.040) (-360.019) [-356.961] * (-357.948) (-358.091) (-355.275) [-355.899] -- 0:00:26
      553500 -- (-357.499) (-354.442) (-357.547) [-358.897] * (-355.944) [-359.471] (-355.897) (-359.331) -- 0:00:26
      554000 -- [-358.288] (-355.016) (-357.394) (-358.391) * [-356.113] (-360.918) (-359.714) (-355.737) -- 0:00:26
      554500 -- [-354.965] (-357.862) (-356.222) (-354.475) * (-358.518) (-359.618) [-357.818] (-355.721) -- 0:00:26
      555000 -- (-355.947) (-357.306) [-358.492] (-355.765) * (-357.830) (-356.009) (-355.638) [-356.077] -- 0:00:26

      Average standard deviation of split frequencies: 0.009892

      555500 -- [-356.870] (-355.163) (-356.282) (-355.721) * [-355.705] (-354.535) (-358.679) (-360.152) -- 0:00:26
      556000 -- (-354.950) (-356.631) (-355.711) [-355.217] * (-355.425) [-356.752] (-356.308) (-357.124) -- 0:00:26
      556500 -- (-356.348) (-357.076) [-355.129] (-355.714) * (-356.440) (-356.642) [-355.662] (-354.649) -- 0:00:26
      557000 -- (-358.743) (-356.769) (-356.663) [-358.382] * (-359.380) [-360.139] (-356.424) (-356.986) -- 0:00:26
      557500 -- (-356.176) [-354.811] (-355.443) (-356.978) * (-356.195) (-354.121) (-358.277) [-355.380] -- 0:00:26
      558000 -- (-359.289) (-356.076) (-355.084) [-355.331] * [-356.374] (-354.138) (-355.778) (-354.996) -- 0:00:26
      558500 -- [-355.876] (-355.441) (-355.963) (-354.836) * (-355.707) (-354.161) (-355.352) [-354.612] -- 0:00:26
      559000 -- (-356.740) (-358.759) [-355.927] (-358.658) * (-356.202) [-354.369] (-356.950) (-355.497) -- 0:00:26
      559500 -- (-356.030) [-357.069] (-356.199) (-355.398) * (-354.841) (-354.252) (-357.322) [-360.096] -- 0:00:25
      560000 -- (-355.255) [-358.113] (-356.892) (-355.173) * [-357.133] (-354.995) (-359.429) (-362.732) -- 0:00:25

      Average standard deviation of split frequencies: 0.010594

      560500 -- (-357.741) (-354.345) (-355.902) [-354.154] * (-356.052) (-358.910) [-357.457] (-358.904) -- 0:00:25
      561000 -- (-356.607) (-354.836) [-355.611] (-355.369) * (-355.501) (-358.412) [-355.642] (-360.074) -- 0:00:25
      561500 -- (-355.722) (-357.850) (-357.599) [-357.420] * [-357.008] (-357.810) (-357.030) (-360.143) -- 0:00:25
      562000 -- (-357.093) (-358.135) [-355.659] (-356.245) * (-358.514) (-356.948) [-356.134] (-356.505) -- 0:00:25
      562500 -- (-355.101) [-354.789] (-355.358) (-357.311) * (-356.957) [-357.917] (-355.611) (-354.516) -- 0:00:25
      563000 -- (-357.177) (-354.921) [-355.505] (-355.736) * (-359.178) (-359.320) (-355.684) [-355.743] -- 0:00:25
      563500 -- (-355.795) [-355.466] (-356.686) (-356.371) * [-356.470] (-360.290) (-355.417) (-357.753) -- 0:00:25
      564000 -- [-355.101] (-356.366) (-356.978) (-356.530) * [-355.737] (-354.674) (-357.293) (-354.705) -- 0:00:25
      564500 -- [-355.921] (-355.761) (-357.054) (-356.232) * [-355.225] (-355.392) (-356.185) (-355.239) -- 0:00:25
      565000 -- (-355.828) [-354.973] (-355.216) (-359.800) * (-356.185) [-356.081] (-356.504) (-356.453) -- 0:00:25

      Average standard deviation of split frequencies: 0.009474

      565500 -- (-357.815) [-359.488] (-356.235) (-360.074) * [-355.999] (-354.465) (-361.352) (-360.652) -- 0:00:25
      566000 -- (-356.112) [-356.075] (-355.996) (-358.151) * (-359.721) (-360.503) [-354.930] (-361.436) -- 0:00:25
      566500 -- (-358.196) (-357.427) [-356.735] (-354.599) * (-356.220) [-355.218] (-354.817) (-358.683) -- 0:00:25
      567000 -- [-363.425] (-357.350) (-357.143) (-357.053) * (-357.839) (-355.948) [-355.232] (-355.454) -- 0:00:25
      567500 -- (-360.135) (-355.835) [-355.808] (-356.026) * (-355.315) (-358.356) (-357.962) [-355.728] -- 0:00:25
      568000 -- [-356.519] (-357.034) (-356.192) (-356.834) * (-355.640) (-356.583) (-354.776) [-355.495] -- 0:00:25
      568500 -- (-355.299) [-358.048] (-356.601) (-356.743) * (-357.432) [-357.431] (-356.307) (-356.010) -- 0:00:25
      569000 -- (-355.551) (-358.584) (-356.179) [-356.952] * (-354.435) [-354.576] (-356.393) (-355.093) -- 0:00:24
      569500 -- [-355.811] (-357.891) (-359.192) (-358.751) * (-354.169) (-354.468) [-354.834] (-354.630) -- 0:00:24
      570000 -- (-356.725) (-362.837) [-355.439] (-355.897) * (-355.333) [-358.308] (-357.151) (-356.500) -- 0:00:25

      Average standard deviation of split frequencies: 0.009655

      570500 -- [-355.401] (-359.431) (-356.458) (-357.710) * (-359.075) (-355.942) [-356.279] (-361.432) -- 0:00:25
      571000 -- [-354.886] (-360.793) (-356.286) (-361.885) * (-361.852) (-362.397) (-354.961) [-355.900] -- 0:00:25
      571500 -- [-355.477] (-354.255) (-355.401) (-362.126) * (-362.256) (-355.746) (-356.137) [-356.094] -- 0:00:25
      572000 -- (-356.284) (-354.686) [-355.366] (-357.964) * [-356.306] (-360.406) (-360.460) (-355.573) -- 0:00:25
      572500 -- (-357.327) (-354.787) [-356.506] (-355.171) * (-357.917) (-357.431) [-361.757] (-354.512) -- 0:00:25
      573000 -- (-359.973) (-354.309) (-355.549) [-356.452] * [-354.602] (-357.704) (-355.659) (-356.624) -- 0:00:25
      573500 -- (-357.920) [-355.655] (-355.853) (-355.299) * [-357.662] (-355.037) (-356.044) (-355.460) -- 0:00:25
      574000 -- (-356.696) [-355.304] (-355.400) (-355.811) * (-354.841) (-359.960) (-355.575) [-356.008] -- 0:00:25
      574500 -- (-357.748) [-356.567] (-355.113) (-361.874) * (-357.003) (-355.474) (-355.490) [-354.746] -- 0:00:25
      575000 -- (-356.433) (-359.419) [-357.522] (-358.722) * (-358.617) [-355.532] (-357.000) (-359.906) -- 0:00:25

      Average standard deviation of split frequencies: 0.010257

      575500 -- [-355.964] (-357.238) (-357.003) (-359.681) * (-355.377) (-355.332) (-356.437) [-358.040] -- 0:00:25
      576000 -- [-356.298] (-359.060) (-356.070) (-356.066) * [-356.020] (-355.900) (-357.744) (-355.780) -- 0:00:25
      576500 -- (-358.670) (-355.588) (-356.652) [-354.588] * [-357.169] (-354.661) (-356.222) (-358.064) -- 0:00:24
      577000 -- (-361.097) (-359.625) (-363.913) [-356.716] * (-360.336) (-355.355) [-355.397] (-361.855) -- 0:00:24
      577500 -- (-356.522) (-362.489) (-356.732) [-356.656] * [-356.815] (-356.871) (-356.962) (-357.095) -- 0:00:24
      578000 -- (-356.723) (-358.779) (-357.737) [-355.039] * (-355.646) [-356.575] (-354.753) (-355.972) -- 0:00:24
      578500 -- (-354.830) (-358.451) [-358.292] (-357.131) * (-355.222) (-355.869) (-354.452) [-356.597] -- 0:00:24
      579000 -- (-359.589) [-355.125] (-357.166) (-357.163) * (-355.667) [-354.776] (-365.315) (-355.732) -- 0:00:24
      579500 -- (-357.345) (-355.473) (-354.555) [-357.407] * [-356.242] (-354.639) (-357.090) (-356.058) -- 0:00:24
      580000 -- (-354.694) (-355.237) [-358.912] (-357.029) * (-355.677) (-355.792) [-357.459] (-356.735) -- 0:00:24

      Average standard deviation of split frequencies: 0.010097

      580500 -- (-356.423) (-356.965) [-359.393] (-357.538) * [-354.727] (-355.448) (-355.824) (-356.217) -- 0:00:24
      581000 -- (-355.401) [-357.484] (-356.427) (-355.944) * (-360.044) (-355.707) (-359.427) [-354.838] -- 0:00:24
      581500 -- [-355.167] (-356.083) (-356.984) (-355.100) * (-356.575) [-355.131] (-355.814) (-356.611) -- 0:00:24
      582000 -- (-355.424) (-357.583) [-357.295] (-355.977) * (-355.919) (-357.120) [-355.503] (-356.109) -- 0:00:24
      582500 -- (-354.110) (-358.680) (-354.031) [-357.361] * (-362.282) (-358.529) [-356.237] (-358.293) -- 0:00:24
      583000 -- (-354.312) (-358.201) [-354.395] (-359.339) * (-357.724) (-357.412) [-355.510] (-361.283) -- 0:00:24
      583500 -- [-354.774] (-357.048) (-354.440) (-355.162) * (-354.408) (-359.797) [-356.492] (-356.682) -- 0:00:24
      584000 -- (-359.417) (-357.219) (-355.004) [-355.829] * (-361.068) (-355.886) (-361.958) [-356.642] -- 0:00:24
      584500 -- (-356.602) [-355.305] (-356.841) (-358.433) * [-360.558] (-354.717) (-354.392) (-356.775) -- 0:00:24
      585000 -- (-359.871) [-354.770] (-359.564) (-357.335) * [-356.710] (-354.827) (-354.562) (-354.934) -- 0:00:24

      Average standard deviation of split frequencies: 0.009704

      585500 -- [-356.072] (-357.821) (-355.648) (-356.199) * (-360.999) (-355.268) [-355.639] (-361.914) -- 0:00:24
      586000 -- (-359.502) (-355.794) [-357.637] (-356.414) * [-355.245] (-360.862) (-355.867) (-354.282) -- 0:00:24
      586500 -- (-359.068) [-354.901] (-358.935) (-359.393) * [-354.561] (-355.523) (-356.400) (-356.223) -- 0:00:23
      587000 -- (-358.335) (-356.309) (-360.287) [-357.226] * (-354.911) (-355.688) [-355.394] (-355.863) -- 0:00:24
      587500 -- (-355.762) (-354.800) (-357.977) [-356.636] * (-354.372) (-354.103) [-358.782] (-356.879) -- 0:00:24
      588000 -- (-356.162) [-355.851] (-357.407) (-356.716) * (-355.825) (-354.697) (-357.304) [-355.496] -- 0:00:24
      588500 -- (-355.756) (-356.956) [-357.604] (-359.979) * (-356.033) (-355.464) [-356.887] (-355.484) -- 0:00:24
      589000 -- [-357.490] (-355.704) (-357.311) (-354.591) * (-358.130) [-354.896] (-357.564) (-355.951) -- 0:00:24
      589500 -- (-357.288) (-356.329) [-358.412] (-355.924) * (-356.478) (-355.935) (-355.548) [-354.750] -- 0:00:24
      590000 -- (-356.684) (-356.115) [-355.623] (-356.009) * [-360.210] (-355.051) (-356.907) (-355.424) -- 0:00:24

      Average standard deviation of split frequencies: 0.009843

      590500 -- (-356.811) [-358.521] (-356.505) (-355.772) * (-357.777) [-355.971] (-356.332) (-355.497) -- 0:00:24
      591000 -- (-358.580) [-354.893] (-354.085) (-356.866) * [-355.868] (-358.937) (-358.071) (-355.567) -- 0:00:24
      591500 -- (-360.399) (-355.683) [-355.375] (-359.797) * (-358.953) (-356.073) (-357.466) [-355.781] -- 0:00:24
      592000 -- (-356.725) (-354.999) (-357.414) [-358.301] * [-354.563] (-361.544) (-357.376) (-357.205) -- 0:00:24
      592500 -- (-356.136) [-357.319] (-356.635) (-357.254) * (-360.033) (-355.757) (-355.141) [-359.179] -- 0:00:24
      593000 -- [-355.480] (-357.429) (-357.242) (-360.015) * (-357.224) (-355.038) (-355.279) [-355.446] -- 0:00:24
      593500 -- (-355.058) (-358.985) [-355.804] (-355.377) * (-357.603) (-356.647) [-355.962] (-355.218) -- 0:00:23
      594000 -- (-355.156) [-358.283] (-355.192) (-355.888) * (-356.840) [-355.709] (-355.092) (-354.695) -- 0:00:23
      594500 -- [-355.886] (-357.371) (-356.100) (-361.421) * [-358.642] (-355.629) (-355.815) (-357.875) -- 0:00:23
      595000 -- (-356.705) (-354.428) (-357.357) [-354.715] * (-358.784) [-356.847] (-356.236) (-356.482) -- 0:00:23

      Average standard deviation of split frequencies: 0.009640

      595500 -- (-356.016) [-357.494] (-362.052) (-356.235) * (-356.200) (-355.574) (-355.695) [-357.822] -- 0:00:23
      596000 -- (-359.376) (-355.703) (-355.990) [-354.789] * (-355.596) (-356.027) [-355.422] (-358.158) -- 0:00:23
      596500 -- (-356.575) (-355.058) [-354.160] (-361.024) * (-355.028) (-356.371) [-355.994] (-355.229) -- 0:00:23
      597000 -- (-356.919) (-355.416) [-357.051] (-355.578) * (-355.824) (-359.670) (-356.807) [-356.056] -- 0:00:23
      597500 -- (-357.084) [-354.678] (-355.312) (-356.539) * (-356.003) (-364.585) (-354.161) [-357.389] -- 0:00:23
      598000 -- (-358.175) [-355.883] (-355.693) (-356.832) * (-359.222) (-359.833) [-354.646] (-358.634) -- 0:00:23
      598500 -- (-356.204) (-355.736) [-355.448] (-355.365) * (-370.370) [-357.640] (-355.537) (-356.112) -- 0:00:23
      599000 -- [-358.691] (-355.799) (-355.611) (-358.355) * (-363.251) (-360.479) (-358.623) [-355.688] -- 0:00:23
      599500 -- (-356.605) (-354.129) (-357.345) [-355.966] * (-359.150) (-355.512) (-357.668) [-357.524] -- 0:00:23
      600000 -- (-357.602) (-357.486) (-355.430) [-354.754] * (-357.675) (-357.465) [-355.176] (-358.278) -- 0:00:23

      Average standard deviation of split frequencies: 0.009784

      600500 -- (-358.127) (-356.275) [-358.272] (-358.737) * (-355.820) [-357.745] (-358.276) (-355.889) -- 0:00:23
      601000 -- (-356.453) [-358.967] (-355.540) (-355.205) * (-358.763) [-356.262] (-356.665) (-360.383) -- 0:00:23
      601500 -- (-358.517) [-357.501] (-354.802) (-357.310) * (-356.399) (-356.486) [-354.713] (-356.130) -- 0:00:23
      602000 -- (-356.128) (-359.641) (-356.456) [-354.626] * [-355.466] (-357.644) (-355.712) (-360.899) -- 0:00:23
      602500 -- [-357.057] (-355.499) (-357.110) (-357.275) * (-354.216) (-355.943) [-356.100] (-355.792) -- 0:00:23
      603000 -- [-355.577] (-362.307) (-357.224) (-356.182) * [-355.057] (-362.432) (-356.670) (-357.100) -- 0:00:23
      603500 -- [-355.040] (-357.574) (-356.163) (-356.239) * (-354.574) (-355.854) (-356.825) [-357.737] -- 0:00:22
      604000 -- [-357.349] (-358.203) (-356.661) (-354.089) * (-358.203) (-355.647) [-356.742] (-357.640) -- 0:00:22
      604500 -- (-355.714) [-354.950] (-357.013) (-356.538) * (-355.028) (-355.831) (-364.689) [-355.242] -- 0:00:23
      605000 -- [-356.572] (-359.032) (-355.960) (-357.668) * (-355.791) (-357.732) [-357.303] (-357.980) -- 0:00:23

      Average standard deviation of split frequencies: 0.009383

      605500 -- [-355.557] (-360.412) (-358.831) (-358.943) * [-354.566] (-357.653) (-361.460) (-360.407) -- 0:00:23
      606000 -- (-356.875) (-356.467) (-356.111) [-357.954] * (-358.373) [-355.397] (-355.800) (-361.640) -- 0:00:23
      606500 -- (-356.850) (-354.298) [-354.828] (-355.484) * [-357.158] (-360.531) (-356.432) (-358.489) -- 0:00:23
      607000 -- (-356.151) (-354.157) (-357.146) [-358.156] * (-356.475) (-358.204) (-356.851) [-355.319] -- 0:00:23
      607500 -- (-357.231) (-355.960) (-359.196) [-358.039] * (-356.355) [-355.845] (-357.305) (-359.615) -- 0:00:23
      608000 -- (-360.532) (-357.780) [-355.134] (-355.703) * (-358.304) (-358.393) (-356.536) [-354.941] -- 0:00:23
      608500 -- (-357.596) (-361.099) (-355.096) [-356.889] * [-358.474] (-361.752) (-357.661) (-354.685) -- 0:00:23
      609000 -- [-356.088] (-354.958) (-354.912) (-355.285) * (-354.361) [-356.623] (-357.255) (-355.341) -- 0:00:23
      609500 -- (-356.798) [-357.275] (-355.224) (-358.993) * (-355.095) (-356.693) (-357.361) [-355.060] -- 0:00:23
      610000 -- (-357.117) (-357.754) [-355.061] (-358.697) * (-358.759) (-354.952) (-359.219) [-357.405] -- 0:00:23

      Average standard deviation of split frequencies: 0.009070

      610500 -- [-355.307] (-357.945) (-359.840) (-357.397) * (-356.951) (-355.021) [-357.489] (-357.459) -- 0:00:22
      611000 -- (-358.518) [-355.524] (-355.414) (-358.360) * (-355.631) (-359.040) (-356.082) [-354.978] -- 0:00:22
      611500 -- (-361.136) (-357.853) (-358.674) [-354.505] * (-354.799) (-354.857) (-358.762) [-355.095] -- 0:00:22
      612000 -- (-356.619) (-355.738) (-358.208) [-354.729] * (-355.831) (-356.926) (-358.096) [-357.874] -- 0:00:22
      612500 -- (-356.190) (-356.013) (-358.708) [-354.299] * (-356.453) (-356.108) (-357.815) [-358.260] -- 0:00:22
      613000 -- (-358.785) [-357.589] (-358.951) (-354.217) * (-356.536) (-356.022) (-357.197) [-358.373] -- 0:00:22
      613500 -- (-356.814) [-355.397] (-355.459) (-358.664) * (-357.608) (-361.698) (-355.010) [-355.314] -- 0:00:22
      614000 -- [-360.007] (-356.898) (-357.298) (-354.493) * (-358.051) (-361.723) [-355.215] (-358.950) -- 0:00:22
      614500 -- [-357.541] (-355.001) (-356.750) (-354.739) * (-355.961) [-356.005] (-355.636) (-355.631) -- 0:00:22
      615000 -- (-359.558) [-356.243] (-357.669) (-356.356) * (-356.047) [-355.083] (-354.724) (-355.150) -- 0:00:22

      Average standard deviation of split frequencies: 0.008801

      615500 -- (-359.130) [-355.385] (-359.097) (-355.629) * (-357.002) (-355.608) (-360.812) [-356.287] -- 0:00:22
      616000 -- (-359.721) [-356.062] (-355.830) (-356.918) * (-355.444) [-355.104] (-358.891) (-355.303) -- 0:00:22
      616500 -- (-361.507) (-355.760) [-357.152] (-356.217) * [-354.245] (-368.051) (-357.507) (-358.247) -- 0:00:22
      617000 -- (-355.421) (-355.451) (-359.981) [-354.121] * [-357.002] (-354.707) (-356.704) (-357.621) -- 0:00:22
      617500 -- (-355.071) (-356.295) (-357.063) [-355.097] * (-358.713) (-354.377) (-355.120) [-358.114] -- 0:00:22
      618000 -- (-357.026) (-356.021) [-355.772] (-354.986) * (-355.775) (-355.061) [-355.545] (-359.374) -- 0:00:22
      618500 -- (-358.478) (-355.611) (-359.992) [-355.488] * (-355.787) (-360.232) [-355.554] (-354.999) -- 0:00:22
      619000 -- (-356.674) (-355.584) [-356.803] (-355.156) * (-356.669) (-358.754) (-359.082) [-354.651] -- 0:00:22
      619500 -- (-356.186) (-355.053) [-358.600] (-359.506) * [-354.640] (-357.258) (-356.205) (-357.857) -- 0:00:22
      620000 -- (-359.733) [-355.988] (-355.997) (-355.573) * (-354.471) (-358.190) (-356.208) [-356.213] -- 0:00:22

      Average standard deviation of split frequencies: 0.009019

      620500 -- (-360.048) (-356.801) (-355.495) [-354.646] * (-357.783) (-359.031) [-355.777] (-355.094) -- 0:00:22
      621000 -- (-357.768) [-355.548] (-355.341) (-357.311) * (-355.638) (-358.492) [-356.582] (-355.925) -- 0:00:21
      621500 -- (-359.695) (-354.974) (-357.572) [-358.391] * [-355.476] (-355.508) (-355.499) (-355.173) -- 0:00:22
      622000 -- (-358.017) [-355.698] (-355.895) (-361.305) * [-355.223] (-359.508) (-357.462) (-356.043) -- 0:00:22
      622500 -- [-356.909] (-357.577) (-354.469) (-357.666) * (-358.505) [-360.026] (-358.436) (-355.808) -- 0:00:22
      623000 -- (-357.933) (-358.823) [-357.906] (-355.675) * (-356.369) [-356.249] (-360.561) (-356.585) -- 0:00:22
      623500 -- [-358.188] (-355.300) (-355.660) (-355.305) * (-355.978) [-356.091] (-357.629) (-357.176) -- 0:00:22
      624000 -- (-357.471) (-359.161) (-357.554) [-355.090] * (-356.212) (-354.824) (-356.370) [-355.755] -- 0:00:22
      624500 -- [-356.047] (-357.139) (-357.856) (-358.335) * (-359.325) (-355.809) (-355.459) [-355.716] -- 0:00:22
      625000 -- (-354.726) (-357.992) (-355.776) [-354.120] * [-356.200] (-363.225) (-356.999) (-357.272) -- 0:00:22

      Average standard deviation of split frequencies: 0.009272

      625500 -- (-358.304) [-355.463] (-360.141) (-355.271) * (-355.487) (-360.957) (-357.610) [-357.364] -- 0:00:22
      626000 -- (-356.625) (-358.446) [-358.681] (-354.740) * (-355.243) [-356.449] (-358.696) (-357.147) -- 0:00:22
      626500 -- (-357.609) [-355.313] (-355.789) (-356.418) * (-355.102) (-357.390) (-356.328) [-356.961] -- 0:00:22
      627000 -- (-358.062) (-356.009) [-355.761] (-363.644) * (-356.012) [-359.009] (-358.576) (-355.169) -- 0:00:22
      627500 -- (-355.698) (-356.387) [-356.288] (-355.709) * (-356.417) (-359.430) (-354.982) [-357.632] -- 0:00:21
      628000 -- (-359.377) [-356.738] (-357.552) (-356.959) * (-360.656) (-355.577) (-356.524) [-361.454] -- 0:00:21
      628500 -- (-356.013) (-358.817) (-357.562) [-356.437] * (-356.895) (-361.644) (-356.425) [-356.544] -- 0:00:21
      629000 -- [-355.657] (-355.235) (-356.774) (-359.655) * (-356.697) (-355.658) (-356.549) [-357.218] -- 0:00:21
      629500 -- (-356.596) (-355.635) [-354.560] (-356.557) * (-356.366) [-357.570] (-357.481) (-360.024) -- 0:00:21
      630000 -- (-356.909) (-355.416) (-359.613) [-355.626] * (-357.109) (-356.671) [-358.046] (-360.425) -- 0:00:21

      Average standard deviation of split frequencies: 0.009811

      630500 -- (-358.816) [-354.343] (-356.613) (-355.589) * (-357.775) [-363.815] (-357.238) (-361.067) -- 0:00:21
      631000 -- [-355.178] (-361.884) (-357.039) (-357.837) * (-355.415) [-354.987] (-356.274) (-355.283) -- 0:00:21
      631500 -- [-357.422] (-355.622) (-360.015) (-356.233) * [-355.034] (-354.756) (-357.707) (-356.482) -- 0:00:21
      632000 -- (-354.114) (-360.822) (-356.007) [-357.666] * [-354.723] (-357.331) (-358.666) (-359.961) -- 0:00:21
      632500 -- [-356.685] (-356.564) (-357.250) (-359.357) * (-362.212) (-355.066) [-359.084] (-354.547) -- 0:00:21
      633000 -- (-357.294) [-355.481] (-355.622) (-356.169) * [-355.680] (-356.411) (-359.205) (-354.823) -- 0:00:21
      633500 -- (-357.016) [-355.335] (-354.209) (-354.669) * [-356.633] (-355.256) (-354.734) (-357.397) -- 0:00:21
      634000 -- (-355.179) (-355.344) (-359.221) [-355.616] * (-358.986) (-355.889) (-356.876) [-358.572] -- 0:00:21
      634500 -- (-356.220) [-356.542] (-360.297) (-357.878) * (-356.288) (-357.906) [-354.620] (-357.113) -- 0:00:21
      635000 -- (-354.755) (-356.623) [-355.392] (-357.024) * (-358.904) [-355.358] (-354.521) (-356.779) -- 0:00:21

      Average standard deviation of split frequencies: 0.009682

      635500 -- (-356.281) (-355.839) [-355.990] (-355.240) * [-356.857] (-356.946) (-356.402) (-357.281) -- 0:00:21
      636000 -- (-355.847) (-355.840) [-355.152] (-354.794) * [-355.741] (-357.269) (-354.782) (-354.816) -- 0:00:21
      636500 -- (-356.367) (-356.064) [-356.731] (-355.923) * [-354.765] (-357.711) (-354.577) (-357.396) -- 0:00:21
      637000 -- (-356.834) (-354.799) (-356.005) [-355.222] * (-356.354) (-356.284) (-355.483) [-355.126] -- 0:00:21
      637500 -- (-357.197) (-354.540) [-361.368] (-358.018) * (-356.932) (-356.424) [-356.272] (-361.546) -- 0:00:21
      638000 -- [-357.375] (-354.882) (-356.517) (-356.965) * [-356.043] (-354.639) (-356.129) (-355.228) -- 0:00:20
      638500 -- (-355.726) (-354.880) [-355.682] (-355.768) * (-354.782) (-357.523) (-355.841) [-360.058] -- 0:00:20
      639000 -- [-354.796] (-355.681) (-355.014) (-356.210) * (-357.134) (-358.535) (-354.763) [-357.554] -- 0:00:21
      639500 -- [-357.555] (-357.100) (-358.571) (-354.653) * [-359.256] (-355.868) (-356.447) (-354.648) -- 0:00:21
      640000 -- (-356.494) (-355.369) [-356.873] (-354.869) * (-356.127) (-355.061) [-356.681] (-355.727) -- 0:00:21

      Average standard deviation of split frequencies: 0.009611

      640500 -- (-356.101) [-358.766] (-358.444) (-357.693) * [-357.016] (-357.903) (-355.542) (-355.485) -- 0:00:21
      641000 -- (-358.445) (-360.512) [-355.108] (-355.418) * (-355.729) [-354.299] (-368.598) (-354.683) -- 0:00:21
      641500 -- [-356.555] (-360.502) (-356.674) (-362.284) * (-359.312) [-355.509] (-359.110) (-354.563) -- 0:00:21
      642000 -- (-356.253) (-360.844) [-356.339] (-357.561) * (-356.174) (-356.455) (-354.696) [-356.245] -- 0:00:21
      642500 -- (-355.897) (-355.418) (-355.985) [-357.316] * (-356.309) (-354.546) [-358.285] (-356.359) -- 0:00:21
      643000 -- (-355.476) (-355.504) (-356.040) [-358.230] * (-357.749) (-355.904) (-358.933) [-356.782] -- 0:00:21
      643500 -- (-362.153) (-360.730) (-357.458) [-354.406] * [-356.896] (-359.243) (-356.439) (-356.370) -- 0:00:21
      644000 -- (-356.387) (-355.762) [-355.524] (-358.017) * (-357.070) (-357.493) [-356.544] (-362.592) -- 0:00:21
      644500 -- (-355.348) [-355.228] (-354.303) (-357.852) * [-356.736] (-359.459) (-358.542) (-359.642) -- 0:00:20
      645000 -- [-356.561] (-355.580) (-359.615) (-355.526) * (-357.683) (-356.354) [-356.146] (-356.008) -- 0:00:20

      Average standard deviation of split frequencies: 0.009304

      645500 -- (-358.204) [-354.145] (-360.109) (-356.721) * (-358.915) (-355.085) (-356.268) [-356.231] -- 0:00:20
      646000 -- [-355.597] (-356.558) (-354.850) (-357.030) * (-356.801) (-357.869) (-355.258) [-355.441] -- 0:00:20
      646500 -- (-355.534) [-354.191] (-355.325) (-357.511) * (-359.073) (-357.782) (-354.343) [-357.479] -- 0:00:20
      647000 -- (-355.125) (-355.941) [-357.793] (-358.270) * (-357.022) (-357.586) (-356.381) [-356.061] -- 0:00:20
      647500 -- [-355.337] (-358.499) (-357.967) (-357.321) * (-357.357) [-358.124] (-354.753) (-362.051) -- 0:00:20
      648000 -- (-356.517) [-355.299] (-357.365) (-357.665) * [-355.234] (-363.498) (-354.840) (-357.223) -- 0:00:20
      648500 -- (-355.253) [-356.217] (-359.455) (-355.130) * [-357.980] (-355.156) (-355.901) (-356.969) -- 0:00:20
      649000 -- [-356.120] (-356.514) (-357.495) (-356.504) * (-359.689) (-357.712) (-355.984) [-355.677] -- 0:00:20
      649500 -- (-355.437) (-356.890) (-355.338) [-355.018] * (-357.684) (-357.109) [-357.527] (-356.119) -- 0:00:20
      650000 -- [-355.390] (-355.417) (-358.014) (-356.980) * (-355.439) [-355.913] (-358.006) (-357.838) -- 0:00:20

      Average standard deviation of split frequencies: 0.009192

      650500 -- [-356.236] (-356.443) (-358.442) (-356.199) * (-357.126) (-356.817) [-359.057] (-356.092) -- 0:00:20
      651000 -- [-358.567] (-359.328) (-355.897) (-359.112) * (-355.826) (-361.302) (-355.154) [-354.786] -- 0:00:20
      651500 -- (-360.122) [-359.699] (-355.553) (-358.030) * (-356.425) (-356.814) [-355.522] (-355.166) -- 0:00:20
      652000 -- [-361.706] (-358.078) (-354.993) (-355.411) * (-356.570) [-355.227] (-355.102) (-361.247) -- 0:00:20
      652500 -- (-357.976) (-356.262) [-355.925] (-359.389) * (-356.118) (-357.442) (-355.695) [-356.783] -- 0:00:20
      653000 -- (-359.379) [-355.873] (-357.637) (-355.004) * [-356.873] (-356.123) (-359.869) (-357.596) -- 0:00:20
      653500 -- (-356.984) (-359.393) [-359.168] (-360.886) * [-358.406] (-355.531) (-355.795) (-359.272) -- 0:00:20
      654000 -- (-358.275) (-356.143) [-355.026] (-361.269) * [-357.422] (-357.185) (-355.846) (-357.997) -- 0:00:20
      654500 -- (-356.535) (-359.354) [-355.338] (-357.788) * (-358.883) (-354.139) (-357.906) [-358.890] -- 0:00:20
      655000 -- (-357.305) [-359.795] (-355.195) (-356.381) * (-360.652) [-358.474] (-358.725) (-357.360) -- 0:00:20

      Average standard deviation of split frequencies: 0.008758

      655500 -- (-356.779) [-360.464] (-358.452) (-356.186) * (-355.502) (-359.451) (-357.597) [-355.848] -- 0:00:19
      656000 -- (-356.296) [-355.326] (-357.041) (-356.434) * [-355.467] (-359.298) (-355.917) (-356.028) -- 0:00:20
      656500 -- [-355.670] (-358.623) (-355.435) (-356.592) * (-355.342) [-356.015] (-355.625) (-356.861) -- 0:00:20
      657000 -- (-355.616) [-355.855] (-354.469) (-359.794) * (-356.568) (-355.656) (-355.008) [-359.246] -- 0:00:20
      657500 -- (-358.982) (-355.638) (-356.225) [-361.755] * (-356.683) (-354.808) [-357.473] (-354.267) -- 0:00:20
      658000 -- (-361.948) (-357.220) (-356.359) [-359.553] * (-355.111) (-354.910) (-355.159) [-354.742] -- 0:00:20
      658500 -- (-361.360) [-356.429] (-356.833) (-359.434) * (-356.117) (-357.975) [-354.864] (-358.346) -- 0:00:20
      659000 -- (-356.847) (-355.904) [-357.443] (-356.293) * (-356.225) [-358.587] (-363.587) (-364.515) -- 0:00:20
      659500 -- (-357.220) (-356.305) [-356.984] (-357.294) * (-358.328) [-354.486] (-356.653) (-354.121) -- 0:00:20
      660000 -- (-357.151) (-356.182) (-355.763) [-360.140] * (-354.698) (-357.553) (-356.892) [-357.506] -- 0:00:20

      Average standard deviation of split frequencies: 0.008785

      660500 -- (-356.048) (-358.076) (-356.796) [-354.907] * (-355.390) [-355.716] (-355.882) (-356.645) -- 0:00:20
      661000 -- [-357.365] (-358.720) (-354.876) (-355.898) * [-357.975] (-355.799) (-357.670) (-355.118) -- 0:00:20
      661500 -- (-361.074) (-363.580) [-354.641] (-355.331) * (-359.117) [-357.340] (-358.286) (-355.105) -- 0:00:19
      662000 -- (-355.244) [-355.491] (-355.542) (-357.632) * (-355.079) (-363.813) [-355.899] (-358.427) -- 0:00:19
      662500 -- (-355.017) (-356.209) [-355.601] (-356.606) * (-354.765) (-355.746) (-355.610) [-356.174] -- 0:00:19
      663000 -- (-357.751) (-361.498) (-357.330) [-358.698] * [-357.501] (-354.639) (-356.670) (-354.558) -- 0:00:19
      663500 -- (-357.836) (-355.481) [-357.592] (-356.726) * (-356.628) (-356.638) [-357.858] (-354.147) -- 0:00:19
      664000 -- (-356.162) (-361.993) (-355.793) [-355.587] * [-357.954] (-357.476) (-355.899) (-358.532) -- 0:00:19
      664500 -- (-357.962) [-355.599] (-356.227) (-354.812) * [-359.063] (-357.352) (-356.840) (-358.874) -- 0:00:19
      665000 -- (-355.712) (-354.735) [-356.101] (-355.021) * (-359.291) [-357.728] (-356.600) (-355.026) -- 0:00:19

      Average standard deviation of split frequencies: 0.008582

      665500 -- (-355.368) (-358.787) [-356.924] (-357.793) * (-359.952) (-360.808) [-357.796] (-354.405) -- 0:00:19
      666000 -- (-354.658) (-361.125) [-355.866] (-356.371) * (-359.177) (-360.544) (-355.214) [-354.964] -- 0:00:19
      666500 -- (-355.626) (-357.914) [-354.704] (-357.861) * (-364.209) (-354.693) [-354.799] (-359.907) -- 0:00:19
      667000 -- (-357.338) (-357.207) (-357.884) [-357.124] * (-357.578) [-356.961] (-358.960) (-356.948) -- 0:00:19
      667500 -- (-355.454) (-354.926) (-356.270) [-355.986] * (-356.038) (-355.715) [-357.511] (-358.615) -- 0:00:19
      668000 -- (-358.433) (-354.628) (-355.418) [-357.533] * (-355.953) [-356.160] (-355.737) (-354.695) -- 0:00:19
      668500 -- [-356.810] (-356.627) (-357.548) (-360.563) * [-355.645] (-356.409) (-358.320) (-361.405) -- 0:00:19
      669000 -- (-355.031) (-361.442) (-359.268) [-355.379] * (-355.798) (-354.656) [-358.401] (-358.788) -- 0:00:19
      669500 -- [-355.211] (-355.815) (-357.005) (-361.736) * (-356.868) (-354.547) (-357.104) [-355.946] -- 0:00:19
      670000 -- (-355.020) (-354.215) (-355.684) [-355.267] * (-355.933) (-355.503) [-356.584] (-359.356) -- 0:00:19

      Average standard deviation of split frequencies: 0.008127

      670500 -- [-355.869] (-354.811) (-354.387) (-355.449) * (-355.466) [-354.471] (-357.392) (-356.462) -- 0:00:19
      671000 -- (-356.874) (-357.666) [-354.184] (-357.308) * (-357.365) (-355.577) [-355.848] (-356.697) -- 0:00:19
      671500 -- (-356.024) (-362.175) (-355.519) [-354.730] * (-357.042) (-356.670) [-354.594] (-357.139) -- 0:00:19
      672000 -- [-356.403] (-360.688) (-354.537) (-357.597) * (-357.201) (-355.745) [-354.662] (-355.150) -- 0:00:19
      672500 -- (-354.796) (-363.040) [-355.090] (-356.299) * (-355.477) (-354.339) (-356.203) [-354.538] -- 0:00:18
      673000 -- [-356.978] (-358.643) (-356.398) (-354.730) * [-355.631] (-355.601) (-355.934) (-356.472) -- 0:00:19
      673500 -- [-355.227] (-357.254) (-357.314) (-355.577) * (-356.284) [-357.020] (-356.306) (-357.125) -- 0:00:19
      674000 -- (-355.453) [-356.334] (-356.610) (-357.130) * (-356.593) [-355.489] (-358.038) (-358.514) -- 0:00:19
      674500 -- (-356.257) [-358.228] (-356.865) (-359.990) * [-358.094] (-359.415) (-360.297) (-363.045) -- 0:00:19
      675000 -- (-355.059) [-360.627] (-357.046) (-356.070) * (-357.758) (-360.477) (-356.140) [-356.041] -- 0:00:19

      Average standard deviation of split frequencies: 0.008194

      675500 -- (-354.238) (-354.675) (-355.939) [-355.709] * (-356.110) (-357.590) (-356.763) [-357.646] -- 0:00:19
      676000 -- (-358.655) (-357.749) [-357.075] (-355.644) * (-355.658) [-355.865] (-357.788) (-354.606) -- 0:00:19
      676500 -- (-356.862) (-356.090) (-356.688) [-355.529] * (-356.194) (-356.320) [-355.919] (-356.952) -- 0:00:19
      677000 -- (-358.174) (-357.461) (-355.210) [-355.091] * (-357.224) [-356.585] (-356.568) (-355.431) -- 0:00:19
      677500 -- (-355.556) [-359.059] (-355.955) (-356.575) * [-358.051] (-360.992) (-356.163) (-355.911) -- 0:00:19
      678000 -- (-355.554) [-355.602] (-355.771) (-358.401) * (-359.347) (-355.670) [-355.881] (-356.059) -- 0:00:18
      678500 -- (-357.174) (-355.888) [-356.487] (-355.754) * (-357.681) [-356.268] (-358.701) (-354.750) -- 0:00:18
      679000 -- (-358.937) (-357.320) [-357.807] (-356.302) * [-356.887] (-356.173) (-357.966) (-357.316) -- 0:00:18
      679500 -- (-355.004) [-355.355] (-360.144) (-357.456) * [-356.564] (-357.249) (-357.184) (-357.900) -- 0:00:18
      680000 -- [-355.201] (-357.337) (-358.088) (-357.446) * (-355.488) (-358.454) (-355.207) [-356.011] -- 0:00:18

      Average standard deviation of split frequencies: 0.008441

      680500 -- [-359.510] (-357.723) (-356.712) (-357.175) * [-356.878] (-357.270) (-355.559) (-357.314) -- 0:00:18
      681000 -- (-355.238) [-354.485] (-355.730) (-361.248) * (-355.671) (-357.680) [-354.480] (-357.146) -- 0:00:18
      681500 -- [-362.425] (-355.971) (-355.454) (-356.061) * [-355.337] (-358.698) (-354.401) (-361.996) -- 0:00:18
      682000 -- (-357.454) (-355.112) (-356.214) [-354.945] * [-356.655] (-356.068) (-356.937) (-355.031) -- 0:00:18
      682500 -- (-357.121) (-357.369) [-357.776] (-359.941) * [-356.586] (-356.644) (-354.852) (-358.235) -- 0:00:18
      683000 -- [-355.541] (-355.116) (-354.677) (-357.516) * (-354.979) (-355.859) [-354.773] (-356.968) -- 0:00:18
      683500 -- (-355.281) (-356.659) (-357.473) [-357.899] * (-354.854) (-361.407) [-357.989] (-356.053) -- 0:00:18
      684000 -- (-355.586) [-357.176] (-358.413) (-357.712) * [-356.034] (-355.281) (-357.937) (-356.512) -- 0:00:18
      684500 -- (-359.487) (-356.193) (-355.213) [-357.966] * [-360.088] (-357.417) (-357.768) (-358.999) -- 0:00:18
      685000 -- (-355.959) [-359.796] (-356.272) (-355.199) * [-357.974] (-356.122) (-358.347) (-355.002) -- 0:00:18

      Average standard deviation of split frequencies: 0.008289

      685500 -- (-358.030) (-356.574) [-355.419] (-355.971) * (-358.214) (-357.865) [-355.152] (-355.935) -- 0:00:18
      686000 -- (-354.177) (-354.166) (-356.491) [-357.617] * (-356.504) [-355.386] (-355.276) (-356.365) -- 0:00:18
      686500 -- (-356.577) (-356.680) (-355.420) [-357.413] * (-355.997) (-361.400) (-360.564) [-360.364] -- 0:00:18
      687000 -- (-354.256) (-355.637) (-356.188) [-356.055] * (-357.702) [-358.919] (-356.278) (-356.774) -- 0:00:18
      687500 -- [-354.669] (-356.998) (-357.078) (-362.468) * (-357.013) [-358.810] (-356.888) (-356.533) -- 0:00:18
      688000 -- [-355.458] (-361.679) (-357.858) (-357.757) * (-358.459) (-357.739) (-356.416) [-356.479] -- 0:00:18
      688500 -- (-355.656) (-361.882) [-357.301] (-360.926) * (-355.048) (-359.284) [-356.300] (-357.902) -- 0:00:18
      689000 -- (-354.795) (-357.060) [-355.774] (-360.125) * (-356.281) (-360.211) [-355.753] (-360.261) -- 0:00:18
      689500 -- (-355.418) (-356.392) [-355.617] (-360.496) * (-359.056) [-359.687] (-355.376) (-360.233) -- 0:00:18
      690000 -- (-359.957) (-354.491) [-355.072] (-356.910) * (-359.115) (-359.595) [-355.561] (-354.788) -- 0:00:17

      Average standard deviation of split frequencies: 0.008062

      690500 -- (-355.155) (-355.264) (-359.196) [-355.944] * (-358.304) (-354.549) [-355.310] (-355.104) -- 0:00:18
      691000 -- (-359.541) (-355.144) [-360.665] (-355.458) * (-357.141) (-355.643) [-354.310] (-355.915) -- 0:00:18
      691500 -- (-356.635) (-355.877) (-360.570) [-354.551] * (-355.885) (-356.768) [-354.906] (-354.726) -- 0:00:18
      692000 -- (-355.600) (-356.898) [-356.921] (-356.193) * (-360.197) (-358.740) (-355.830) [-355.509] -- 0:00:18
      692500 -- [-355.980] (-354.483) (-358.560) (-357.319) * (-358.463) (-359.066) [-354.209] (-355.601) -- 0:00:18
      693000 -- (-356.531) [-355.310] (-355.916) (-356.411) * (-355.162) (-359.317) (-354.757) [-355.807] -- 0:00:18
      693500 -- (-355.716) (-356.092) (-355.320) [-356.207] * (-356.710) (-356.724) [-354.635] (-356.817) -- 0:00:18
      694000 -- (-360.126) (-360.349) [-355.807] (-357.624) * (-355.624) (-359.116) [-358.693] (-356.326) -- 0:00:18
      694500 -- (-355.660) (-356.953) (-358.942) [-355.861] * (-356.195) (-358.405) (-357.140) [-355.751] -- 0:00:18
      695000 -- (-355.442) (-356.660) [-355.335] (-357.273) * (-357.829) [-354.720] (-358.558) (-357.927) -- 0:00:17

      Average standard deviation of split frequencies: 0.007947

      695500 -- (-355.664) [-354.795] (-359.298) (-359.525) * (-358.027) (-355.395) [-358.353] (-361.866) -- 0:00:17
      696000 -- [-355.521] (-357.657) (-358.343) (-356.850) * [-355.203] (-355.039) (-356.971) (-360.125) -- 0:00:17
      696500 -- (-355.510) (-354.938) [-357.289] (-357.250) * (-357.189) (-355.143) [-357.249] (-356.043) -- 0:00:17
      697000 -- (-357.511) [-356.312] (-354.980) (-356.577) * (-354.660) (-355.357) (-356.924) [-354.347] -- 0:00:17
      697500 -- (-355.368) (-356.545) [-355.173] (-355.420) * (-357.855) (-360.325) [-355.500] (-358.870) -- 0:00:17
      698000 -- (-356.090) (-355.698) (-357.705) [-355.487] * (-356.974) [-359.149] (-356.346) (-356.649) -- 0:00:17
      698500 -- (-355.905) [-356.180] (-358.466) (-355.719) * (-355.297) (-357.010) [-357.103] (-355.887) -- 0:00:17
      699000 -- (-356.166) [-357.578] (-356.052) (-355.295) * (-355.506) [-354.965] (-356.144) (-357.571) -- 0:00:17
      699500 -- (-355.885) (-356.772) [-355.021] (-357.811) * (-356.248) (-361.117) (-357.230) [-355.556] -- 0:00:17
      700000 -- (-356.254) (-355.927) [-355.886] (-358.775) * (-358.042) (-360.952) (-355.762) [-357.631] -- 0:00:17

      Average standard deviation of split frequencies: 0.007611

      700500 -- (-355.671) (-355.083) (-361.677) [-358.709] * (-356.585) (-356.143) [-355.810] (-358.399) -- 0:00:17
      701000 -- (-356.990) (-356.788) (-358.133) [-358.994] * (-358.156) [-354.319] (-357.201) (-356.795) -- 0:00:17
      701500 -- (-355.929) [-356.017] (-355.123) (-357.545) * (-355.794) [-354.309] (-360.090) (-361.905) -- 0:00:17
      702000 -- (-355.730) (-355.633) (-358.963) [-355.594] * (-355.885) (-355.581) (-354.960) [-354.882] -- 0:00:17
      702500 -- (-355.182) (-355.403) [-355.179] (-356.717) * (-355.638) (-355.041) [-359.724] (-356.302) -- 0:00:17
      703000 -- (-356.435) (-360.739) (-355.505) [-355.832] * [-355.665] (-356.447) (-355.608) (-357.862) -- 0:00:17
      703500 -- (-355.575) (-359.718) (-354.811) [-354.613] * (-358.608) [-356.417] (-355.857) (-357.057) -- 0:00:17
      704000 -- (-355.044) (-361.006) [-355.793] (-356.148) * (-359.642) [-358.497] (-358.763) (-358.543) -- 0:00:17
      704500 -- (-355.563) (-359.733) (-355.906) [-356.166] * (-361.771) (-357.855) (-356.191) [-359.289] -- 0:00:17
      705000 -- (-358.662) (-360.674) [-354.712] (-359.821) * (-357.388) (-354.892) [-355.303] (-355.443) -- 0:00:17

      Average standard deviation of split frequencies: 0.007804

      705500 -- (-355.479) (-356.751) [-356.039] (-357.088) * (-355.337) (-357.321) (-355.213) [-357.719] -- 0:00:17
      706000 -- (-355.314) (-356.321) [-355.746] (-357.326) * [-356.594] (-356.282) (-358.204) (-355.607) -- 0:00:17
      706500 -- (-357.681) [-357.552] (-356.491) (-356.429) * (-356.123) (-357.870) [-355.924] (-359.276) -- 0:00:17
      707000 -- (-357.509) (-354.763) (-355.997) [-358.667] * [-354.098] (-357.433) (-356.944) (-358.674) -- 0:00:16
      707500 -- (-356.631) (-359.207) [-356.821] (-359.908) * [-356.049] (-355.968) (-354.672) (-356.609) -- 0:00:17
      708000 -- (-358.366) [-355.103] (-363.593) (-354.352) * [-357.384] (-354.912) (-355.332) (-361.119) -- 0:00:17
      708500 -- (-357.650) [-356.154] (-356.748) (-354.825) * (-358.921) [-355.943] (-358.917) (-359.746) -- 0:00:17
      709000 -- (-354.720) [-356.191] (-356.163) (-355.848) * (-360.056) [-355.317] (-355.599) (-368.020) -- 0:00:17
      709500 -- (-355.558) [-354.980] (-360.178) (-357.227) * (-356.092) [-357.237] (-355.403) (-368.383) -- 0:00:17
      710000 -- (-359.552) [-354.760] (-356.615) (-356.521) * (-355.500) (-357.832) (-355.302) [-356.086] -- 0:00:17

      Average standard deviation of split frequencies: 0.008001

      710500 -- (-355.899) (-355.916) (-356.055) [-355.972] * (-355.771) [-357.503] (-354.363) (-355.571) -- 0:00:17
      711000 -- (-357.483) (-359.134) [-356.376] (-354.940) * [-356.911] (-357.250) (-357.831) (-354.818) -- 0:00:17
      711500 -- [-358.164] (-356.848) (-355.119) (-355.003) * (-355.125) (-357.032) [-355.100] (-354.519) -- 0:00:17
      712000 -- (-356.826) (-358.131) [-358.740] (-357.544) * (-357.228) [-356.127] (-356.788) (-355.442) -- 0:00:16
      712500 -- (-356.705) (-356.339) (-356.152) [-357.335] * (-356.690) (-354.229) (-354.463) [-354.464] -- 0:00:16
      713000 -- (-355.016) [-355.275] (-362.903) (-354.898) * [-354.086] (-354.162) (-354.813) (-355.440) -- 0:00:16
      713500 -- (-356.540) (-357.322) (-356.150) [-354.968] * (-357.255) (-355.164) (-355.654) [-360.360] -- 0:00:16
      714000 -- (-355.090) (-362.154) [-355.436] (-362.641) * (-359.932) [-354.287] (-357.885) (-359.713) -- 0:00:16
      714500 -- (-359.182) [-359.335] (-354.336) (-356.583) * (-359.994) (-356.949) (-354.951) [-356.687] -- 0:00:16
      715000 -- (-356.639) (-358.340) [-357.788] (-355.992) * (-359.855) (-356.882) [-355.192] (-355.445) -- 0:00:16

      Average standard deviation of split frequencies: 0.008271

      715500 -- (-354.924) (-357.609) [-356.167] (-359.703) * (-361.315) (-355.544) [-355.831] (-356.572) -- 0:00:16
      716000 -- [-359.615] (-356.028) (-356.223) (-356.576) * [-355.058] (-356.455) (-354.052) (-356.327) -- 0:00:16
      716500 -- (-359.746) (-357.892) (-356.763) [-357.285] * (-355.363) [-359.251] (-353.982) (-355.361) -- 0:00:16
      717000 -- (-360.170) (-358.170) [-358.462] (-358.518) * (-355.410) [-357.001] (-355.773) (-355.937) -- 0:00:16
      717500 -- [-354.795] (-358.070) (-356.285) (-357.714) * [-356.498] (-357.179) (-355.129) (-355.364) -- 0:00:16
      718000 -- (-354.906) [-357.020] (-355.021) (-355.406) * [-356.463] (-355.165) (-357.366) (-355.135) -- 0:00:16
      718500 -- (-356.401) (-356.507) [-356.462] (-355.544) * [-360.765] (-355.115) (-358.914) (-355.046) -- 0:00:16
      719000 -- (-357.635) (-359.125) (-357.702) [-355.192] * (-359.446) [-356.665] (-356.895) (-354.134) -- 0:00:16
      719500 -- [-355.850] (-358.296) (-354.806) (-354.607) * (-357.249) (-356.931) [-354.701] (-355.236) -- 0:00:16
      720000 -- [-354.993] (-359.812) (-358.848) (-356.154) * (-359.694) [-355.500] (-357.047) (-355.189) -- 0:00:16

      Average standard deviation of split frequencies: 0.008177

      720500 -- (-355.362) [-355.299] (-355.633) (-358.103) * (-356.265) [-355.150] (-355.248) (-357.060) -- 0:00:16
      721000 -- [-359.866] (-355.667) (-354.231) (-356.500) * (-358.443) [-360.862] (-355.478) (-357.461) -- 0:00:16
      721500 -- [-355.253] (-355.276) (-355.411) (-356.330) * (-364.132) (-357.921) (-358.317) [-354.880] -- 0:00:16
      722000 -- (-354.623) [-355.830] (-354.317) (-355.982) * [-359.100] (-356.720) (-355.053) (-354.566) -- 0:00:16
      722500 -- (-354.097) [-358.193] (-358.373) (-355.549) * (-357.729) [-355.838] (-359.424) (-355.379) -- 0:00:16
      723000 -- (-359.248) (-355.582) [-357.369] (-354.841) * (-357.777) [-357.625] (-357.053) (-359.931) -- 0:00:16
      723500 -- (-358.671) (-356.200) (-354.408) [-354.926] * (-355.926) (-355.467) (-356.554) [-356.567] -- 0:00:16
      724000 -- (-355.295) (-360.349) (-357.989) [-357.185] * [-354.200] (-355.835) (-356.951) (-357.823) -- 0:00:16
      724500 -- [-361.168] (-355.096) (-357.816) (-361.639) * [-354.924] (-358.814) (-357.461) (-356.697) -- 0:00:15
      725000 -- [-362.355] (-354.391) (-357.671) (-355.521) * (-356.472) (-358.667) (-356.573) [-357.376] -- 0:00:16

      Average standard deviation of split frequencies: 0.008401

      725500 -- [-354.099] (-356.991) (-354.924) (-355.385) * (-355.393) (-355.015) (-357.672) [-359.873] -- 0:00:16
      726000 -- (-354.534) (-355.024) [-355.038] (-354.655) * (-357.466) (-357.035) [-358.049] (-355.278) -- 0:00:16
      726500 -- (-357.339) (-355.634) (-358.936) [-356.290] * (-355.578) (-356.055) [-354.982] (-358.057) -- 0:00:16
      727000 -- (-357.275) (-358.268) [-358.405] (-357.803) * [-355.697] (-355.604) (-356.492) (-358.946) -- 0:00:16
      727500 -- (-355.351) (-357.498) [-356.420] (-358.795) * (-355.788) (-355.574) [-355.937] (-360.633) -- 0:00:16
      728000 -- (-354.509) (-356.354) [-357.824] (-356.138) * (-357.445) [-355.765] (-359.946) (-356.668) -- 0:00:16
      728500 -- (-358.544) [-356.837] (-356.701) (-356.540) * (-357.580) (-358.522) (-355.989) [-357.480] -- 0:00:16
      729000 -- (-355.901) [-356.024] (-355.375) (-356.189) * (-355.471) (-360.616) [-355.346] (-356.035) -- 0:00:15
      729500 -- (-357.396) (-354.726) (-358.401) [-354.768] * (-355.736) [-361.433] (-359.473) (-362.334) -- 0:00:15
      730000 -- [-354.852] (-359.314) (-356.092) (-359.952) * [-355.107] (-358.689) (-355.845) (-360.212) -- 0:00:15

      Average standard deviation of split frequencies: 0.008629

      730500 -- (-355.436) [-358.408] (-354.789) (-357.718) * (-356.249) (-355.314) (-355.339) [-357.155] -- 0:00:15
      731000 -- (-359.394) [-355.297] (-355.698) (-356.888) * (-356.388) [-357.865] (-356.673) (-357.017) -- 0:00:15
      731500 -- [-354.964] (-355.200) (-355.695) (-359.455) * (-356.805) (-355.904) [-356.582] (-356.754) -- 0:00:15
      732000 -- (-355.579) [-355.648] (-357.152) (-357.390) * (-360.084) [-354.412] (-356.593) (-357.310) -- 0:00:15
      732500 -- (-356.461) [-356.824] (-357.295) (-356.733) * (-359.404) [-355.204] (-362.627) (-357.641) -- 0:00:15
      733000 -- (-357.630) [-355.454] (-359.366) (-354.162) * [-356.720] (-355.483) (-357.695) (-357.831) -- 0:00:15
      733500 -- (-356.899) (-358.444) [-356.261] (-356.622) * (-359.047) [-355.623] (-356.200) (-358.089) -- 0:00:15
      734000 -- (-363.168) (-359.956) [-355.861] (-355.077) * (-356.477) [-357.073] (-356.306) (-358.350) -- 0:00:15
      734500 -- [-359.959] (-355.428) (-358.180) (-356.776) * [-356.283] (-356.231) (-357.317) (-357.131) -- 0:00:15
      735000 -- (-359.343) (-356.833) [-359.904] (-357.276) * (-354.897) (-354.505) [-357.796] (-355.034) -- 0:00:15

      Average standard deviation of split frequencies: 0.008487

      735500 -- (-354.665) (-358.996) [-357.084] (-358.749) * [-356.828] (-354.885) (-359.665) (-356.974) -- 0:00:15
      736000 -- [-354.897] (-354.868) (-359.153) (-359.044) * (-355.781) [-355.950] (-359.220) (-355.314) -- 0:00:15
      736500 -- (-358.664) (-356.684) (-357.852) [-354.853] * (-356.652) (-358.221) (-361.670) [-358.121] -- 0:00:15
      737000 -- (-355.908) (-354.385) (-359.826) [-355.323] * (-357.374) (-359.265) (-361.050) [-357.847] -- 0:00:15
      737500 -- (-356.313) [-354.454] (-362.953) (-356.024) * (-357.783) [-356.828] (-356.676) (-356.738) -- 0:00:15
      738000 -- (-356.640) [-356.433] (-357.724) (-356.980) * (-357.542) [-355.580] (-356.501) (-361.013) -- 0:00:15
      738500 -- (-355.745) [-357.404] (-355.662) (-357.204) * (-356.841) (-354.385) [-358.829] (-361.739) -- 0:00:15
      739000 -- [-355.225] (-355.590) (-354.500) (-356.911) * (-356.388) (-356.499) [-357.735] (-362.065) -- 0:00:15
      739500 -- (-357.359) (-357.330) (-356.742) [-356.573] * [-355.090] (-355.157) (-355.428) (-355.303) -- 0:00:15
      740000 -- (-358.480) [-355.585] (-358.715) (-361.316) * [-354.889] (-358.514) (-361.505) (-354.832) -- 0:00:15

      Average standard deviation of split frequencies: 0.008513

      740500 -- (-357.608) (-358.628) [-356.103] (-359.382) * (-355.807) (-358.245) (-360.174) [-355.231] -- 0:00:15
      741000 -- (-355.830) [-357.133] (-355.900) (-356.198) * [-356.318] (-356.513) (-358.849) (-357.501) -- 0:00:15
      741500 -- (-356.964) [-354.541] (-356.610) (-357.360) * (-359.319) (-359.495) (-358.250) [-358.569] -- 0:00:14
      742000 -- (-358.749) (-355.552) [-355.886] (-357.099) * [-356.947] (-358.858) (-359.194) (-357.394) -- 0:00:15
      742500 -- (-355.493) (-354.945) (-356.536) [-355.307] * (-354.991) [-355.682] (-355.135) (-354.581) -- 0:00:15
      743000 -- (-358.107) [-355.820] (-354.679) (-355.954) * (-356.741) (-355.807) [-356.386] (-354.869) -- 0:00:15
      743500 -- [-355.212] (-358.349) (-356.817) (-355.038) * (-357.087) (-359.728) (-354.624) [-359.075] -- 0:00:15
      744000 -- (-355.086) [-360.589] (-358.875) (-354.890) * (-360.250) (-356.564) [-355.085] (-358.677) -- 0:00:15
      744500 -- (-356.623) (-356.208) [-356.248] (-359.400) * [-360.986] (-355.921) (-358.117) (-355.240) -- 0:00:15
      745000 -- (-355.622) [-357.417] (-358.023) (-358.876) * (-358.920) [-358.326] (-360.161) (-355.208) -- 0:00:15

      Average standard deviation of split frequencies: 0.008088

      745500 -- [-354.491] (-356.784) (-355.707) (-356.976) * (-359.338) [-358.431] (-359.159) (-355.070) -- 0:00:15
      746000 -- (-356.691) (-357.602) (-355.495) [-357.211] * (-356.605) (-354.798) (-358.305) [-355.782] -- 0:00:14
      746500 -- (-354.698) (-355.813) (-358.136) [-355.768] * (-358.944) (-354.702) [-359.215] (-361.396) -- 0:00:14
      747000 -- [-355.230] (-361.525) (-356.453) (-357.104) * (-358.407) (-354.866) (-356.092) [-361.576] -- 0:00:14
      747500 -- [-354.951] (-363.187) (-356.888) (-359.343) * (-356.492) [-356.233] (-356.597) (-358.947) -- 0:00:14
      748000 -- [-355.565] (-356.000) (-356.112) (-357.715) * (-357.533) (-357.989) [-355.626] (-355.502) -- 0:00:14
      748500 -- (-356.966) (-358.208) [-356.024] (-358.012) * (-355.357) (-358.597) [-357.750] (-356.7