--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:40:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0094/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -780.15 -783.52
2 -780.18 -783.54
--------------------------------------
TOTAL -780.16 -783.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900796 0.092082 0.393341 1.518502 0.866974 1207.82 1354.41 1.000
r(A<->C){all} 0.158537 0.019969 0.000087 0.447762 0.119584 181.27 210.61 1.000
r(A<->G){all} 0.169556 0.020507 0.000093 0.454299 0.135463 137.46 184.41 1.003
r(A<->T){all} 0.169621 0.020365 0.000264 0.449509 0.129257 174.61 199.09 1.000
r(C<->G){all} 0.158299 0.018052 0.000028 0.437392 0.125429 310.72 312.48 1.000
r(C<->T){all} 0.165374 0.021410 0.000090 0.467734 0.125760 223.95 228.15 1.002
r(G<->T){all} 0.178613 0.021987 0.000345 0.475092 0.137597 252.89 259.76 1.001
pi(A){all} 0.165170 0.000233 0.135839 0.195391 0.164860 1267.59 1290.72 1.000
pi(C){all} 0.291569 0.000369 0.255767 0.331009 0.290948 1105.12 1112.16 1.000
pi(G){all} 0.331502 0.000380 0.292673 0.367731 0.331641 824.64 1067.44 1.000
pi(T){all} 0.211759 0.000284 0.179307 0.244730 0.211786 1361.41 1368.71 1.000
alpha{1,2} 0.412239 0.243127 0.000119 1.397807 0.237742 1172.71 1336.86 1.000
alpha{3} 0.468943 0.252648 0.000192 1.508587 0.300312 1114.54 1294.08 1.000
pinvar{all} 0.997143 0.000013 0.990653 0.999999 0.998249 1352.19 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -759.726229
Model 2: PositiveSelection -759.726231
Model 0: one-ratio -759.726236
Model 7: beta -759.726167
Model 8: beta&w>1 -759.726167
Model 0 vs 1 1.3999999964653398E-5
Model 2 vs 1 3.999999989900971E-6
Model 8 vs 7 0.0
>C1
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C2
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C3
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C4
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C5
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C6
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192
C1 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C2 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C3 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C4 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C5 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C6 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
**************************************************
C1 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C2 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C3 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C4 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C5 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C6 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
**************************************************
C1 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C2 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C3 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C4 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C5 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C6 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
**************************************************
C1 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C2 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C3 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C4 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C5 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C6 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 192 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 192 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5760]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5760]--->[5760]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.723 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C2 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C3 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C4 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C5 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C6 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
**************************************************
C1 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C2 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C3 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C4 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C5 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C6 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
**************************************************
C1 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C2 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C3 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C4 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C5 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C6 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
**************************************************
C1 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C2 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C3 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C4 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C5 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C6 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C2 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C3 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C4 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C5 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C6 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
**************************************************
C1 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C2 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C3 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C4 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C5 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C6 TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
**************************************************
C1 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C2 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C3 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C4 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C5 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C6 TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
**************************************************
C1 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C2 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C3 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C4 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C5 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C6 GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
**************************************************
C1 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C2 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C3 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C4 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C5 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C6 CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
**************************************************
C1 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C2 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C3 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C4 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C5 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C6 GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
**************************************************
C1 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C2 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C3 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C4 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C5 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C6 AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
**************************************************
C1 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C2 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C3 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C4 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C5 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C6 CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
**************************************************
C1 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C2 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C3 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C4 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C5 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C6 TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
**************************************************
C1 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C2 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C3 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C4 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C5 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C6 CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
**************************************************
C1 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C2 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C3 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C4 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C5 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C6 TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
**************************************************
C1 GCCTCAGCTCGGGAAGTGCGGTCAAA
C2 GCCTCAGCTCGGGAAGTGCGGTCAAA
C3 GCCTCAGCTCGGGAAGTGCGGTCAAA
C4 GCCTCAGCTCGGGAAGTGCGGTCAAA
C5 GCCTCAGCTCGGGAAGTGCGGTCAAA
C6 GCCTCAGCTCGGGAAGTGCGGTCAAA
**************************
>C1
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C2
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C3
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C4
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C5
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C6
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C1
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C2
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C3
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C4
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C5
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C6
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 576 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790321
Setting output file names to "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1452087901
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0541023901
Seed = 872791126
Swapseed = 1579790321
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1289.115611 -- -24.965149
Chain 2 -- -1289.115611 -- -24.965149
Chain 3 -- -1289.115611 -- -24.965149
Chain 4 -- -1289.115611 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1289.115611 -- -24.965149
Chain 2 -- -1289.115537 -- -24.965149
Chain 3 -- -1289.115415 -- -24.965149
Chain 4 -- -1289.115537 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1289.116] (-1289.116) (-1289.116) (-1289.116) * [-1289.116] (-1289.116) (-1289.115) (-1289.116)
500 -- (-798.191) (-811.652) (-798.116) [-805.781] * (-801.254) (-788.624) (-802.110) [-791.176] -- 0:00:00
1000 -- (-799.966) (-791.335) (-784.247) [-788.439] * (-798.787) (-794.882) [-783.299] (-795.241) -- 0:00:00
1500 -- (-800.323) (-789.926) (-785.376) [-795.264] * (-790.587) (-791.972) [-792.400] (-788.242) -- 0:00:00
2000 -- (-796.857) (-784.532) [-788.251] (-793.545) * [-786.352] (-787.868) (-788.710) (-792.695) -- 0:00:00
2500 -- (-788.504) [-783.359] (-795.647) (-787.557) * (-796.525) (-786.073) [-788.862] (-790.683) -- 0:00:00
3000 -- (-797.573) (-796.903) [-789.060] (-789.786) * (-788.902) (-789.233) [-785.316] (-786.909) -- 0:00:00
3500 -- (-789.956) (-788.772) [-789.000] (-793.285) * (-792.594) (-794.447) [-790.578] (-790.567) -- 0:00:00
4000 -- (-789.655) (-784.210) (-794.522) [-788.220] * (-788.746) (-788.868) (-799.669) [-787.097] -- 0:04:09
4500 -- (-792.145) (-789.111) [-788.515] (-788.304) * (-795.339) [-792.839] (-788.204) (-788.777) -- 0:03:41
5000 -- (-786.597) [-787.978] (-794.188) (-799.389) * (-790.571) [-787.603] (-787.758) (-796.126) -- 0:03:19
Average standard deviation of split frequencies: 0.057140
5500 -- (-792.315) (-798.268) [-794.571] (-788.521) * (-791.503) [-792.477] (-789.956) (-791.525) -- 0:03:00
6000 -- [-789.973] (-786.833) (-794.974) (-793.327) * [-790.244] (-785.950) (-794.602) (-788.924) -- 0:02:45
6500 -- (-785.418) (-791.338) (-794.205) [-792.301] * (-781.955) [-802.529] (-786.805) (-786.721) -- 0:02:32
7000 -- [-785.233] (-789.766) (-787.811) (-784.688) * [-789.086] (-793.056) (-780.672) (-792.862) -- 0:02:21
7500 -- (-794.386) [-789.952] (-789.029) (-782.158) * (-795.608) (-787.669) (-781.294) [-784.498] -- 0:02:12
8000 -- [-789.362] (-795.256) (-788.381) (-780.860) * (-792.431) (-788.370) [-780.102] (-792.427) -- 0:02:04
8500 -- [-791.350] (-783.852) (-787.034) (-781.669) * (-785.684) (-791.039) [-779.308] (-791.005) -- 0:01:56
9000 -- (-786.971) (-780.253) (-792.372) [-779.250] * (-790.837) (-786.178) (-781.194) [-797.208] -- 0:01:50
9500 -- (-793.577) (-778.962) [-792.006] (-779.823) * [-795.587] (-793.469) (-780.318) (-790.321) -- 0:01:44
10000 -- (-787.404) [-782.807] (-788.948) (-781.385) * (-789.873) (-790.595) (-784.263) [-789.129] -- 0:01:39
Average standard deviation of split frequencies: 0.059662
10500 -- (-784.901) (-785.654) (-794.110) [-781.142] * (-803.451) (-792.824) [-779.794] (-790.946) -- 0:01:34
11000 -- (-790.030) (-785.195) [-786.241] (-782.056) * (-795.801) (-794.226) [-779.936] (-794.140) -- 0:01:29
11500 -- [-793.505] (-782.405) (-793.186) (-779.973) * [-779.404] (-794.562) (-787.338) (-790.557) -- 0:01:25
12000 -- [-785.097] (-780.889) (-797.950) (-779.386) * [-779.110] (-789.652) (-781.363) (-794.103) -- 0:01:22
12500 -- (-790.263) (-780.132) (-787.752) [-781.294] * (-781.673) [-790.948] (-781.162) (-784.400) -- 0:01:19
13000 -- (-792.944) [-780.979] (-789.342) (-780.751) * (-784.612) (-787.212) (-782.850) [-789.982] -- 0:01:15
13500 -- [-789.373] (-781.470) (-785.785) (-781.665) * (-780.244) (-796.092) [-789.349] (-791.864) -- 0:01:13
14000 -- [-793.721] (-779.472) (-788.330) (-783.378) * (-780.070) (-792.464) [-781.842] (-787.310) -- 0:01:10
14500 -- (-793.021) (-780.300) (-789.626) [-781.083] * (-779.696) [-786.012] (-781.727) (-790.805) -- 0:01:07
15000 -- (-798.589) [-785.511] (-799.792) (-780.999) * (-780.922) (-788.898) [-780.860] (-791.533) -- 0:01:05
Average standard deviation of split frequencies: 0.054506
15500 -- (-796.610) (-779.119) (-795.865) [-781.946] * (-784.913) (-791.474) (-779.525) [-789.640] -- 0:01:03
16000 -- (-795.127) (-778.893) [-786.851] (-781.328) * (-783.416) [-792.620] (-780.522) (-795.846) -- 0:01:01
16500 -- [-781.342] (-780.259) (-791.519) (-783.255) * (-782.523) (-794.710) (-780.981) [-784.675] -- 0:00:59
17000 -- (-779.462) (-780.134) (-795.500) [-784.306] * (-781.287) (-794.778) (-781.236) [-790.318] -- 0:00:57
17500 -- (-782.268) [-782.812] (-795.534) (-788.121) * (-779.782) (-788.342) (-780.590) [-786.562] -- 0:00:56
18000 -- (-781.461) (-781.016) [-784.292] (-782.936) * [-785.376] (-787.634) (-780.005) (-790.887) -- 0:00:54
18500 -- (-784.606) [-780.449] (-803.253) (-785.089) * [-784.429] (-797.250) (-781.282) (-793.964) -- 0:00:53
19000 -- (-785.014) [-780.570] (-790.287) (-788.459) * (-782.305) (-789.940) [-781.695] (-789.874) -- 0:00:51
19500 -- (-783.765) [-779.705] (-781.424) (-784.440) * (-781.796) (-789.879) [-779.479] (-791.671) -- 0:01:40
20000 -- [-781.324] (-779.480) (-780.940) (-783.211) * (-779.290) (-791.836) [-780.197] (-789.405) -- 0:01:38
Average standard deviation of split frequencies: 0.041818
20500 -- (-780.478) (-780.885) (-780.923) [-779.141] * [-780.645] (-805.225) (-783.265) (-784.014) -- 0:01:35
21000 -- (-784.639) (-781.133) (-779.087) [-781.201] * [-779.216] (-789.722) (-785.393) (-782.600) -- 0:01:33
21500 -- (-779.298) [-781.478] (-783.658) (-780.100) * [-782.302] (-781.849) (-782.213) (-780.919) -- 0:01:31
22000 -- (-780.028) (-779.239) [-781.484] (-781.028) * (-780.717) (-781.084) (-782.973) [-781.114] -- 0:01:28
22500 -- [-783.947] (-782.216) (-778.645) (-778.754) * (-780.131) (-782.149) [-784.241] (-780.956) -- 0:01:26
23000 -- (-786.210) (-780.143) (-779.374) [-779.412] * [-779.546] (-781.254) (-779.537) (-782.109) -- 0:01:24
23500 -- (-784.441) (-779.261) (-781.271) [-782.959] * (-781.141) [-780.440] (-786.207) (-781.978) -- 0:01:23
24000 -- (-780.862) (-780.923) (-782.825) [-781.552] * (-780.347) (-780.957) [-780.085] (-778.717) -- 0:01:21
24500 -- [-783.370] (-779.432) (-781.983) (-780.254) * (-782.634) [-782.566] (-781.164) (-778.943) -- 0:01:19
25000 -- (-784.935) [-780.231] (-786.683) (-786.139) * (-781.656) (-782.427) [-779.857] (-781.682) -- 0:01:18
Average standard deviation of split frequencies: 0.044503
25500 -- (-781.939) (-782.069) (-782.662) [-785.145] * (-780.566) (-784.532) [-782.465] (-779.440) -- 0:01:16
26000 -- (-782.663) [-782.412] (-780.620) (-786.509) * (-780.648) (-783.945) [-780.862] (-780.337) -- 0:01:14
26500 -- (-781.751) (-782.090) (-781.815) [-784.291] * (-779.615) (-780.449) (-781.102) [-779.732] -- 0:01:13
27000 -- (-779.000) (-779.386) [-780.554] (-781.100) * [-779.087] (-782.261) (-779.865) (-781.055) -- 0:01:12
27500 -- [-779.027] (-780.425) (-779.121) (-785.859) * [-779.215] (-784.359) (-779.676) (-782.425) -- 0:01:10
28000 -- [-780.019] (-780.761) (-780.710) (-788.549) * (-780.673) [-779.913] (-781.128) (-782.921) -- 0:01:09
28500 -- (-779.520) [-781.089] (-779.895) (-782.745) * (-780.159) [-780.533] (-779.022) (-779.823) -- 0:01:08
29000 -- (-779.520) (-784.821) (-782.001) [-781.450] * (-779.755) (-779.812) (-780.014) [-780.147] -- 0:01:06
29500 -- [-781.069] (-781.596) (-780.898) (-781.706) * (-779.905) (-780.533) [-781.013] (-781.108) -- 0:01:05
30000 -- (-781.552) [-780.670] (-782.063) (-779.994) * (-783.415) [-781.923] (-780.054) (-784.122) -- 0:01:04
Average standard deviation of split frequencies: 0.038025
30500 -- (-779.626) (-780.025) (-779.971) [-781.322] * [-781.133] (-780.477) (-781.184) (-780.818) -- 0:01:03
31000 -- (-781.295) [-779.992] (-780.829) (-780.417) * (-782.958) [-779.679] (-783.072) (-779.910) -- 0:01:02
31500 -- (-781.003) [-783.429] (-780.634) (-780.476) * (-785.405) (-780.975) [-782.865] (-780.511) -- 0:01:01
32000 -- (-786.499) (-782.402) (-782.224) [-779.257] * [-788.951] (-781.280) (-781.008) (-784.087) -- 0:01:00
32500 -- [-783.638] (-785.706) (-784.102) (-779.933) * (-786.316) (-780.901) (-781.039) [-782.010] -- 0:00:59
33000 -- (-783.489) (-782.071) [-782.284] (-781.684) * (-783.666) (-782.701) (-779.423) [-780.864] -- 0:00:58
33500 -- (-780.636) (-779.801) [-780.865] (-780.925) * (-781.006) (-782.896) (-780.268) [-782.559] -- 0:00:57
34000 -- [-780.905] (-779.784) (-781.312) (-782.942) * [-783.509] (-781.558) (-779.265) (-781.872) -- 0:00:56
34500 -- (-779.505) (-779.255) [-784.375] (-782.260) * (-781.857) (-782.663) [-778.705] (-781.068) -- 0:00:55
35000 -- [-779.386] (-780.804) (-784.228) (-781.308) * (-781.323) (-780.150) (-780.957) [-781.181] -- 0:00:55
Average standard deviation of split frequencies: 0.051689
35500 -- (-780.193) (-780.100) [-779.246] (-780.149) * (-782.350) (-779.675) (-780.136) [-782.679] -- 0:00:54
36000 -- (-779.201) (-783.371) [-779.972] (-785.470) * [-783.568] (-781.879) (-780.174) (-780.506) -- 0:01:20
36500 -- (-779.634) (-780.328) [-780.120] (-784.622) * (-781.895) (-781.680) [-779.975] (-779.743) -- 0:01:19
37000 -- (-780.083) [-780.328] (-782.799) (-780.458) * (-780.357) [-781.272] (-779.931) (-781.480) -- 0:01:18
37500 -- (-782.466) (-779.757) (-783.439) [-778.840] * [-778.718] (-781.356) (-781.753) (-780.608) -- 0:01:17
38000 -- [-782.400] (-779.769) (-781.545) (-779.711) * [-781.216] (-782.176) (-781.203) (-781.557) -- 0:01:15
38500 -- (-779.660) [-779.262] (-781.665) (-781.254) * (-780.654) [-781.098] (-780.509) (-781.429) -- 0:01:14
39000 -- (-782.374) [-781.362] (-782.054) (-779.195) * [-780.447] (-779.120) (-781.566) (-782.389) -- 0:01:13
39500 -- (-780.744) [-781.755] (-780.776) (-781.051) * (-779.333) (-779.336) (-780.284) [-784.477] -- 0:01:12
40000 -- (-784.201) (-782.892) [-782.735] (-784.348) * (-779.587) [-780.114] (-781.579) (-785.236) -- 0:01:12
Average standard deviation of split frequencies: 0.039046
40500 -- (-779.743) [-779.039] (-780.360) (-780.464) * (-780.636) [-780.101] (-780.648) (-783.805) -- 0:01:11
41000 -- (-782.506) (-784.216) [-778.878] (-778.974) * (-783.091) (-780.788) (-782.615) [-781.044] -- 0:01:10
41500 -- [-781.441] (-781.403) (-779.584) (-779.497) * (-787.621) (-779.271) (-780.862) [-780.273] -- 0:01:09
42000 -- (-780.501) (-782.592) (-779.485) [-779.374] * (-781.738) [-779.122] (-783.717) (-783.183) -- 0:01:08
42500 -- (-780.117) (-781.593) (-782.033) [-778.626] * [-782.207] (-780.104) (-782.916) (-780.218) -- 0:01:07
43000 -- (-782.843) (-780.590) (-782.575) [-778.623] * (-780.605) (-781.744) [-780.650] (-780.679) -- 0:01:06
43500 -- [-780.742] (-782.113) (-782.734) (-779.401) * (-780.733) (-781.531) [-782.053] (-783.554) -- 0:01:05
44000 -- (-780.032) (-779.646) (-781.769) [-780.872] * (-781.072) (-781.180) [-780.797] (-780.753) -- 0:01:05
44500 -- (-780.764) (-783.274) (-779.125) [-781.227] * (-783.282) (-781.112) [-779.933] (-782.701) -- 0:01:04
45000 -- (-779.776) (-780.464) (-780.042) [-781.428] * (-784.850) (-781.484) (-779.818) [-785.266] -- 0:01:03
Average standard deviation of split frequencies: 0.034160
45500 -- (-781.073) (-781.824) [-780.346] (-781.961) * [-784.912] (-783.340) (-779.675) (-782.289) -- 0:01:02
46000 -- (-778.500) (-781.964) (-778.938) [-783.098] * (-781.629) (-779.866) [-779.976] (-783.219) -- 0:01:02
46500 -- (-780.480) (-781.325) [-778.794] (-782.525) * (-786.016) (-779.799) (-779.349) [-784.690] -- 0:01:01
47000 -- (-780.724) (-779.103) [-778.822] (-779.898) * (-784.212) (-781.836) (-780.011) [-780.047] -- 0:01:00
47500 -- (-781.634) [-781.459] (-782.939) (-778.824) * [-784.097] (-781.270) (-780.316) (-785.344) -- 0:01:00
48000 -- [-786.002] (-779.565) (-779.269) (-781.564) * [-779.394] (-783.341) (-779.775) (-780.781) -- 0:00:59
48500 -- [-780.898] (-780.361) (-782.301) (-778.924) * (-780.122) (-782.246) (-780.600) [-780.838] -- 0:00:58
49000 -- (-779.891) [-779.433] (-781.531) (-780.150) * [-779.738] (-782.040) (-779.469) (-779.562) -- 0:00:58
49500 -- [-780.028] (-780.358) (-780.456) (-780.734) * [-780.234] (-781.717) (-779.674) (-783.402) -- 0:00:57
50000 -- [-779.227] (-781.033) (-780.571) (-782.417) * (-785.822) (-781.044) (-781.142) [-780.049] -- 0:00:57
Average standard deviation of split frequencies: 0.028355
50500 -- (-780.278) (-786.072) [-781.293] (-780.619) * (-782.704) (-780.293) (-779.339) [-779.620] -- 0:00:56
51000 -- (-780.832) (-781.061) (-780.662) [-778.784] * (-783.032) (-781.448) (-780.285) [-782.971] -- 0:00:55
51500 -- (-781.314) (-781.941) [-780.237] (-781.243) * (-782.181) (-782.753) (-782.813) [-781.061] -- 0:00:55
52000 -- (-781.425) (-781.775) [-781.693] (-783.554) * (-780.637) (-781.203) [-780.093] (-779.858) -- 0:01:12
52500 -- [-780.729] (-782.997) (-779.787) (-779.520) * (-781.919) [-786.004] (-780.138) (-780.845) -- 0:01:12
53000 -- [-782.390] (-784.515) (-779.931) (-782.446) * (-782.060) [-781.883] (-779.102) (-780.085) -- 0:01:11
53500 -- (-780.125) [-780.748] (-780.622) (-781.090) * (-781.071) (-781.150) (-782.382) [-780.276] -- 0:01:10
54000 -- [-780.607] (-781.058) (-781.989) (-781.614) * (-780.183) (-784.026) [-779.008] (-778.925) -- 0:01:10
54500 -- (-779.823) (-779.686) [-780.642] (-785.407) * (-781.070) (-779.587) [-780.752] (-781.245) -- 0:01:09
55000 -- [-779.416] (-779.514) (-783.391) (-782.511) * [-781.295] (-779.784) (-778.715) (-780.466) -- 0:01:08
Average standard deviation of split frequencies: 0.031457
55500 -- (-783.030) (-780.105) [-780.108] (-781.962) * (-782.212) [-780.912] (-782.137) (-780.614) -- 0:01:08
56000 -- (-780.504) (-780.168) (-782.031) [-781.955] * (-780.593) [-779.202] (-781.288) (-781.955) -- 0:01:07
56500 -- (-783.077) [-779.669] (-781.733) (-779.989) * (-780.399) [-781.760] (-779.708) (-783.496) -- 0:01:06
57000 -- (-781.972) (-780.989) [-779.860] (-780.354) * (-782.995) [-781.671] (-781.270) (-781.049) -- 0:01:06
57500 -- (-786.724) [-779.157] (-780.637) (-780.725) * (-780.627) [-780.081] (-780.488) (-780.884) -- 0:01:05
58000 -- (-782.932) (-779.714) (-780.106) [-779.784] * [-780.749] (-779.518) (-780.360) (-779.858) -- 0:01:04
58500 -- [-784.381] (-782.515) (-780.956) (-781.862) * (-780.041) [-778.788] (-782.732) (-779.418) -- 0:01:04
59000 -- (-783.290) [-784.037] (-781.932) (-783.016) * (-779.283) (-781.826) (-784.499) [-779.412] -- 0:01:03
59500 -- [-784.842] (-781.735) (-781.374) (-781.835) * (-779.327) [-781.189] (-786.016) (-780.710) -- 0:01:03
60000 -- (-781.835) [-780.458] (-781.887) (-779.980) * (-779.815) [-783.026] (-781.114) (-779.587) -- 0:01:02
Average standard deviation of split frequencies: 0.030342
60500 -- [-779.536] (-780.448) (-782.401) (-780.668) * (-779.286) [-779.390] (-779.837) (-779.523) -- 0:01:02
61000 -- (-780.096) (-781.081) [-783.831] (-780.799) * (-780.145) [-779.119] (-783.143) (-781.067) -- 0:01:01
61500 -- [-778.978] (-783.098) (-781.235) (-779.618) * (-780.394) (-780.745) [-780.353] (-780.913) -- 0:01:01
62000 -- [-780.462] (-783.515) (-781.487) (-780.470) * (-780.675) (-780.537) (-783.266) [-780.955] -- 0:01:00
62500 -- (-784.877) (-782.754) (-781.130) [-781.843] * (-780.767) [-780.925] (-780.565) (-780.222) -- 0:01:00
63000 -- (-786.337) (-781.162) [-780.191] (-781.776) * [-781.474] (-782.797) (-781.765) (-780.024) -- 0:00:59
63500 -- (-787.279) (-782.922) [-780.945] (-781.214) * [-779.704] (-783.007) (-781.467) (-782.010) -- 0:00:58
64000 -- [-779.074] (-783.658) (-780.145) (-781.469) * [-780.456] (-779.368) (-782.316) (-780.357) -- 0:00:58
64500 -- (-782.465) (-785.207) [-780.963] (-785.618) * [-780.882] (-779.881) (-779.791) (-786.643) -- 0:00:58
65000 -- (-780.993) (-780.160) [-781.646] (-783.646) * (-781.079) [-779.662] (-782.580) (-783.891) -- 0:00:57
Average standard deviation of split frequencies: 0.029284
65500 -- (-784.087) [-779.956] (-781.192) (-782.165) * (-785.264) [-781.757] (-783.000) (-784.292) -- 0:00:57
66000 -- (-780.537) (-781.844) (-782.615) [-779.994] * (-782.074) (-781.535) [-779.374] (-781.519) -- 0:00:56
66500 -- (-779.571) (-780.349) [-779.825] (-779.210) * (-780.452) [-781.341] (-780.807) (-781.654) -- 0:00:56
67000 -- (-780.663) (-780.380) [-781.365] (-781.856) * (-780.600) (-780.944) (-780.098) [-780.239] -- 0:01:09
67500 -- (-779.518) (-780.074) [-784.183] (-779.055) * (-780.677) (-781.476) (-781.595) [-779.515] -- 0:01:09
68000 -- (-779.634) (-779.895) [-781.566] (-780.165) * (-779.909) (-781.138) [-779.902] (-779.848) -- 0:01:08
68500 -- (-779.682) [-782.122] (-781.747) (-780.694) * (-781.355) (-780.232) [-779.141] (-780.239) -- 0:01:07
69000 -- (-780.374) (-779.956) [-779.862] (-780.786) * (-783.782) [-780.304] (-781.804) (-780.538) -- 0:01:07
69500 -- (-779.375) (-780.812) (-782.216) [-783.467] * (-780.339) (-781.596) [-779.939] (-779.015) -- 0:01:06
70000 -- (-780.151) [-781.216] (-782.938) (-781.190) * [-782.810] (-779.179) (-781.619) (-780.703) -- 0:01:06
Average standard deviation of split frequencies: 0.026016
70500 -- (-781.376) (-781.459) (-781.301) [-780.214] * (-780.864) [-781.846] (-779.906) (-781.053) -- 0:01:05
71000 -- [-779.478] (-782.823) (-782.138) (-783.564) * (-780.802) [-780.650] (-780.790) (-778.535) -- 0:01:05
71500 -- (-780.044) (-779.436) [-779.534] (-781.897) * (-782.661) [-780.781] (-779.735) (-779.819) -- 0:01:04
72000 -- (-779.987) (-779.479) (-780.916) [-778.922] * (-779.817) (-781.388) (-780.532) [-779.745] -- 0:01:04
72500 -- (-779.596) (-781.006) (-782.192) [-779.948] * (-779.370) [-781.177] (-779.597) (-780.384) -- 0:01:03
73000 -- (-781.140) (-781.847) (-780.950) [-778.862] * [-782.402] (-779.597) (-779.601) (-779.982) -- 0:01:03
73500 -- (-783.075) (-781.285) (-782.433) [-779.592] * (-784.141) (-779.500) (-779.701) [-781.831] -- 0:01:03
74000 -- (-782.865) (-779.824) [-780.028] (-781.444) * (-781.144) (-780.988) [-780.347] (-780.720) -- 0:01:02
74500 -- (-781.225) (-780.366) [-780.453] (-780.480) * (-780.396) [-781.390] (-782.285) (-780.435) -- 0:01:02
75000 -- (-783.642) (-782.380) (-780.432) [-780.360] * (-780.112) [-783.557] (-781.875) (-781.285) -- 0:01:01
Average standard deviation of split frequencies: 0.029463
75500 -- (-780.157) (-781.454) [-783.135] (-780.251) * (-780.961) (-781.026) (-782.770) [-782.032] -- 0:01:01
76000 -- (-779.646) [-778.783] (-784.833) (-780.000) * (-779.738) (-781.709) [-779.891] (-779.716) -- 0:01:00
76500 -- (-780.706) [-781.358] (-782.581) (-780.681) * (-779.615) [-780.753] (-780.378) (-780.756) -- 0:01:00
77000 -- [-779.970] (-780.877) (-785.435) (-779.366) * (-784.797) (-781.799) (-781.067) [-781.212] -- 0:00:59
77500 -- [-783.698] (-781.379) (-782.157) (-780.417) * (-781.044) [-785.443] (-781.486) (-782.225) -- 0:00:59
78000 -- [-783.380] (-781.147) (-782.215) (-779.730) * (-781.250) [-788.747] (-783.315) (-783.613) -- 0:00:59
78500 -- (-780.990) [-780.888] (-779.677) (-781.098) * (-781.444) (-782.332) [-779.364] (-783.822) -- 0:00:58
79000 -- (-782.199) (-780.958) (-780.837) [-781.147] * (-780.802) (-779.691) [-779.353] (-780.562) -- 0:00:58
79500 -- (-782.455) (-780.055) [-781.152] (-782.735) * (-781.212) (-779.520) (-781.534) [-779.860] -- 0:00:57
80000 -- (-781.849) [-780.460] (-780.719) (-780.217) * (-781.245) [-779.472] (-779.766) (-779.424) -- 0:00:57
Average standard deviation of split frequencies: 0.030388
80500 -- (-785.419) (-781.241) [-780.658] (-779.621) * [-782.361] (-779.508) (-779.447) (-779.862) -- 0:00:57
81000 -- [-780.903] (-782.124) (-779.143) (-780.856) * [-780.384] (-780.034) (-781.212) (-778.878) -- 0:00:56
81500 -- [-781.699] (-782.160) (-780.086) (-780.730) * [-778.942] (-784.487) (-780.642) (-785.007) -- 0:00:56
82000 -- (-781.271) (-779.323) (-780.062) [-780.274] * (-779.364) (-782.738) [-780.027] (-780.634) -- 0:01:07
82500 -- (-779.987) (-778.623) [-779.053] (-781.085) * (-782.387) [-781.178] (-780.738) (-783.819) -- 0:01:06
83000 -- (-781.764) (-781.094) [-781.390] (-783.105) * [-780.441] (-781.538) (-779.986) (-783.677) -- 0:01:06
83500 -- (-779.615) (-779.899) (-781.601) [-779.678] * [-779.715] (-779.320) (-782.632) (-780.512) -- 0:01:05
84000 -- [-784.366] (-781.490) (-782.352) (-782.617) * (-779.973) [-780.089] (-782.484) (-781.127) -- 0:01:05
84500 -- (-779.761) (-778.879) [-782.805] (-780.662) * (-779.509) (-784.212) [-779.608] (-781.089) -- 0:01:05
85000 -- [-779.136] (-779.961) (-778.677) (-779.159) * [-783.440] (-780.025) (-780.998) (-783.835) -- 0:01:04
Average standard deviation of split frequencies: 0.030148
85500 -- (-779.299) [-782.235] (-779.959) (-779.776) * (-784.927) (-780.507) (-780.296) [-779.055] -- 0:01:04
86000 -- [-779.386] (-779.671) (-783.582) (-780.433) * (-778.664) (-779.701) (-778.985) [-778.778] -- 0:01:03
86500 -- (-780.052) (-782.300) (-780.310) [-781.702] * [-778.489] (-780.489) (-780.112) (-779.584) -- 0:01:03
87000 -- [-780.921] (-779.879) (-779.601) (-780.547) * (-781.325) (-781.630) (-781.044) [-781.206] -- 0:01:02
87500 -- (-780.875) [-778.707] (-779.838) (-780.690) * (-782.856) (-781.857) (-779.394) [-784.806] -- 0:01:02
88000 -- (-780.401) (-780.282) (-779.808) [-781.686] * (-780.636) [-779.351] (-779.024) (-785.898) -- 0:01:02
88500 -- (-780.054) (-782.127) [-778.677] (-780.502) * (-779.977) (-779.533) [-779.670] (-779.769) -- 0:01:01
89000 -- [-779.256] (-780.424) (-779.165) (-780.773) * [-782.024] (-779.535) (-780.436) (-779.570) -- 0:01:01
89500 -- (-780.806) (-779.947) (-779.749) [-781.935] * (-781.615) (-783.041) (-779.622) [-781.036] -- 0:01:01
90000 -- [-780.779] (-778.915) (-779.481) (-783.178) * [-779.274] (-780.230) (-781.600) (-780.832) -- 0:01:00
Average standard deviation of split frequencies: 0.029069
90500 -- (-782.866) (-781.113) (-779.234) [-779.706] * (-780.977) (-779.937) [-780.476] (-784.176) -- 0:01:00
91000 -- (-781.492) (-780.654) (-778.889) [-781.808] * (-780.762) (-779.039) [-779.953] (-783.544) -- 0:00:59
91500 -- (-780.525) (-780.701) (-781.378) [-778.976] * (-780.225) (-779.555) (-782.882) [-782.268] -- 0:00:59
92000 -- (-783.436) (-781.163) (-787.445) [-781.995] * (-779.941) (-780.756) [-781.584] (-784.841) -- 0:00:59
92500 -- [-780.743] (-781.652) (-787.453) (-781.449) * (-784.126) [-779.702] (-780.785) (-779.788) -- 0:00:58
93000 -- (-780.160) [-781.324] (-782.589) (-782.817) * (-789.102) (-778.817) (-780.034) [-779.673] -- 0:00:58
93500 -- [-780.177] (-785.577) (-779.321) (-781.449) * (-783.759) (-784.234) (-784.338) [-781.082] -- 0:00:58
94000 -- (-781.743) [-779.713] (-779.361) (-782.108) * (-783.074) [-780.488] (-786.287) (-779.685) -- 0:00:57
94500 -- (-780.096) (-779.543) [-779.306] (-779.421) * (-782.350) [-782.253] (-780.269) (-781.225) -- 0:00:57
95000 -- (-779.650) [-780.272] (-780.746) (-779.729) * [-778.901] (-782.732) (-786.343) (-785.948) -- 0:00:57
Average standard deviation of split frequencies: 0.022767
95500 -- (-780.096) (-780.641) [-780.232] (-779.723) * [-779.784] (-784.588) (-785.385) (-787.964) -- 0:00:56
96000 -- [-780.657] (-782.342) (-780.590) (-784.901) * (-784.253) (-779.069) [-780.506] (-780.961) -- 0:00:56
96500 -- [-780.603] (-779.902) (-779.391) (-780.757) * (-783.209) (-783.087) [-779.396] (-781.542) -- 0:00:56
97000 -- (-780.272) [-778.957] (-780.599) (-784.687) * (-782.475) (-784.324) [-782.555] (-780.079) -- 0:00:55
97500 -- (-780.042) (-778.611) [-780.492] (-787.586) * [-780.569] (-779.270) (-786.312) (-782.031) -- 0:01:04
98000 -- [-778.688] (-779.961) (-780.796) (-781.441) * (-785.308) (-781.998) [-781.112] (-782.520) -- 0:01:04
98500 -- [-779.385] (-780.073) (-781.650) (-780.023) * (-786.461) (-780.956) [-780.862] (-783.329) -- 0:01:04
99000 -- (-779.295) (-779.470) [-782.193] (-781.154) * (-782.231) (-782.513) [-779.689] (-782.207) -- 0:01:03
99500 -- (-779.112) (-779.567) (-781.001) [-782.103] * (-782.381) (-782.216) [-782.866] (-781.363) -- 0:01:03
100000 -- (-782.624) [-779.084] (-781.631) (-781.683) * (-780.682) [-779.364] (-781.558) (-779.555) -- 0:01:02
Average standard deviation of split frequencies: 0.019668
100500 -- (-780.120) (-785.801) [-779.620] (-783.346) * (-779.008) [-780.375] (-780.590) (-781.972) -- 0:01:02
101000 -- [-779.457] (-784.042) (-781.994) (-781.231) * (-780.749) (-781.797) [-782.851] (-782.214) -- 0:01:02
101500 -- (-785.844) (-779.315) (-781.631) [-783.205] * [-781.396] (-779.781) (-781.099) (-779.799) -- 0:01:01
102000 -- (-781.592) (-780.307) [-779.827] (-781.075) * (-779.148) (-779.761) (-779.771) [-780.118] -- 0:01:01
102500 -- (-779.060) [-783.962] (-780.045) (-780.526) * (-780.540) (-782.100) (-783.442) [-779.758] -- 0:01:01
103000 -- (-779.274) (-784.392) [-779.846] (-784.279) * (-787.750) (-781.387) [-783.074] (-779.724) -- 0:01:00
103500 -- [-781.118] (-780.311) (-781.083) (-781.014) * [-785.445] (-782.052) (-781.799) (-780.241) -- 0:01:00
104000 -- (-780.148) (-781.267) [-779.705] (-780.432) * (-779.148) [-779.978] (-780.732) (-781.354) -- 0:01:00
104500 -- (-780.366) [-780.982] (-779.700) (-780.547) * (-779.913) [-784.123] (-780.940) (-782.456) -- 0:00:59
105000 -- [-779.053] (-778.944) (-780.713) (-788.147) * (-785.102) (-781.793) [-782.384] (-781.646) -- 0:00:59
Average standard deviation of split frequencies: 0.018678
105500 -- (-780.061) (-779.952) [-780.650] (-782.718) * (-782.307) (-781.746) [-780.127] (-781.259) -- 0:00:59
106000 -- (-783.437) (-779.810) [-780.469] (-780.128) * (-780.408) [-781.396] (-780.306) (-782.248) -- 0:00:59
106500 -- (-779.111) [-780.909] (-780.489) (-782.182) * [-781.758] (-782.950) (-780.182) (-782.097) -- 0:00:58
107000 -- (-780.781) (-779.318) (-782.588) [-779.167] * (-779.092) (-781.291) (-781.269) [-779.680] -- 0:00:58
107500 -- (-778.855) (-781.608) [-779.376] (-784.151) * (-779.544) (-782.725) [-780.622] (-780.121) -- 0:00:58
108000 -- (-782.953) (-779.577) [-779.031] (-778.775) * (-780.348) (-779.056) (-785.808) [-781.248] -- 0:00:57
108500 -- (-782.052) (-780.528) [-780.173] (-783.391) * (-780.457) (-780.227) (-783.082) [-781.148] -- 0:00:57
109000 -- [-780.603] (-780.780) (-783.725) (-784.285) * [-782.736] (-779.979) (-783.725) (-779.137) -- 0:00:57
109500 -- [-780.827] (-781.165) (-779.118) (-781.368) * [-783.727] (-779.953) (-785.254) (-780.015) -- 0:00:56
110000 -- (-781.541) (-784.662) [-779.158] (-779.660) * (-782.889) (-779.673) (-784.973) [-781.042] -- 0:00:56
Average standard deviation of split frequencies: 0.020020
110500 -- (-780.536) [-782.584] (-781.792) (-778.741) * [-781.540] (-780.181) (-779.267) (-781.688) -- 0:00:56
111000 -- (-784.243) (-781.841) (-779.173) [-780.096] * [-781.009] (-782.699) (-779.604) (-779.620) -- 0:00:56
111500 -- [-778.794] (-783.627) (-779.258) (-781.393) * (-779.866) (-781.573) (-783.090) [-778.897] -- 0:00:55
112000 -- [-780.845] (-781.894) (-781.587) (-780.240) * (-781.444) (-784.722) (-789.832) [-780.070] -- 0:00:55
112500 -- (-783.385) (-781.320) (-779.336) [-781.737] * (-781.135) (-783.023) (-780.952) [-784.194] -- 0:00:55
113000 -- [-779.705] (-781.165) (-779.576) (-780.738) * (-780.653) (-780.790) (-779.941) [-780.442] -- 0:01:02
113500 -- (-779.612) (-783.372) [-779.292] (-784.089) * (-783.287) [-779.742] (-780.371) (-782.597) -- 0:01:02
114000 -- [-780.792] (-781.894) (-780.138) (-780.425) * [-779.938] (-780.849) (-779.435) (-781.645) -- 0:01:02
114500 -- (-782.249) (-782.115) [-779.312] (-780.841) * (-778.974) (-781.055) [-778.576] (-781.484) -- 0:01:01
115000 -- (-784.081) [-782.184] (-780.597) (-780.467) * (-781.429) (-782.661) (-779.034) [-778.706] -- 0:01:01
Average standard deviation of split frequencies: 0.018084
115500 -- (-791.408) (-785.360) (-781.108) [-780.322] * (-781.515) [-780.701] (-779.273) (-783.249) -- 0:01:01
116000 -- [-783.032] (-782.968) (-780.882) (-787.942) * (-781.048) (-780.229) [-780.358] (-783.649) -- 0:01:00
116500 -- (-785.097) [-779.468] (-781.980) (-783.753) * (-780.526) (-779.607) (-781.233) [-779.151] -- 0:01:00
117000 -- (-782.108) (-783.017) [-778.976] (-785.179) * (-779.303) (-781.612) [-782.390] (-780.841) -- 0:01:00
117500 -- (-784.515) [-778.642] (-778.640) (-781.801) * [-780.710] (-780.900) (-780.020) (-780.619) -- 0:01:00
118000 -- [-779.101] (-779.798) (-778.680) (-782.290) * (-782.008) [-778.980] (-781.556) (-781.338) -- 0:00:59
118500 -- (-781.816) (-779.193) (-779.913) [-779.718] * (-780.041) (-779.656) (-780.024) [-780.209] -- 0:00:59
119000 -- (-781.054) [-779.925] (-781.473) (-779.367) * (-779.150) (-779.948) (-779.266) [-779.679] -- 0:00:59
119500 -- [-780.173] (-780.985) (-778.800) (-779.403) * [-783.428] (-779.813) (-780.327) (-781.926) -- 0:00:58
120000 -- [-780.915] (-781.487) (-780.267) (-781.549) * [-779.762] (-783.839) (-779.561) (-780.960) -- 0:00:58
Average standard deviation of split frequencies: 0.018094
120500 -- (-778.680) (-780.115) (-780.434) [-779.921] * [-780.456] (-782.771) (-783.133) (-779.088) -- 0:00:58
121000 -- (-780.024) (-780.727) [-781.096] (-780.764) * (-781.215) (-782.223) [-779.485] (-779.537) -- 0:00:58
121500 -- (-780.221) (-782.067) [-779.866] (-780.810) * [-782.693] (-784.411) (-781.562) (-779.055) -- 0:00:57
122000 -- (-779.851) (-779.397) (-779.982) [-779.897] * (-781.752) [-784.908] (-781.558) (-781.116) -- 0:00:57
122500 -- (-779.813) (-779.417) [-781.114] (-783.480) * [-780.669] (-782.288) (-783.601) (-779.145) -- 0:00:57
123000 -- (-779.865) [-781.570] (-779.587) (-785.630) * (-779.747) [-780.177] (-784.840) (-779.613) -- 0:00:57
123500 -- (-781.106) (-781.182) (-779.249) [-779.830] * [-780.425] (-779.689) (-786.305) (-779.805) -- 0:00:56
124000 -- (-785.721) (-780.622) (-780.024) [-779.517] * [-782.708] (-779.907) (-780.622) (-779.508) -- 0:00:56
124500 -- (-779.722) [-779.760] (-780.875) (-780.509) * (-780.573) [-781.149] (-782.986) (-782.402) -- 0:00:56
125000 -- (-779.586) (-779.793) (-780.667) [-779.445] * (-780.284) (-778.771) (-779.182) [-780.901] -- 0:00:56
Average standard deviation of split frequencies: 0.017994
125500 -- (-780.483) (-781.953) [-780.659] (-779.971) * [-779.494] (-780.083) (-779.304) (-779.816) -- 0:00:55
126000 -- (-780.376) (-787.270) [-780.562] (-780.442) * (-780.594) [-780.181] (-779.242) (-780.064) -- 0:00:55
126500 -- (-780.504) [-780.537] (-782.555) (-781.021) * (-779.870) (-780.569) (-779.657) [-782.582] -- 0:00:55
127000 -- (-782.003) [-782.429] (-782.220) (-783.053) * (-779.202) [-780.664] (-780.851) (-781.347) -- 0:00:54
127500 -- (-781.114) (-780.896) (-778.762) [-780.982] * [-779.949] (-781.729) (-779.203) (-783.354) -- 0:00:54
128000 -- [-782.407] (-779.920) (-780.448) (-779.693) * (-781.255) (-780.319) [-779.457] (-782.040) -- 0:00:54
128500 -- (-783.848) (-780.360) [-779.814] (-781.587) * (-785.012) (-781.159) [-782.289] (-781.962) -- 0:00:54
129000 -- (-779.347) (-780.520) (-779.577) [-785.169] * (-780.364) (-781.293) (-782.352) [-780.507] -- 0:01:00
129500 -- (-778.913) [-782.430] (-781.484) (-784.398) * [-780.168] (-781.542) (-781.145) (-781.705) -- 0:01:00
130000 -- (-779.335) [-781.832] (-779.011) (-781.318) * (-783.578) (-781.071) [-780.564] (-781.947) -- 0:01:00
Average standard deviation of split frequencies: 0.014972
130500 -- (-783.698) [-780.746] (-779.984) (-781.839) * (-786.514) (-781.643) [-780.114] (-780.220) -- 0:00:59
131000 -- (-779.808) [-782.409] (-780.703) (-783.608) * (-781.024) [-780.525] (-780.396) (-779.844) -- 0:00:59
131500 -- (-779.088) (-779.377) [-779.277] (-782.849) * (-781.247) (-784.202) [-779.079] (-779.835) -- 0:00:59
132000 -- (-781.568) [-780.801] (-779.455) (-780.552) * [-783.628] (-785.629) (-781.398) (-780.071) -- 0:00:59
132500 -- (-783.471) (-782.223) [-779.142] (-778.977) * (-783.111) (-781.592) [-778.681] (-780.586) -- 0:00:58
133000 -- [-782.559] (-782.771) (-780.876) (-782.640) * (-781.040) [-779.433] (-779.512) (-780.958) -- 0:00:58
133500 -- (-781.486) (-785.372) (-782.773) [-782.215] * (-778.964) (-782.436) [-778.822] (-789.107) -- 0:00:58
134000 -- (-783.285) [-781.713] (-782.064) (-780.440) * (-781.221) [-778.622] (-779.627) (-787.249) -- 0:00:58
134500 -- (-784.398) (-781.416) (-782.351) [-781.756] * [-781.397] (-779.288) (-781.025) (-784.110) -- 0:00:57
135000 -- (-782.452) (-781.309) (-781.853) [-781.301] * (-782.096) (-791.236) [-782.216] (-781.884) -- 0:00:57
Average standard deviation of split frequencies: 0.018243
135500 -- (-780.602) [-779.854] (-782.987) (-783.125) * [-782.296] (-786.404) (-783.044) (-780.581) -- 0:00:57
136000 -- [-779.522] (-783.515) (-780.458) (-780.731) * [-780.109] (-781.569) (-779.608) (-779.941) -- 0:00:57
136500 -- (-780.047) (-781.469) (-781.344) [-778.912] * (-779.621) [-782.882] (-780.223) (-781.059) -- 0:00:56
137000 -- (-779.620) (-781.200) [-784.592] (-783.378) * (-779.117) (-783.906) (-779.553) [-780.496] -- 0:00:56
137500 -- (-779.491) [-780.668] (-784.322) (-779.409) * (-778.998) (-783.113) [-781.190] (-779.384) -- 0:00:56
138000 -- (-780.115) (-781.019) (-782.643) [-779.728] * (-779.520) [-779.168] (-779.797) (-785.356) -- 0:00:56
138500 -- (-779.941) (-781.242) (-780.855) [-779.881] * [-779.428] (-783.220) (-779.544) (-781.264) -- 0:00:55
139000 -- (-779.638) (-784.772) [-783.548] (-779.917) * (-779.005) (-781.082) [-780.883] (-782.526) -- 0:00:55
139500 -- (-785.845) (-784.332) (-782.580) [-781.802] * [-779.010] (-779.031) (-780.282) (-781.784) -- 0:00:55
140000 -- (-780.690) [-780.882] (-782.305) (-780.206) * (-780.847) (-780.612) [-782.525] (-781.854) -- 0:00:55
Average standard deviation of split frequencies: 0.016580
140500 -- [-779.773] (-783.835) (-782.373) (-780.499) * [-779.117] (-782.057) (-779.714) (-781.254) -- 0:00:55
141000 -- (-786.619) [-782.377] (-781.191) (-780.075) * [-778.851] (-782.230) (-779.379) (-784.368) -- 0:00:54
141500 -- [-781.217] (-781.568) (-783.750) (-783.139) * (-778.775) (-779.515) [-780.132] (-779.579) -- 0:00:54
142000 -- (-780.917) [-779.961] (-783.618) (-781.269) * (-779.012) (-781.433) (-779.953) [-778.990] -- 0:00:54
142500 -- (-783.975) (-781.241) (-780.124) [-782.695] * (-780.306) (-780.718) [-783.536] (-780.145) -- 0:00:54
143000 -- (-784.206) (-781.596) [-781.192] (-778.636) * [-779.413] (-779.905) (-783.407) (-782.925) -- 0:00:53
143500 -- (-782.819) (-780.077) [-783.062] (-778.923) * [-781.878] (-782.358) (-787.856) (-780.016) -- 0:00:53
144000 -- [-780.895] (-781.030) (-782.520) (-782.279) * (-780.344) (-782.545) [-779.278] (-782.190) -- 0:00:53
144500 -- (-780.327) [-782.715] (-780.016) (-780.374) * [-779.953] (-782.389) (-779.557) (-780.712) -- 0:00:53
145000 -- (-779.141) (-781.972) (-781.066) [-782.128] * (-779.771) [-784.501] (-780.517) (-780.282) -- 0:00:58
Average standard deviation of split frequencies: 0.016438
145500 -- [-780.112] (-782.593) (-782.191) (-780.596) * (-781.048) (-781.718) (-781.930) [-779.124] -- 0:00:58
146000 -- (-780.702) (-780.287) [-780.963] (-779.353) * [-779.099] (-780.509) (-783.529) (-782.978) -- 0:00:58
146500 -- [-778.898] (-780.721) (-782.237) (-780.273) * [-779.486] (-781.323) (-783.303) (-780.606) -- 0:00:58
147000 -- (-779.152) [-781.463] (-783.889) (-780.169) * [-779.869] (-783.409) (-780.576) (-778.725) -- 0:00:58
147500 -- (-779.638) (-780.583) (-781.861) [-780.317] * (-779.936) [-782.354] (-779.499) (-781.051) -- 0:00:57
148000 -- (-781.121) [-783.086] (-782.034) (-780.387) * (-781.172) (-780.252) (-779.117) [-779.622] -- 0:00:57
148500 -- (-783.203) (-779.671) (-783.840) [-780.081] * (-781.163) (-782.573) [-782.612] (-780.961) -- 0:00:57
149000 -- (-779.597) (-783.011) (-785.093) [-780.136] * (-780.328) (-779.377) [-779.943] (-782.387) -- 0:00:57
149500 -- [-782.787] (-778.793) (-794.356) (-779.912) * (-780.329) (-779.404) (-784.745) [-780.696] -- 0:00:56
150000 -- (-781.860) [-779.491] (-783.863) (-782.538) * [-779.374] (-780.818) (-779.334) (-779.977) -- 0:00:56
Average standard deviation of split frequencies: 0.015048
150500 -- [-780.885] (-780.354) (-783.078) (-779.390) * [-780.156] (-778.928) (-779.956) (-781.493) -- 0:00:56
151000 -- [-779.695] (-780.687) (-779.544) (-784.997) * [-779.304] (-781.534) (-780.792) (-779.330) -- 0:00:56
151500 -- (-780.111) (-780.583) [-779.307] (-783.116) * (-780.503) (-781.379) [-779.870] (-786.539) -- 0:00:56
152000 -- (-783.588) (-780.634) [-780.859] (-781.045) * (-780.205) (-782.866) [-779.272] (-787.851) -- 0:00:55
152500 -- (-784.352) (-779.919) [-783.339] (-783.532) * (-780.926) (-784.474) (-779.439) [-783.029] -- 0:00:55
153000 -- (-784.354) (-784.120) (-780.309) [-781.762] * (-781.143) (-783.239) [-779.233] (-779.912) -- 0:00:55
153500 -- (-779.744) [-781.634] (-780.356) (-780.316) * [-778.575] (-780.512) (-779.119) (-779.876) -- 0:00:55
154000 -- [-780.245] (-782.428) (-781.270) (-789.070) * (-778.735) [-782.775] (-782.199) (-778.813) -- 0:00:54
154500 -- (-778.964) [-779.788] (-782.639) (-791.134) * [-779.421] (-780.813) (-786.027) (-779.545) -- 0:00:54
155000 -- (-779.607) [-780.264] (-781.330) (-782.135) * (-779.473) (-779.802) [-783.899] (-778.632) -- 0:00:54
Average standard deviation of split frequencies: 0.014677
155500 -- (-779.462) (-781.286) (-781.162) [-780.553] * (-779.327) (-781.107) [-781.438] (-779.579) -- 0:00:54
156000 -- [-780.289] (-781.953) (-779.572) (-782.279) * [-779.946] (-781.473) (-779.166) (-779.008) -- 0:00:54
156500 -- (-780.306) (-780.984) [-781.378] (-780.539) * (-780.509) (-781.571) (-780.339) [-778.989] -- 0:00:53
157000 -- [-779.314] (-779.878) (-785.809) (-780.382) * (-782.087) (-779.349) [-780.262] (-779.481) -- 0:00:53
157500 -- (-780.421) (-779.874) (-778.754) [-780.381] * [-779.711] (-779.668) (-779.592) (-780.275) -- 0:00:53
158000 -- (-779.558) (-781.980) (-780.009) [-780.440] * [-780.433] (-784.089) (-780.586) (-782.611) -- 0:00:53
158500 -- (-779.290) [-781.935] (-782.184) (-781.191) * [-780.579] (-782.939) (-780.910) (-781.662) -- 0:00:53
159000 -- (-779.147) (-781.802) (-779.911) [-781.310] * (-785.058) (-780.569) [-781.588] (-781.662) -- 0:00:52
159500 -- [-779.439] (-781.699) (-782.085) (-783.655) * (-783.014) (-778.684) [-779.231] (-778.827) -- 0:00:52
160000 -- [-779.982] (-782.820) (-782.309) (-783.856) * (-782.347) (-781.006) (-780.849) [-780.455] -- 0:00:52
Average standard deviation of split frequencies: 0.013133
160500 -- [-779.123] (-780.896) (-780.530) (-780.777) * (-780.477) [-781.406] (-780.257) (-782.391) -- 0:00:52
161000 -- (-780.344) (-780.439) (-788.390) [-780.289] * (-782.799) (-784.364) (-781.330) [-782.001] -- 0:00:57
161500 -- [-780.095] (-783.550) (-784.311) (-785.576) * (-779.534) (-785.258) (-780.710) [-780.044] -- 0:00:57
162000 -- (-779.919) [-780.554] (-782.884) (-782.321) * (-780.985) (-779.413) [-780.267] (-783.031) -- 0:00:56
162500 -- (-779.272) [-780.735] (-782.072) (-779.984) * (-778.840) (-779.193) (-781.413) [-783.873] -- 0:00:56
163000 -- (-783.710) [-779.727] (-780.492) (-780.949) * (-781.631) [-780.257] (-781.553) (-781.250) -- 0:00:56
163500 -- [-787.290] (-780.672) (-780.486) (-780.351) * [-780.513] (-781.037) (-780.383) (-784.340) -- 0:00:56
164000 -- (-781.026) [-779.525] (-780.652) (-780.845) * [-782.454] (-780.067) (-780.446) (-781.413) -- 0:00:56
164500 -- [-779.097] (-778.916) (-781.405) (-780.064) * (-784.824) (-779.712) [-779.783] (-783.383) -- 0:00:55
165000 -- (-781.771) (-778.692) [-779.218] (-780.495) * (-787.945) (-780.812) [-781.033] (-780.771) -- 0:00:55
Average standard deviation of split frequencies: 0.014973
165500 -- [-783.923] (-779.544) (-783.671) (-779.946) * [-779.787] (-781.359) (-779.906) (-782.070) -- 0:00:55
166000 -- (-780.701) [-780.100] (-780.815) (-781.019) * (-779.215) (-779.700) (-780.646) [-780.445] -- 0:00:55
166500 -- (-781.871) (-780.776) (-782.641) [-780.571] * (-781.990) (-781.013) (-779.552) [-780.778] -- 0:00:55
167000 -- (-782.370) (-779.640) [-780.523] (-779.731) * (-782.873) (-780.978) [-783.577] (-780.598) -- 0:00:54
167500 -- (-782.373) [-784.411] (-779.754) (-781.313) * (-779.973) (-781.975) (-783.632) [-781.526] -- 0:00:54
168000 -- (-780.050) [-780.261] (-780.007) (-779.932) * (-781.883) (-786.217) [-778.825] (-781.486) -- 0:00:54
168500 -- (-782.691) (-781.452) [-780.035] (-781.066) * (-780.403) (-780.865) [-783.266] (-780.576) -- 0:00:54
169000 -- [-780.624] (-783.051) (-780.998) (-781.387) * (-781.974) (-780.530) (-780.599) [-780.785] -- 0:00:54
169500 -- [-779.515] (-781.201) (-784.196) (-781.160) * (-780.737) (-783.686) [-779.629] (-781.793) -- 0:00:53
170000 -- [-780.187] (-782.665) (-780.301) (-780.325) * [-779.222] (-780.606) (-779.807) (-780.785) -- 0:00:53
Average standard deviation of split frequencies: 0.014205
170500 -- (-779.395) [-780.785] (-780.828) (-780.794) * [-780.158] (-783.341) (-780.787) (-781.273) -- 0:00:53
171000 -- (-779.418) [-779.641] (-779.193) (-779.126) * (-779.264) (-782.615) [-783.845] (-782.001) -- 0:00:53
171500 -- (-782.940) (-782.725) (-779.473) [-779.688] * (-779.831) [-781.392] (-783.476) (-780.146) -- 0:00:53
172000 -- [-782.459] (-782.915) (-784.762) (-779.964) * (-779.410) (-780.573) (-779.477) [-781.886] -- 0:00:52
172500 -- (-779.755) (-783.661) (-783.796) [-778.970] * (-780.347) [-780.784] (-780.795) (-783.706) -- 0:00:52
173000 -- (-779.554) (-781.798) [-781.292] (-781.044) * (-781.329) (-780.065) [-779.027] (-785.297) -- 0:00:52
173500 -- (-782.379) [-780.536] (-779.776) (-787.250) * (-779.150) [-781.297] (-784.705) (-779.256) -- 0:00:52
174000 -- (-780.793) (-780.624) [-781.742] (-778.948) * [-780.600] (-780.951) (-779.305) (-781.033) -- 0:00:52
174500 -- (-781.900) (-779.460) [-779.540] (-778.790) * [-781.551] (-782.167) (-783.861) (-783.009) -- 0:00:52
175000 -- (-780.202) [-779.701] (-782.119) (-780.549) * (-779.588) (-780.826) [-779.979] (-788.963) -- 0:00:51
Average standard deviation of split frequencies: 0.013520
175500 -- (-779.185) (-780.381) (-782.018) [-780.658] * (-781.207) [-779.562] (-780.739) (-786.438) -- 0:00:51
176000 -- (-781.135) (-781.207) [-781.652] (-782.991) * (-783.100) (-779.846) [-781.167] (-781.114) -- 0:00:51
176500 -- (-781.264) [-782.203] (-781.265) (-784.264) * (-783.761) (-779.774) [-781.501] (-784.248) -- 0:00:51
177000 -- (-780.823) (-779.994) (-781.071) [-785.545] * (-782.095) (-781.098) (-782.163) [-781.372] -- 0:00:55
177500 -- [-782.738] (-778.778) (-782.491) (-779.789) * (-782.624) (-783.063) [-780.482] (-784.464) -- 0:00:55
178000 -- [-779.783] (-784.369) (-782.934) (-781.858) * (-779.717) (-781.884) [-780.366] (-786.631) -- 0:00:55
178500 -- (-779.368) [-782.149] (-780.008) (-781.630) * (-779.160) (-782.407) [-781.414] (-783.382) -- 0:00:55
179000 -- (-780.530) (-781.559) (-782.214) [-781.246] * (-780.988) (-779.874) (-780.905) [-783.528] -- 0:00:55
179500 -- [-780.132] (-780.943) (-782.085) (-781.103) * [-779.598] (-780.585) (-778.897) (-781.338) -- 0:00:54
180000 -- (-780.595) [-780.721] (-779.473) (-782.674) * (-779.904) [-782.345] (-781.823) (-787.780) -- 0:00:54
Average standard deviation of split frequencies: 0.013568
180500 -- (-779.863) (-779.660) [-780.105] (-781.157) * (-779.060) (-780.317) [-780.823] (-783.478) -- 0:00:54
181000 -- (-778.912) [-782.026] (-784.924) (-780.691) * [-779.724] (-779.965) (-781.626) (-779.484) -- 0:00:54
181500 -- (-779.413) (-785.068) (-782.863) [-779.889] * (-779.787) (-779.766) [-779.239] (-781.125) -- 0:00:54
182000 -- (-781.353) [-781.591] (-782.765) (-780.253) * (-782.603) [-787.653] (-779.699) (-780.063) -- 0:00:53
182500 -- [-781.687] (-783.475) (-783.555) (-782.318) * [-783.564] (-781.683) (-781.579) (-780.619) -- 0:00:53
183000 -- (-785.581) [-781.947] (-782.676) (-781.179) * [-781.451] (-779.749) (-780.950) (-779.700) -- 0:00:53
183500 -- (-779.180) (-780.096) [-781.801] (-782.732) * [-780.005] (-780.537) (-784.877) (-779.642) -- 0:00:53
184000 -- (-779.272) (-782.577) [-780.029] (-783.082) * [-780.899] (-782.908) (-782.033) (-780.152) -- 0:00:53
184500 -- (-780.259) [-779.916] (-780.399) (-782.531) * (-781.605) (-781.759) [-780.232] (-780.314) -- 0:00:53
185000 -- (-779.682) (-786.337) (-779.869) [-781.199] * (-782.816) (-787.532) [-781.086] (-780.154) -- 0:00:52
Average standard deviation of split frequencies: 0.014241
185500 -- (-783.406) (-782.656) (-778.480) [-780.677] * (-782.845) (-781.642) (-781.879) [-778.823] -- 0:00:52
186000 -- (-782.503) (-788.704) [-780.075] (-782.984) * (-780.017) [-782.110] (-783.956) (-778.932) -- 0:00:52
186500 -- (-779.726) (-785.362) [-779.855] (-783.006) * [-783.894] (-779.265) (-779.182) (-780.546) -- 0:00:52
187000 -- [-779.188] (-785.680) (-780.181) (-780.266) * (-782.872) (-787.345) [-779.659] (-784.303) -- 0:00:52
187500 -- (-779.387) (-780.232) [-786.511] (-781.543) * [-779.823] (-779.083) (-781.488) (-781.508) -- 0:00:52
188000 -- [-779.354] (-782.005) (-786.041) (-782.274) * (-779.542) (-778.546) (-783.078) [-781.803] -- 0:00:51
188500 -- (-781.469) (-783.068) (-786.209) [-779.072] * (-784.401) (-779.531) [-780.050] (-780.702) -- 0:00:51
189000 -- (-782.125) [-782.285] (-782.781) (-782.777) * (-782.371) (-779.278) (-783.752) [-779.325] -- 0:00:51
189500 -- (-779.781) [-781.906] (-780.930) (-781.250) * [-781.062] (-779.934) (-781.166) (-780.886) -- 0:00:51
190000 -- (-780.825) (-780.788) (-781.057) [-787.386] * [-779.864] (-782.393) (-779.512) (-780.441) -- 0:00:51
Average standard deviation of split frequencies: 0.012980
190500 -- (-779.772) (-781.250) [-781.250] (-787.049) * (-779.161) (-780.599) [-780.606] (-779.654) -- 0:00:50
191000 -- (-780.055) (-779.844) (-780.438) [-779.610] * (-779.593) (-785.388) (-780.745) [-779.162] -- 0:00:50
191500 -- (-778.899) (-781.689) [-782.467] (-779.404) * [-779.072] (-782.926) (-780.594) (-779.214) -- 0:00:50
192000 -- (-782.068) [-781.196] (-780.684) (-780.035) * (-779.228) (-783.078) (-782.368) [-780.712] -- 0:00:50
192500 -- (-779.184) (-778.882) (-780.992) [-781.241] * (-780.271) [-783.717] (-781.158) (-780.459) -- 0:00:50
193000 -- (-779.924) [-781.151] (-782.578) (-780.783) * (-784.032) (-782.417) (-780.166) [-779.957] -- 0:00:54
193500 -- (-780.017) (-779.463) (-780.588) [-779.747] * (-782.350) (-783.176) [-780.521] (-786.533) -- 0:00:54
194000 -- (-778.992) (-780.726) (-779.619) [-781.707] * (-779.507) (-780.783) (-780.187) [-780.075] -- 0:00:54
194500 -- (-779.223) (-782.466) (-782.910) [-781.223] * (-780.139) (-783.557) (-780.438) [-780.324] -- 0:00:53
195000 -- (-780.574) [-781.726] (-784.122) (-781.371) * (-781.048) (-779.594) (-781.041) [-781.013] -- 0:00:53
Average standard deviation of split frequencies: 0.012026
195500 -- (-781.584) (-781.008) [-780.293] (-782.067) * (-780.167) (-779.794) (-781.555) [-780.506] -- 0:00:53
196000 -- (-783.414) (-780.117) [-780.930] (-780.824) * (-778.927) (-782.189) [-782.244] (-782.497) -- 0:00:53
196500 -- (-783.475) (-779.457) [-780.769] (-783.358) * [-779.458] (-783.648) (-783.417) (-781.686) -- 0:00:53
197000 -- (-779.348) [-780.067] (-781.463) (-781.163) * (-781.274) (-780.807) [-784.842] (-782.694) -- 0:00:52
197500 -- (-779.671) (-778.871) [-779.510] (-781.761) * (-781.233) (-786.297) [-780.444] (-782.217) -- 0:00:52
198000 -- (-779.702) [-781.077] (-779.506) (-782.212) * (-785.155) [-781.967] (-786.615) (-781.319) -- 0:00:52
198500 -- (-780.081) (-779.066) (-780.492) [-780.506] * (-782.480) [-778.865] (-783.164) (-781.212) -- 0:00:52
199000 -- [-781.230] (-779.466) (-781.329) (-780.319) * (-780.545) [-778.828] (-781.166) (-783.301) -- 0:00:52
199500 -- [-779.689] (-781.280) (-781.561) (-779.932) * (-779.763) [-780.841] (-780.543) (-781.089) -- 0:00:52
200000 -- [-782.034] (-780.726) (-781.180) (-784.169) * (-784.768) (-780.966) [-786.913] (-781.609) -- 0:00:51
Average standard deviation of split frequencies: 0.011276
200500 -- (-782.751) [-780.662] (-786.764) (-781.403) * (-786.396) (-780.455) (-780.628) [-779.203] -- 0:00:51
201000 -- (-779.080) (-781.221) [-783.333] (-781.510) * [-780.394] (-780.579) (-779.942) (-779.550) -- 0:00:51
201500 -- [-779.005] (-781.135) (-782.294) (-784.993) * (-780.103) (-781.955) [-779.577] (-781.125) -- 0:00:51
202000 -- [-780.811] (-780.142) (-782.151) (-779.104) * (-780.709) (-780.398) [-778.954] (-779.267) -- 0:00:51
202500 -- (-779.760) (-780.041) (-785.310) [-779.680] * [-779.606] (-782.384) (-779.500) (-779.078) -- 0:00:51
203000 -- (-778.878) [-779.540] (-780.969) (-781.556) * [-780.205] (-782.001) (-786.056) (-779.206) -- 0:00:51
203500 -- [-779.065] (-778.468) (-780.067) (-780.570) * (-783.019) (-781.722) [-780.482] (-779.125) -- 0:00:50
204000 -- (-782.231) (-779.252) [-780.055] (-782.223) * (-783.069) [-779.806] (-780.984) (-782.261) -- 0:00:50
204500 -- (-784.074) (-780.115) [-780.479] (-781.585) * (-782.331) (-780.911) (-779.836) [-780.441] -- 0:00:50
205000 -- (-781.253) (-780.699) (-781.039) [-781.855] * (-779.512) (-780.500) [-781.175] (-781.453) -- 0:00:50
Average standard deviation of split frequencies: 0.009840
205500 -- (-779.441) (-779.090) [-779.258] (-782.478) * [-781.387] (-781.161) (-782.960) (-780.491) -- 0:00:50
206000 -- (-778.747) (-783.255) [-785.169] (-782.637) * (-782.395) [-781.332] (-781.440) (-779.093) -- 0:00:50
206500 -- (-779.876) (-781.277) (-782.352) [-780.196] * [-781.217] (-782.997) (-779.711) (-781.964) -- 0:00:49
207000 -- (-780.227) (-781.409) (-779.752) [-779.714] * (-779.872) [-780.039] (-779.169) (-781.411) -- 0:00:49
207500 -- [-780.342] (-780.337) (-778.768) (-779.415) * (-779.518) [-781.599] (-782.934) (-782.850) -- 0:00:49
208000 -- (-780.019) (-781.378) [-782.066] (-781.408) * [-785.036] (-783.150) (-780.505) (-781.910) -- 0:00:49
208500 -- [-780.437] (-780.910) (-781.456) (-782.164) * [-781.101] (-780.524) (-782.395) (-783.915) -- 0:00:49
209000 -- (-781.476) (-784.729) [-783.111] (-782.730) * (-779.624) (-778.633) [-780.133] (-784.481) -- 0:00:52
209500 -- (-783.855) (-786.836) [-781.319] (-779.941) * [-780.300] (-779.686) (-780.150) (-780.553) -- 0:00:52
210000 -- (-781.023) (-782.450) [-780.319] (-779.418) * (-780.708) [-783.584] (-779.593) (-783.638) -- 0:00:52
Average standard deviation of split frequencies: 0.009398
210500 -- (-782.302) (-781.855) (-779.827) [-779.319] * [-779.268] (-782.046) (-782.038) (-784.434) -- 0:00:52
211000 -- (-782.909) (-781.495) (-780.302) [-779.618] * (-783.961) (-779.144) (-781.386) [-779.466] -- 0:00:52
211500 -- (-780.642) (-781.029) (-781.472) [-780.400] * (-781.326) (-779.681) (-780.346) [-780.635] -- 0:00:52
212000 -- (-789.689) (-780.252) (-781.180) [-781.552] * [-780.341] (-780.541) (-779.946) (-780.370) -- 0:00:52
212500 -- (-785.766) (-779.538) [-779.064] (-780.278) * (-784.142) (-778.811) [-780.092] (-781.000) -- 0:00:51
213000 -- [-783.680] (-779.973) (-780.559) (-780.511) * (-780.360) (-780.132) (-780.520) [-780.501] -- 0:00:51
213500 -- (-780.841) [-780.395] (-781.628) (-781.077) * [-780.370] (-780.666) (-779.916) (-779.211) -- 0:00:51
214000 -- (-779.899) [-780.953] (-779.395) (-782.353) * (-780.053) [-782.087] (-779.736) (-779.552) -- 0:00:51
214500 -- (-779.139) (-783.985) [-779.483] (-785.576) * (-782.518) (-783.065) [-779.063] (-780.122) -- 0:00:51
215000 -- (-779.315) (-781.433) [-779.081] (-785.098) * [-783.389] (-779.599) (-780.510) (-779.734) -- 0:00:51
Average standard deviation of split frequencies: 0.010223
215500 -- (-778.793) [-781.303] (-779.097) (-780.823) * (-781.314) (-783.595) [-779.757] (-784.282) -- 0:00:50
216000 -- [-782.595] (-781.060) (-779.341) (-779.820) * (-779.336) (-785.447) (-780.791) [-780.772] -- 0:00:50
216500 -- [-779.854] (-780.137) (-781.273) (-781.436) * [-779.986] (-781.036) (-781.843) (-780.647) -- 0:00:50
217000 -- [-779.923] (-785.665) (-781.328) (-781.020) * [-778.564] (-780.910) (-780.032) (-782.400) -- 0:00:50
217500 -- (-780.985) [-782.844] (-779.542) (-781.630) * (-781.184) (-779.915) [-782.098] (-781.517) -- 0:00:50
218000 -- (-779.378) (-780.365) [-779.393] (-778.536) * (-780.850) (-781.241) (-783.465) [-779.699] -- 0:00:50
218500 -- (-781.286) (-780.190) [-779.286] (-778.927) * [-779.479] (-783.879) (-779.535) (-780.884) -- 0:00:50
219000 -- (-782.664) (-781.695) (-779.856) [-781.813] * (-780.375) [-780.383] (-779.493) (-779.699) -- 0:00:49
219500 -- (-779.807) (-780.325) (-780.032) [-779.340] * (-779.284) (-779.456) [-780.478] (-784.828) -- 0:00:49
220000 -- (-780.230) (-781.646) [-781.379] (-779.933) * [-778.839] (-780.065) (-779.586) (-779.753) -- 0:00:49
Average standard deviation of split frequencies: 0.010468
220500 -- (-779.653) [-780.009] (-780.680) (-778.653) * (-781.451) [-780.635] (-781.141) (-780.865) -- 0:00:49
221000 -- [-780.733] (-780.863) (-781.425) (-780.617) * [-779.970] (-779.925) (-783.875) (-784.635) -- 0:00:49
221500 -- (-782.183) (-783.340) [-781.169] (-779.919) * (-781.319) (-780.127) [-781.671] (-782.709) -- 0:00:49
222000 -- (-783.149) (-780.484) (-783.119) [-782.094] * (-780.189) (-780.243) (-784.125) [-779.687] -- 0:00:49
222500 -- [-781.956] (-781.295) (-779.394) (-780.305) * (-784.523) (-780.919) (-782.271) [-780.011] -- 0:00:48
223000 -- (-784.473) [-779.647] (-782.119) (-781.568) * (-784.878) (-780.187) [-781.795] (-780.766) -- 0:00:52
223500 -- (-781.543) (-780.331) (-778.986) [-780.038] * (-781.848) (-780.073) [-781.804] (-781.133) -- 0:00:52
224000 -- (-781.245) [-780.775] (-780.053) (-784.633) * (-784.033) (-780.610) (-781.660) [-781.631] -- 0:00:51
224500 -- (-779.555) [-782.567] (-784.547) (-781.554) * [-785.786] (-779.508) (-781.137) (-779.248) -- 0:00:51
225000 -- (-780.304) (-782.887) [-780.844] (-784.064) * (-779.460) [-779.681] (-779.291) (-779.816) -- 0:00:51
Average standard deviation of split frequencies: 0.011785
225500 -- (-782.156) (-781.033) (-781.128) [-783.542] * (-785.617) (-784.579) (-782.294) [-783.004] -- 0:00:51
226000 -- (-782.794) [-780.550] (-782.282) (-784.836) * (-780.672) (-784.560) (-784.702) [-779.213] -- 0:00:51
226500 -- [-780.024] (-780.754) (-786.276) (-781.814) * (-778.975) (-785.758) (-781.037) [-778.977] -- 0:00:51
227000 -- (-781.537) (-781.991) [-781.018] (-783.732) * (-783.595) (-781.253) (-781.833) [-779.513] -- 0:00:51
227500 -- [-781.182] (-779.348) (-781.791) (-783.890) * (-781.857) (-783.520) [-780.087] (-779.670) -- 0:00:50
228000 -- (-782.227) [-779.234] (-782.231) (-780.862) * (-780.295) (-780.112) [-780.329] (-780.075) -- 0:00:50
228500 -- (-779.271) (-779.419) (-784.157) [-779.699] * (-780.144) (-784.853) (-782.947) [-781.599] -- 0:00:50
229000 -- [-779.271] (-779.728) (-779.941) (-779.919) * (-780.362) (-783.504) (-779.698) [-780.353] -- 0:00:50
229500 -- (-781.462) (-779.368) (-782.974) [-780.025] * (-779.039) (-780.425) [-781.209] (-782.030) -- 0:00:50
230000 -- (-778.947) (-779.421) (-779.921) [-779.947] * (-784.158) (-780.991) (-782.068) [-781.762] -- 0:00:50
Average standard deviation of split frequencies: 0.011832
230500 -- (-783.500) (-783.590) (-778.802) [-778.835] * [-780.543] (-780.493) (-781.920) (-779.246) -- 0:00:50
231000 -- (-780.265) (-784.338) (-780.220) [-780.207] * (-780.534) [-780.343] (-780.379) (-780.627) -- 0:00:49
231500 -- [-781.319] (-782.777) (-779.889) (-781.525) * (-781.692) (-779.002) (-781.698) [-781.289] -- 0:00:49
232000 -- (-778.744) (-783.350) (-778.879) [-785.181] * (-781.186) (-780.794) [-780.908] (-781.168) -- 0:00:49
232500 -- (-779.705) (-780.322) (-779.229) [-778.970] * [-782.055] (-782.463) (-780.903) (-784.123) -- 0:00:49
233000 -- (-778.453) (-779.170) (-787.092) [-780.917] * [-779.672] (-780.364) (-780.088) (-783.403) -- 0:00:49
233500 -- (-779.753) (-779.495) (-781.052) [-779.366] * [-782.190] (-780.850) (-779.926) (-782.161) -- 0:00:49
234000 -- (-782.809) (-781.306) (-780.603) [-781.175] * [-781.896] (-779.405) (-785.116) (-780.575) -- 0:00:49
234500 -- [-780.062] (-782.874) (-780.823) (-780.090) * (-782.470) (-781.835) [-785.304] (-779.671) -- 0:00:48
235000 -- [-779.634] (-783.103) (-782.875) (-785.974) * (-780.183) (-780.985) [-779.760] (-782.208) -- 0:00:48
Average standard deviation of split frequencies: 0.011459
235500 -- (-779.964) (-784.810) [-780.167] (-781.178) * (-779.899) [-781.262] (-779.850) (-779.617) -- 0:00:48
236000 -- (-781.118) (-782.385) [-784.350] (-779.446) * (-780.388) (-780.787) [-779.421] (-779.142) -- 0:00:48
236500 -- (-788.148) (-779.464) (-780.585) [-780.723] * [-783.142] (-780.350) (-781.437) (-784.727) -- 0:00:48
237000 -- (-783.641) (-780.175) [-783.105] (-780.220) * [-781.084] (-780.638) (-784.687) (-781.621) -- 0:00:48
237500 -- (-780.910) [-782.723] (-779.274) (-780.835) * (-789.200) (-781.982) [-781.817] (-780.011) -- 0:00:48
238000 -- [-779.526] (-781.319) (-779.658) (-781.013) * (-782.612) (-785.820) (-783.531) [-780.061] -- 0:00:48
238500 -- (-779.236) [-780.795] (-780.813) (-781.510) * [-782.665] (-782.042) (-782.683) (-780.325) -- 0:00:51
239000 -- (-780.486) [-778.914] (-783.113) (-780.425) * (-780.708) (-781.160) [-780.790] (-781.585) -- 0:00:50
239500 -- [-780.128] (-783.360) (-780.552) (-779.787) * (-779.534) (-780.876) (-780.475) [-780.748] -- 0:00:50
240000 -- (-782.276) (-781.046) [-784.050] (-779.127) * (-780.990) (-781.401) [-779.845] (-783.029) -- 0:00:50
Average standard deviation of split frequencies: 0.011031
240500 -- [-779.980] (-780.227) (-785.584) (-780.273) * [-780.774] (-780.800) (-780.685) (-780.644) -- 0:00:50
241000 -- (-781.078) (-780.771) (-779.770) [-784.943] * (-779.101) (-782.928) [-779.028] (-780.442) -- 0:00:50
241500 -- (-779.109) [-780.077] (-782.544) (-783.165) * (-780.956) (-780.475) [-784.078] (-779.609) -- 0:00:50
242000 -- [-778.855] (-783.851) (-780.218) (-782.464) * (-781.217) (-780.237) (-782.006) [-780.895] -- 0:00:50
242500 -- [-781.111] (-788.261) (-779.901) (-782.084) * (-781.551) (-783.543) [-781.206] (-780.024) -- 0:00:49
243000 -- [-780.856] (-780.368) (-780.737) (-782.020) * [-782.561] (-784.143) (-783.557) (-783.799) -- 0:00:49
243500 -- (-783.974) (-780.193) (-780.508) [-778.883] * (-785.636) (-780.596) (-779.143) [-779.550] -- 0:00:49
244000 -- (-783.391) (-780.211) (-782.430) [-778.812] * (-780.630) (-783.688) [-779.925] (-782.080) -- 0:00:49
244500 -- (-782.066) (-780.312) [-782.922] (-780.498) * (-784.888) (-783.818) [-782.466] (-780.876) -- 0:00:49
245000 -- (-785.116) (-781.426) (-783.124) [-779.756] * (-782.677) (-781.592) (-781.346) [-779.956] -- 0:00:49
Average standard deviation of split frequencies: 0.010348
245500 -- (-779.626) (-780.029) (-783.008) [-780.868] * (-782.154) [-785.327] (-781.653) (-781.444) -- 0:00:49
246000 -- [-779.682] (-780.780) (-782.690) (-780.379) * [-781.647] (-782.679) (-780.356) (-779.596) -- 0:00:49
246500 -- [-781.202] (-780.422) (-780.802) (-780.111) * (-785.828) (-782.784) [-782.030] (-781.027) -- 0:00:48
247000 -- [-781.960] (-781.099) (-780.857) (-779.962) * [-780.575] (-782.036) (-780.221) (-785.907) -- 0:00:48
247500 -- (-779.306) [-779.893] (-780.726) (-778.778) * [-780.970] (-780.319) (-782.716) (-782.166) -- 0:00:48
248000 -- (-779.224) [-782.228] (-782.572) (-783.490) * [-781.457] (-779.453) (-780.518) (-780.441) -- 0:00:48
248500 -- (-781.577) (-785.645) (-781.345) [-782.132] * [-779.829] (-779.442) (-779.473) (-781.042) -- 0:00:48
249000 -- [-780.800] (-782.669) (-779.002) (-781.295) * (-779.640) [-780.000] (-780.596) (-780.777) -- 0:00:48
249500 -- (-784.686) [-783.052] (-779.181) (-781.412) * (-784.471) [-781.939] (-781.242) (-783.066) -- 0:00:48
250000 -- (-780.379) (-780.590) [-781.999] (-779.169) * (-784.563) (-779.084) (-780.853) [-779.518] -- 0:00:48
Average standard deviation of split frequencies: 0.008518
250500 -- [-781.198] (-778.938) (-782.264) (-782.195) * (-780.989) (-780.019) (-783.387) [-781.220] -- 0:00:47
251000 -- (-781.916) (-779.649) [-781.378] (-780.680) * [-780.275] (-781.924) (-780.418) (-779.165) -- 0:00:47
251500 -- (-781.119) [-779.965] (-780.938) (-781.919) * (-778.960) (-783.752) (-782.809) [-779.746] -- 0:00:47
252000 -- (-780.244) (-780.611) [-782.574] (-786.046) * (-780.816) (-779.806) (-779.956) [-780.317] -- 0:00:47
252500 -- (-784.076) [-780.405] (-780.538) (-784.526) * (-789.147) [-780.584] (-782.885) (-780.698) -- 0:00:47
253000 -- (-788.012) (-785.200) (-782.216) [-784.988] * (-779.211) (-782.053) [-780.234] (-781.501) -- 0:00:47
253500 -- (-781.647) (-782.855) [-779.743] (-781.019) * [-779.102] (-783.478) (-780.687) (-781.449) -- 0:00:47
254000 -- (-778.876) (-779.177) (-780.858) [-780.754] * (-779.051) (-781.288) (-780.606) [-779.907] -- 0:00:49
254500 -- (-782.918) [-779.177] (-782.943) (-783.830) * (-778.894) (-780.202) (-781.917) [-779.186] -- 0:00:49
255000 -- (-781.651) (-781.616) (-779.338) [-782.850] * (-781.631) (-781.005) [-783.050] (-780.934) -- 0:00:49
Average standard deviation of split frequencies: 0.010182
255500 -- [-782.082] (-782.584) (-780.513) (-782.380) * (-782.260) [-782.195] (-779.657) (-780.756) -- 0:00:49
256000 -- [-780.464] (-780.710) (-780.475) (-781.103) * (-780.270) (-780.508) (-779.344) [-782.790] -- 0:00:49
256500 -- (-781.341) [-781.949] (-780.330) (-779.156) * [-782.417] (-782.450) (-779.481) (-782.871) -- 0:00:49
257000 -- (-778.826) [-780.342] (-780.095) (-781.105) * (-779.795) (-781.463) [-781.162] (-785.784) -- 0:00:49
257500 -- [-779.499] (-781.889) (-780.885) (-779.703) * (-781.182) (-780.988) [-778.786] (-785.843) -- 0:00:49
258000 -- (-779.913) [-780.760] (-780.072) (-780.585) * [-779.370] (-781.075) (-779.442) (-779.731) -- 0:00:48
258500 -- (-779.335) (-782.479) (-783.340) [-782.451] * (-779.636) [-780.702] (-779.635) (-780.023) -- 0:00:48
259000 -- (-782.729) (-783.461) (-779.678) [-781.049] * (-782.344) [-782.211] (-779.200) (-781.039) -- 0:00:48
259500 -- (-782.127) (-779.325) (-783.544) [-781.654] * [-781.954] (-782.995) (-781.980) (-787.156) -- 0:00:48
260000 -- (-778.882) [-779.395] (-779.279) (-781.079) * (-779.116) (-782.920) (-779.662) [-779.789] -- 0:00:48
Average standard deviation of split frequencies: 0.010957
260500 -- (-782.680) [-779.264] (-780.795) (-780.245) * (-782.776) (-782.500) [-783.263] (-779.822) -- 0:00:48
261000 -- (-787.278) (-783.640) (-784.122) [-781.717] * (-782.605) (-780.046) (-784.254) [-785.023] -- 0:00:48
261500 -- [-782.014] (-780.737) (-781.036) (-779.192) * (-783.862) (-779.102) (-785.385) [-782.591] -- 0:00:48
262000 -- (-780.540) (-782.113) [-782.277] (-779.658) * [-780.687] (-779.443) (-781.516) (-782.437) -- 0:00:47
262500 -- (-787.559) [-782.018] (-779.529) (-779.271) * [-780.364] (-779.662) (-786.887) (-779.159) -- 0:00:47
263000 -- [-780.842] (-784.011) (-780.719) (-783.236) * (-781.081) [-782.080] (-782.656) (-781.341) -- 0:00:47
263500 -- (-779.045) (-780.298) [-780.608] (-779.640) * (-781.475) (-780.721) [-781.340] (-779.801) -- 0:00:47
264000 -- [-779.277] (-782.094) (-781.924) (-779.411) * (-780.908) (-783.015) [-782.210] (-780.100) -- 0:00:47
264500 -- (-779.138) [-782.706] (-780.236) (-780.108) * (-781.884) (-780.313) (-779.398) [-781.801] -- 0:00:47
265000 -- (-779.452) [-784.687] (-780.411) (-784.388) * (-781.218) [-779.489] (-786.893) (-784.273) -- 0:00:47
Average standard deviation of split frequencies: 0.010112
265500 -- (-778.888) (-783.594) (-781.765) [-779.249] * [-779.658] (-782.159) (-779.429) (-780.164) -- 0:00:47
266000 -- (-780.243) (-779.404) [-778.980] (-779.434) * (-781.263) (-780.289) [-781.816] (-781.072) -- 0:00:46
266500 -- (-781.121) (-779.240) (-779.370) [-779.897] * (-783.551) (-782.074) (-780.044) [-780.202] -- 0:00:46
267000 -- (-782.037) (-781.530) [-779.337] (-787.051) * [-785.496] (-781.536) (-781.264) (-781.252) -- 0:00:46
267500 -- (-781.768) (-783.181) [-779.851] (-784.040) * (-780.938) [-780.534] (-784.150) (-786.249) -- 0:00:46
268000 -- [-780.097] (-781.214) (-781.344) (-782.350) * (-783.423) (-781.535) (-786.386) [-780.356] -- 0:00:46
268500 -- (-780.097) (-782.982) (-782.492) [-780.518] * (-783.218) (-782.656) (-783.555) [-779.670] -- 0:00:46
269000 -- (-780.510) (-782.060) (-783.463) [-778.976] * (-781.809) (-781.364) (-780.169) [-780.184] -- 0:00:46
269500 -- (-784.683) (-780.695) (-781.638) [-780.011] * [-780.298] (-780.950) (-782.927) (-779.634) -- 0:00:46
270000 -- (-779.880) [-780.244] (-781.464) (-785.511) * [-781.220] (-782.732) (-779.545) (-781.637) -- 0:00:48
Average standard deviation of split frequencies: 0.009323
270500 -- (-779.245) [-784.411] (-779.038) (-780.992) * [-781.377] (-780.782) (-782.239) (-782.538) -- 0:00:48
271000 -- (-780.182) [-784.376] (-779.970) (-780.149) * (-779.703) (-781.440) [-779.782] (-781.512) -- 0:00:48
271500 -- (-780.754) [-779.829] (-780.531) (-781.157) * [-779.478] (-782.291) (-780.467) (-779.154) -- 0:00:48
272000 -- [-779.361] (-779.365) (-780.161) (-780.271) * (-779.671) (-780.303) [-779.657] (-779.736) -- 0:00:48
272500 -- (-779.159) (-787.833) [-780.805] (-783.284) * (-780.905) [-780.867] (-784.403) (-783.114) -- 0:00:48
273000 -- [-779.959] (-792.921) (-780.473) (-781.620) * [-781.031] (-784.098) (-779.333) (-779.833) -- 0:00:47
273500 -- (-782.569) (-782.823) (-781.805) [-780.630] * [-779.634] (-779.045) (-780.415) (-781.064) -- 0:00:47
274000 -- (-783.447) [-781.303] (-779.258) (-780.318) * (-780.957) (-788.716) [-779.895] (-782.844) -- 0:00:47
274500 -- (-780.321) (-782.864) [-779.248] (-782.184) * [-779.480] (-780.823) (-784.539) (-780.793) -- 0:00:47
275000 -- (-780.031) (-780.069) [-782.554] (-778.756) * [-780.204] (-780.649) (-780.484) (-780.670) -- 0:00:47
Average standard deviation of split frequencies: 0.010533
275500 -- (-779.905) (-786.846) (-785.529) [-779.561] * [-781.296] (-781.577) (-779.796) (-781.168) -- 0:00:47
276000 -- [-780.548] (-782.262) (-784.169) (-780.749) * (-780.061) (-783.017) (-781.867) [-780.312] -- 0:00:47
276500 -- [-782.254] (-780.093) (-782.662) (-781.826) * (-782.527) (-783.177) (-779.535) [-779.155] -- 0:00:47
277000 -- (-779.627) (-781.120) [-781.815] (-782.181) * (-781.327) (-790.262) (-779.411) [-779.496] -- 0:00:46
277500 -- (-780.367) (-782.668) [-782.248] (-780.790) * (-782.632) (-782.423) (-780.612) [-779.084] -- 0:00:46
278000 -- (-781.245) (-780.498) [-781.626] (-779.658) * (-782.626) (-779.531) [-779.882] (-780.373) -- 0:00:46
278500 -- (-782.362) [-780.789] (-779.859) (-779.263) * (-781.322) (-780.369) (-781.078) [-780.080] -- 0:00:46
279000 -- (-784.200) (-782.159) [-779.175] (-780.004) * (-781.811) (-782.419) (-778.720) [-780.159] -- 0:00:46
279500 -- (-781.613) (-779.724) [-779.981] (-779.571) * [-784.833] (-779.667) (-781.265) (-780.418) -- 0:00:46
280000 -- (-780.915) (-780.794) [-781.015] (-782.252) * (-782.858) [-779.063] (-781.800) (-782.990) -- 0:00:46
Average standard deviation of split frequencies: 0.009424
280500 -- [-780.279] (-780.210) (-779.660) (-779.604) * (-783.102) (-780.844) [-783.939] (-781.450) -- 0:00:46
281000 -- (-779.571) [-780.647] (-779.834) (-781.436) * (-781.090) (-782.134) [-784.810] (-783.212) -- 0:00:46
281500 -- (-781.112) [-782.007] (-780.755) (-780.268) * [-778.827] (-779.556) (-783.034) (-786.028) -- 0:00:45
282000 -- (-781.400) (-781.832) [-782.397] (-780.578) * (-779.005) (-781.899) (-780.065) [-780.463] -- 0:00:45
282500 -- (-781.450) (-781.354) [-781.261] (-782.963) * [-780.988] (-783.080) (-779.523) (-781.268) -- 0:00:45
283000 -- (-780.833) (-780.899) (-780.150) [-779.867] * (-782.944) (-781.505) (-779.611) [-780.386] -- 0:00:45
283500 -- (-780.389) (-780.157) (-781.826) [-780.796] * (-784.899) (-782.430) (-779.133) [-781.664] -- 0:00:45
284000 -- (-780.280) (-779.318) (-781.167) [-782.074] * [-781.359] (-781.544) (-780.156) (-780.217) -- 0:00:45
284500 -- (-780.130) [-779.370] (-782.766) (-780.176) * (-780.232) (-780.958) [-781.972] (-781.207) -- 0:00:45
285000 -- (-779.814) (-778.892) [-782.309] (-779.249) * (-782.599) (-781.481) (-780.659) [-778.649] -- 0:00:45
Average standard deviation of split frequencies: 0.010073
285500 -- [-779.094] (-778.682) (-780.794) (-782.376) * [-781.327] (-782.916) (-779.500) (-780.972) -- 0:00:47
286000 -- (-779.595) (-779.422) (-779.882) [-780.623] * (-780.368) (-779.033) (-781.334) [-779.845] -- 0:00:47
286500 -- (-781.976) [-779.074] (-779.532) (-786.700) * (-780.598) (-781.946) (-779.563) [-780.705] -- 0:00:47
287000 -- [-781.903] (-779.380) (-779.816) (-779.583) * (-782.765) (-781.222) (-779.099) [-783.824] -- 0:00:47
287500 -- (-780.327) (-780.138) [-784.481] (-779.510) * [-780.985] (-780.220) (-782.536) (-780.182) -- 0:00:47
288000 -- (-784.248) [-781.255] (-786.022) (-779.120) * (-780.008) [-779.077] (-783.643) (-785.078) -- 0:00:46
288500 -- (-781.218) [-781.421] (-780.553) (-779.808) * (-782.865) (-781.901) [-781.778] (-780.127) -- 0:00:46
289000 -- (-782.094) (-781.809) [-780.150] (-781.444) * (-779.156) (-781.508) [-779.744] (-779.958) -- 0:00:46
289500 -- (-780.060) (-780.967) [-779.666] (-780.758) * (-781.833) (-781.521) [-782.013] (-782.891) -- 0:00:46
290000 -- (-783.979) [-781.167] (-779.955) (-779.830) * (-779.198) (-782.754) [-782.100] (-779.575) -- 0:00:46
Average standard deviation of split frequencies: 0.009816
290500 -- [-780.518] (-783.408) (-781.412) (-779.220) * (-780.440) (-779.447) [-781.195] (-780.980) -- 0:00:46
291000 -- (-779.907) (-779.829) [-779.939] (-781.784) * [-779.211] (-781.962) (-781.820) (-781.297) -- 0:00:46
291500 -- [-779.492] (-782.864) (-782.407) (-779.915) * (-783.413) (-780.421) (-779.472) [-779.903] -- 0:00:46
292000 -- [-779.026] (-781.560) (-780.278) (-779.054) * (-780.222) [-779.661] (-780.864) (-779.684) -- 0:00:46
292500 -- [-785.066] (-781.031) (-784.264) (-780.376) * (-780.730) (-781.721) [-779.658] (-782.967) -- 0:00:45
293000 -- [-782.487] (-781.764) (-781.131) (-780.759) * (-781.388) [-782.198] (-782.447) (-783.224) -- 0:00:45
293500 -- (-784.415) (-780.900) [-779.696] (-782.416) * (-780.697) (-780.068) [-780.954] (-781.046) -- 0:00:45
294000 -- (-786.312) [-781.685] (-782.443) (-779.748) * (-780.270) (-781.279) (-779.274) [-779.678] -- 0:00:45
294500 -- [-782.378] (-781.754) (-782.085) (-779.459) * (-783.687) [-781.852] (-779.231) (-779.938) -- 0:00:45
295000 -- (-782.485) (-786.452) [-781.760] (-779.508) * (-783.391) [-781.895] (-783.122) (-779.227) -- 0:00:45
Average standard deviation of split frequencies: 0.009909
295500 -- (-784.877) (-781.158) [-781.942] (-780.574) * (-781.851) (-782.232) [-781.308] (-780.605) -- 0:00:45
296000 -- [-781.198] (-781.858) (-780.004) (-780.831) * (-779.469) (-786.855) [-779.716] (-783.203) -- 0:00:45
296500 -- (-783.314) [-782.373] (-779.535) (-783.575) * (-781.497) (-782.077) [-779.725] (-780.590) -- 0:00:45
297000 -- [-782.630] (-780.444) (-780.625) (-781.443) * (-780.234) (-783.063) [-779.725] (-780.231) -- 0:00:44
297500 -- (-780.358) (-778.759) (-782.830) [-782.517] * (-780.072) (-781.448) [-778.962] (-778.662) -- 0:00:44
298000 -- (-781.465) [-779.903] (-780.816) (-780.711) * (-779.723) (-781.129) (-779.722) [-780.535] -- 0:00:44
298500 -- [-780.650] (-780.252) (-778.843) (-781.144) * (-779.043) (-780.471) [-782.375] (-785.529) -- 0:00:44
299000 -- (-782.180) (-784.823) (-782.522) [-780.413] * (-778.926) [-779.142] (-779.931) (-783.314) -- 0:00:44
299500 -- (-782.131) [-778.670] (-782.038) (-779.473) * [-779.020] (-779.219) (-781.313) (-781.699) -- 0:00:44
300000 -- (-780.350) (-778.685) (-779.616) [-781.199] * (-780.912) (-782.686) [-782.022] (-780.113) -- 0:00:44
Average standard deviation of split frequencies: 0.010053
300500 -- (-781.498) [-779.284] (-781.128) (-784.424) * [-782.260] (-784.992) (-780.993) (-781.647) -- 0:00:44
301000 -- (-781.287) (-782.265) [-781.662] (-780.173) * (-783.278) [-780.440] (-781.157) (-779.345) -- 0:00:46
301500 -- [-780.963] (-778.721) (-780.132) (-780.418) * (-779.527) (-780.550) [-781.665] (-780.225) -- 0:00:46
302000 -- (-780.511) (-785.331) (-781.062) [-781.189] * (-785.605) [-780.106] (-781.304) (-779.813) -- 0:00:46
302500 -- (-782.413) (-783.583) (-782.895) [-781.045] * (-779.893) (-780.349) [-778.639] (-780.233) -- 0:00:46
303000 -- (-779.819) (-788.141) (-782.223) [-779.149] * (-781.206) (-782.957) [-782.555] (-781.452) -- 0:00:46
303500 -- (-781.509) (-782.480) [-782.631] (-780.658) * (-781.392) (-782.383) (-780.446) [-783.256] -- 0:00:45
304000 -- (-782.312) (-781.759) (-782.809) [-780.274] * (-784.424) [-780.356] (-780.339) (-779.718) -- 0:00:45
304500 -- (-780.541) (-781.430) [-784.242] (-779.955) * (-779.477) (-779.996) (-779.357) [-781.202] -- 0:00:45
305000 -- (-782.113) (-779.903) (-780.411) [-780.541] * [-780.045] (-778.808) (-782.188) (-782.296) -- 0:00:45
Average standard deviation of split frequencies: 0.011270
305500 -- (-781.980) (-780.776) (-779.086) [-780.236] * (-780.202) (-784.554) (-783.078) [-781.037] -- 0:00:45
306000 -- [-783.952] (-781.419) (-779.882) (-782.347) * (-779.892) [-781.200] (-778.740) (-783.334) -- 0:00:45
306500 -- (-789.090) (-784.300) (-780.828) [-783.071] * (-782.972) (-783.725) [-779.211] (-782.178) -- 0:00:45
307000 -- (-784.727) [-784.443] (-781.001) (-780.102) * (-783.320) (-785.949) (-781.185) [-782.323] -- 0:00:45
307500 -- [-779.949] (-783.176) (-787.615) (-783.914) * (-787.460) (-782.001) (-779.404) [-780.527] -- 0:00:45
308000 -- [-783.575] (-782.165) (-781.920) (-779.852) * [-780.650] (-779.731) (-779.933) (-780.813) -- 0:00:44
308500 -- (-782.128) (-781.366) (-782.608) [-779.884] * (-779.588) (-779.393) [-779.952] (-781.138) -- 0:00:44
309000 -- [-779.941] (-782.874) (-783.026) (-780.476) * (-779.738) [-779.581] (-780.042) (-781.712) -- 0:00:44
309500 -- (-779.207) [-780.410] (-784.686) (-780.365) * [-779.795] (-779.433) (-783.687) (-780.396) -- 0:00:44
310000 -- [-778.936] (-782.420) (-783.896) (-781.812) * [-781.101] (-779.847) (-781.123) (-780.291) -- 0:00:44
Average standard deviation of split frequencies: 0.011886
310500 -- (-779.066) (-781.126) (-780.911) [-781.370] * [-782.460] (-779.616) (-781.104) (-780.777) -- 0:00:44
311000 -- (-781.773) [-780.501] (-780.572) (-779.497) * (-780.229) (-781.472) (-785.382) [-779.574] -- 0:00:44
311500 -- [-779.197] (-779.347) (-782.266) (-780.639) * (-782.506) (-781.783) [-782.297] (-779.133) -- 0:00:44
312000 -- (-781.072) (-780.493) (-782.975) [-780.892] * (-780.033) (-780.009) [-780.288] (-780.883) -- 0:00:44
312500 -- [-780.490] (-780.459) (-781.710) (-781.657) * (-780.194) [-779.753] (-781.338) (-780.603) -- 0:00:44
313000 -- (-788.264) [-782.098] (-783.830) (-780.620) * (-782.435) [-779.058] (-781.195) (-781.057) -- 0:00:43
313500 -- (-781.004) (-781.498) [-780.702] (-783.041) * (-781.321) (-782.466) [-781.967] (-782.753) -- 0:00:43
314000 -- (-783.235) (-781.727) (-780.527) [-780.920] * (-782.332) [-782.293] (-779.824) (-781.168) -- 0:00:43
314500 -- [-783.983] (-780.205) (-780.367) (-783.466) * [-778.691] (-779.761) (-779.751) (-784.978) -- 0:00:43
315000 -- (-780.910) [-783.659] (-779.735) (-781.106) * (-778.906) (-780.381) [-782.978] (-782.101) -- 0:00:43
Average standard deviation of split frequencies: 0.009779
315500 -- (-782.981) [-783.980] (-780.517) (-781.078) * (-780.487) (-781.937) (-782.007) [-780.260] -- 0:00:43
316000 -- (-784.178) (-785.632) [-779.935] (-783.854) * [-780.864] (-781.806) (-786.207) (-779.682) -- 0:00:43
316500 -- (-783.305) [-781.445] (-780.032) (-781.828) * [-779.386] (-780.591) (-780.404) (-781.553) -- 0:00:45
317000 -- (-784.172) (-785.742) [-781.507] (-781.948) * [-779.510] (-783.269) (-780.434) (-779.373) -- 0:00:45
317500 -- (-782.533) [-780.295] (-782.469) (-780.164) * [-779.013] (-785.499) (-782.418) (-779.914) -- 0:00:45
318000 -- [-780.579] (-785.279) (-782.298) (-779.186) * [-782.419] (-781.387) (-778.862) (-779.824) -- 0:00:45
318500 -- (-788.158) (-779.377) [-779.573] (-780.301) * (-784.998) (-779.718) (-779.507) [-780.770] -- 0:00:44
319000 -- (-778.881) [-779.684] (-780.500) (-780.913) * (-781.776) (-782.061) (-780.689) [-780.812] -- 0:00:44
319500 -- [-782.271] (-781.555) (-780.127) (-782.111) * (-782.704) (-780.529) [-779.509] (-784.547) -- 0:00:44
320000 -- [-779.122] (-781.746) (-782.267) (-781.052) * (-779.895) (-782.083) (-779.331) [-782.203] -- 0:00:44
Average standard deviation of split frequencies: 0.009253
320500 -- [-779.037] (-780.706) (-779.063) (-784.647) * (-781.762) (-782.593) [-778.681] (-779.631) -- 0:00:44
321000 -- [-778.854] (-785.094) (-782.561) (-782.831) * [-780.267] (-779.304) (-780.098) (-779.916) -- 0:00:44
321500 -- (-781.699) [-781.990] (-779.392) (-781.833) * [-782.197] (-779.362) (-778.920) (-780.275) -- 0:00:44
322000 -- [-779.435] (-779.641) (-781.765) (-781.770) * (-779.677) [-783.093] (-780.575) (-782.085) -- 0:00:44
322500 -- (-779.912) [-781.274] (-781.762) (-788.142) * (-781.908) [-781.350] (-782.696) (-781.667) -- 0:00:44
323000 -- (-780.210) [-780.884] (-779.973) (-789.134) * (-782.868) [-780.654] (-781.623) (-780.258) -- 0:00:44
323500 -- (-780.251) [-781.103] (-779.326) (-789.317) * (-782.112) (-782.881) (-781.454) [-780.235] -- 0:00:43
324000 -- (-784.626) [-782.596] (-779.283) (-781.003) * [-780.501] (-787.776) (-779.757) (-785.998) -- 0:00:43
324500 -- [-780.665] (-779.753) (-779.275) (-783.224) * (-779.845) (-786.199) (-779.989) [-781.486] -- 0:00:43
325000 -- (-785.630) [-784.248] (-781.132) (-785.313) * (-782.734) (-780.098) [-781.437] (-781.171) -- 0:00:43
Average standard deviation of split frequencies: 0.008676
325500 -- [-779.853] (-781.044) (-780.996) (-780.044) * (-779.442) (-780.660) (-780.811) [-778.738] -- 0:00:43
326000 -- (-779.622) [-781.913] (-781.566) (-780.820) * (-780.115) (-780.534) (-780.523) [-783.272] -- 0:00:43
326500 -- [-779.925] (-779.742) (-780.977) (-782.555) * (-779.525) (-784.400) (-781.567) [-781.554] -- 0:00:43
327000 -- [-780.867] (-779.149) (-783.230) (-783.423) * (-781.694) [-782.078] (-780.220) (-781.080) -- 0:00:43
327500 -- (-780.441) [-779.905] (-782.934) (-785.652) * [-782.052] (-782.241) (-780.328) (-782.484) -- 0:00:43
328000 -- (-781.312) (-779.045) (-781.422) [-781.369] * (-783.225) (-779.301) [-780.683] (-784.318) -- 0:00:43
328500 -- (-781.848) (-783.361) (-779.000) [-780.841] * (-785.409) [-780.201] (-779.793) (-779.834) -- 0:00:42
329000 -- (-783.734) (-781.898) [-782.941] (-782.575) * (-780.709) [-783.004] (-782.701) (-780.729) -- 0:00:42
329500 -- (-781.579) (-783.097) [-780.038] (-780.541) * [-783.271] (-785.494) (-779.190) (-780.253) -- 0:00:42
330000 -- (-783.989) (-784.927) [-779.931] (-780.656) * (-781.220) (-784.314) (-780.103) [-779.391] -- 0:00:42
Average standard deviation of split frequencies: 0.008302
330500 -- (-782.018) (-783.336) [-778.639] (-780.405) * (-784.619) (-785.177) (-779.900) [-780.232] -- 0:00:42
331000 -- (-781.232) [-780.225] (-778.776) (-780.677) * (-780.668) (-782.458) (-781.637) [-779.413] -- 0:00:42
331500 -- (-782.031) [-781.724] (-778.775) (-779.906) * (-784.302) [-783.140] (-780.918) (-781.270) -- 0:00:44
332000 -- (-780.087) [-779.168] (-779.030) (-782.735) * [-781.545] (-781.245) (-779.036) (-782.991) -- 0:00:44
332500 -- (-780.834) (-778.910) (-783.571) [-779.736] * (-781.697) (-780.979) [-779.136] (-783.216) -- 0:00:44
333000 -- (-780.326) (-783.951) (-780.770) [-780.258] * (-779.611) (-780.150) [-781.373] (-781.437) -- 0:00:44
333500 -- [-779.293] (-783.837) (-780.641) (-779.754) * [-779.267] (-780.066) (-782.563) (-780.134) -- 0:00:43
334000 -- (-779.173) (-779.087) [-785.436] (-779.319) * [-784.284] (-780.112) (-786.329) (-780.605) -- 0:00:43
334500 -- (-778.654) [-783.442] (-781.337) (-781.054) * (-780.086) [-783.346] (-786.156) (-779.438) -- 0:00:43
335000 -- (-781.874) [-781.563] (-778.903) (-780.501) * (-781.923) (-779.622) [-781.996] (-784.591) -- 0:00:43
Average standard deviation of split frequencies: 0.010055
335500 -- [-779.003] (-782.443) (-781.098) (-782.290) * (-781.934) [-778.925] (-780.199) (-786.742) -- 0:00:43
336000 -- (-781.545) (-779.654) (-779.892) [-779.464] * (-779.303) [-781.886] (-782.159) (-782.721) -- 0:00:43
336500 -- (-779.712) (-781.443) (-779.897) [-781.092] * (-782.215) (-779.822) [-780.786] (-780.365) -- 0:00:43
337000 -- (-783.950) [-782.182] (-779.986) (-780.755) * (-782.131) (-779.576) (-779.224) [-779.795] -- 0:00:43
337500 -- (-781.089) (-781.520) [-779.501] (-781.744) * [-779.415] (-779.476) (-783.330) (-780.395) -- 0:00:43
338000 -- (-781.845) (-779.975) (-779.130) [-782.288] * (-780.238) [-779.971] (-785.461) (-780.829) -- 0:00:43
338500 -- (-785.071) (-779.584) [-779.915] (-779.813) * (-781.634) [-780.967] (-786.704) (-781.416) -- 0:00:42
339000 -- (-783.486) (-780.987) (-785.792) [-781.055] * (-779.159) [-780.167] (-782.523) (-782.170) -- 0:00:42
339500 -- (-786.239) (-783.600) (-784.690) [-779.825] * (-778.666) [-782.962] (-781.760) (-788.338) -- 0:00:42
340000 -- (-779.349) (-782.629) [-783.602] (-779.598) * (-780.473) (-779.379) [-780.846] (-786.501) -- 0:00:42
Average standard deviation of split frequencies: 0.009605
340500 -- (-783.319) [-782.667] (-779.894) (-780.629) * [-781.055] (-780.534) (-780.297) (-786.389) -- 0:00:42
341000 -- (-784.113) (-779.044) [-779.206] (-779.983) * (-784.651) (-782.784) [-780.174] (-783.260) -- 0:00:42
341500 -- (-782.260) [-785.839] (-779.924) (-782.578) * [-780.643] (-782.727) (-780.606) (-784.508) -- 0:00:42
342000 -- (-782.421) [-778.987] (-779.957) (-785.183) * (-780.540) (-781.188) [-779.307] (-779.225) -- 0:00:42
342500 -- [-779.743] (-784.390) (-778.914) (-780.174) * [-779.432] (-788.066) (-780.311) (-781.306) -- 0:00:42
343000 -- (-779.929) [-779.346] (-780.351) (-780.071) * (-779.395) [-782.454] (-780.210) (-780.911) -- 0:00:42
343500 -- [-781.825] (-780.419) (-782.955) (-782.748) * [-780.171] (-781.336) (-778.932) (-779.790) -- 0:00:42
344000 -- (-779.917) [-780.816] (-780.109) (-779.784) * (-781.012) [-781.726] (-781.610) (-779.045) -- 0:00:41
344500 -- (-781.769) (-784.516) (-780.758) [-780.603] * (-781.627) [-780.365] (-784.526) (-781.590) -- 0:00:41
345000 -- [-779.804] (-783.168) (-781.969) (-784.655) * (-784.380) [-781.831] (-780.242) (-781.004) -- 0:00:41
Average standard deviation of split frequencies: 0.011104
345500 -- [-782.867] (-782.281) (-781.947) (-781.080) * (-785.374) (-780.329) (-780.214) [-782.264] -- 0:00:41
346000 -- [-781.318] (-780.243) (-785.346) (-782.874) * (-780.787) [-779.331] (-781.865) (-783.193) -- 0:00:41
346500 -- (-783.085) [-779.485] (-782.561) (-781.542) * (-782.067) (-779.983) (-782.121) [-780.614] -- 0:00:41
347000 -- (-780.883) (-781.929) (-781.999) [-782.152] * [-778.762] (-780.179) (-780.960) (-782.089) -- 0:00:41
347500 -- (-779.167) [-779.564] (-781.764) (-782.868) * (-780.455) [-780.814] (-778.861) (-783.174) -- 0:00:41
348000 -- (-780.415) (-779.800) [-781.031] (-786.254) * [-778.672] (-782.320) (-782.545) (-780.779) -- 0:00:43
348500 -- (-786.960) (-780.451) (-781.283) [-781.860] * [-779.143] (-782.724) (-782.940) (-781.672) -- 0:00:42
349000 -- (-783.201) (-780.238) (-778.912) [-782.743] * (-778.626) [-785.773] (-785.012) (-781.785) -- 0:00:42
349500 -- (-782.270) [-781.832] (-779.460) (-780.617) * (-779.875) (-779.373) [-779.348] (-779.995) -- 0:00:42
350000 -- (-782.641) [-780.125] (-779.624) (-782.238) * (-779.876) (-784.439) (-780.193) [-780.316] -- 0:00:42
Average standard deviation of split frequencies: 0.010043
350500 -- (-783.412) (-782.598) (-778.949) [-781.803] * (-781.442) [-786.778] (-779.755) (-781.307) -- 0:00:42
351000 -- (-780.779) (-782.353) [-779.291] (-781.916) * [-780.832] (-780.888) (-779.585) (-780.671) -- 0:00:42
351500 -- [-781.144] (-780.076) (-782.799) (-782.012) * [-780.278] (-785.988) (-781.304) (-780.425) -- 0:00:42
352000 -- (-782.030) (-785.226) (-781.914) [-780.948] * (-783.879) [-783.659] (-779.541) (-782.142) -- 0:00:42
352500 -- (-779.800) (-781.745) (-781.557) [-778.906] * (-781.871) (-780.857) (-781.631) [-779.263] -- 0:00:42
353000 -- [-781.375] (-785.943) (-778.491) (-781.341) * (-778.970) (-781.413) [-779.065] (-781.650) -- 0:00:42
353500 -- (-782.393) [-779.131] (-780.339) (-779.332) * [-782.224] (-783.543) (-779.508) (-779.811) -- 0:00:42
354000 -- (-778.965) (-781.159) [-780.380] (-782.832) * (-782.148) (-780.210) (-783.360) [-781.954] -- 0:00:41
354500 -- [-778.897] (-779.460) (-782.561) (-782.036) * (-785.722) (-779.632) [-779.534] (-780.495) -- 0:00:41
355000 -- (-779.462) (-784.532) [-778.708] (-781.922) * [-780.984] (-779.192) (-782.288) (-780.777) -- 0:00:41
Average standard deviation of split frequencies: 0.009490
355500 -- [-779.430] (-780.716) (-780.073) (-779.808) * (-779.692) (-779.088) (-781.449) [-780.144] -- 0:00:41
356000 -- (-780.603) (-780.138) [-778.726] (-779.693) * [-779.166] (-782.111) (-785.610) (-788.882) -- 0:00:41
356500 -- (-780.876) [-779.672] (-778.445) (-780.413) * [-778.998] (-783.531) (-781.244) (-783.864) -- 0:00:41
357000 -- (-784.471) (-779.920) (-779.104) [-781.956] * (-780.728) [-779.178] (-783.629) (-780.713) -- 0:00:41
357500 -- (-780.019) [-779.133] (-780.223) (-780.417) * [-780.122] (-779.261) (-778.952) (-780.084) -- 0:00:41
358000 -- (-780.112) (-779.661) (-780.223) [-781.630] * (-779.306) [-779.327] (-779.441) (-781.150) -- 0:00:41
358500 -- [-779.142] (-779.759) (-782.057) (-782.264) * (-779.143) (-779.961) [-781.751] (-780.789) -- 0:00:41
359000 -- [-779.253] (-779.144) (-780.374) (-780.319) * (-781.916) [-783.147] (-782.566) (-782.047) -- 0:00:41
359500 -- (-780.217) [-779.687] (-781.270) (-781.625) * (-783.578) (-782.952) [-780.501] (-781.101) -- 0:00:40
360000 -- (-781.237) [-780.688] (-783.726) (-780.365) * (-782.286) [-782.460] (-779.845) (-779.738) -- 0:00:40
Average standard deviation of split frequencies: 0.009440
360500 -- [-784.658] (-783.210) (-782.294) (-781.668) * (-788.771) (-781.069) (-781.668) [-779.250] -- 0:00:40
361000 -- (-779.810) (-781.704) (-781.404) [-781.256] * [-780.806] (-780.773) (-781.148) (-780.007) -- 0:00:40
361500 -- (-779.953) (-786.580) [-780.823] (-780.493) * (-783.578) (-780.689) (-782.181) [-780.030] -- 0:00:40
362000 -- (-781.997) (-783.987) [-782.227] (-779.627) * (-786.322) (-782.175) [-782.671] (-782.809) -- 0:00:40
362500 -- [-779.751] (-782.675) (-782.792) (-782.095) * (-783.008) (-780.751) [-785.917] (-784.096) -- 0:00:40
363000 -- (-781.603) [-781.201] (-779.639) (-779.659) * (-782.836) [-782.340] (-783.614) (-781.247) -- 0:00:40
363500 -- [-779.583] (-784.387) (-779.072) (-780.795) * (-780.199) (-779.881) (-781.040) [-779.652] -- 0:00:40
364000 -- (-779.981) (-782.434) (-778.647) [-779.768] * (-779.319) (-780.820) [-783.788] (-783.002) -- 0:00:41
364500 -- (-782.331) (-781.052) (-780.220) [-781.855] * (-779.634) [-784.715] (-783.707) (-779.791) -- 0:00:41
365000 -- (-784.746) (-782.428) (-786.548) [-781.565] * (-783.602) [-780.822] (-781.746) (-781.676) -- 0:00:41
Average standard deviation of split frequencies: 0.009731
365500 -- (-781.750) (-783.844) (-789.335) [-781.878] * (-779.625) [-780.620] (-781.344) (-782.628) -- 0:00:41
366000 -- [-781.353] (-783.304) (-787.903) (-782.607) * (-780.101) (-782.437) [-781.560] (-781.345) -- 0:00:41
366500 -- (-781.871) (-780.550) (-786.746) [-783.388] * (-780.753) (-780.918) (-786.465) [-780.929] -- 0:00:41
367000 -- (-782.967) (-779.432) [-779.026] (-781.230) * (-779.613) [-779.343] (-783.504) (-780.272) -- 0:00:41
367500 -- (-781.289) (-788.540) [-780.009] (-779.621) * (-780.896) (-779.403) [-782.120] (-786.264) -- 0:00:41
368000 -- (-781.336) (-786.223) (-780.143) [-783.733] * (-780.282) (-779.344) [-780.612] (-783.886) -- 0:00:41
368500 -- [-781.216] (-791.105) (-778.758) (-780.756) * (-781.963) (-779.394) (-779.961) [-784.268] -- 0:00:41
369000 -- (-782.268) [-780.435] (-781.844) (-778.794) * [-781.595] (-780.489) (-780.116) (-780.554) -- 0:00:41
369500 -- [-782.115] (-780.829) (-779.847) (-780.970) * (-780.474) (-780.015) (-779.891) [-780.999] -- 0:00:40
370000 -- (-782.400) (-780.412) [-780.827] (-786.995) * (-781.222) [-781.684] (-781.015) (-783.899) -- 0:00:40
Average standard deviation of split frequencies: 0.009185
370500 -- (-780.291) [-781.980] (-785.257) (-783.565) * (-782.986) (-780.883) (-781.391) [-783.321] -- 0:00:40
371000 -- [-779.795] (-778.885) (-779.488) (-782.968) * (-779.961) (-780.694) (-783.192) [-779.630] -- 0:00:40
371500 -- (-779.829) (-779.190) [-780.850] (-780.193) * (-782.288) [-781.373] (-783.178) (-781.180) -- 0:00:40
372000 -- (-780.237) [-778.652] (-780.003) (-779.562) * (-781.421) (-780.977) (-780.429) [-782.748] -- 0:00:40
372500 -- (-781.200) (-779.336) [-781.471] (-781.999) * [-780.482] (-781.559) (-779.299) (-779.341) -- 0:00:40
373000 -- (-784.945) (-780.920) [-778.564] (-780.504) * (-782.086) [-780.394] (-781.999) (-780.461) -- 0:00:40
373500 -- (-780.248) (-782.375) (-778.509) [-779.396] * (-779.194) (-780.628) [-780.243] (-780.673) -- 0:00:40
374000 -- (-781.076) (-780.823) [-784.081] (-784.164) * (-779.653) (-779.787) [-781.886] (-779.465) -- 0:00:40
374500 -- [-781.294] (-783.936) (-780.406) (-778.989) * (-781.965) (-780.166) [-780.839] (-780.292) -- 0:00:40
375000 -- (-782.050) (-782.420) (-781.249) [-781.268] * (-781.467) (-782.551) (-778.750) [-780.265] -- 0:00:40
Average standard deviation of split frequencies: 0.008846
375500 -- (-779.752) (-781.083) (-783.293) [-779.163] * (-779.468) (-781.528) [-779.353] (-781.418) -- 0:00:39
376000 -- (-783.626) [-780.936] (-782.620) (-778.736) * (-782.700) [-779.135] (-778.979) (-781.999) -- 0:00:39
376500 -- (-783.077) (-781.190) (-780.383) [-780.899] * (-780.111) [-780.399] (-780.025) (-779.835) -- 0:00:39
377000 -- [-782.667] (-781.210) (-779.486) (-780.563) * [-781.112] (-780.196) (-780.804) (-780.479) -- 0:00:39
377500 -- (-780.896) [-779.708] (-780.300) (-782.009) * [-780.532] (-779.636) (-781.743) (-780.216) -- 0:00:39
378000 -- (-781.151) (-780.134) [-779.530] (-779.015) * (-780.418) (-780.367) [-782.565] (-780.908) -- 0:00:39
378500 -- (-781.416) (-779.647) (-779.683) [-779.277] * (-779.310) (-779.542) (-780.769) [-780.298] -- 0:00:39
379000 -- (-779.084) [-779.741] (-779.125) (-780.931) * (-779.314) (-779.531) (-785.997) [-781.104] -- 0:00:39
379500 -- (-780.447) [-781.147] (-783.222) (-781.100) * (-783.583) [-778.695] (-785.905) (-782.494) -- 0:00:40
380000 -- (-779.603) [-779.659] (-782.638) (-783.434) * (-783.380) (-780.632) [-779.043] (-782.068) -- 0:00:40
Average standard deviation of split frequencies: 0.008814
380500 -- (-781.243) (-780.207) (-782.452) [-782.018] * (-785.778) (-780.060) (-779.922) [-784.185] -- 0:00:40
381000 -- (-780.380) [-780.652] (-785.749) (-781.521) * (-781.741) (-783.190) [-779.255] (-781.489) -- 0:00:40
381500 -- (-779.753) [-784.906] (-785.014) (-780.806) * (-782.540) (-780.465) [-780.852] (-779.609) -- 0:00:40
382000 -- [-779.454] (-780.384) (-787.797) (-779.836) * (-783.403) (-782.673) [-781.424] (-785.402) -- 0:00:40
382500 -- (-780.261) (-784.380) [-781.323] (-782.062) * [-781.746] (-781.290) (-778.473) (-782.940) -- 0:00:40
383000 -- [-781.309] (-782.132) (-779.213) (-780.234) * (-779.299) [-780.110] (-780.028) (-781.370) -- 0:00:40
383500 -- (-781.808) (-783.635) [-778.909] (-780.082) * (-779.050) [-780.608] (-779.229) (-780.754) -- 0:00:40
384000 -- (-781.745) (-784.309) (-780.365) [-781.625] * [-780.722] (-783.300) (-780.711) (-779.800) -- 0:00:40
384500 -- [-780.431] (-780.408) (-779.189) (-785.521) * (-782.464) [-779.410] (-782.796) (-779.572) -- 0:00:40
385000 -- (-782.076) (-780.956) (-783.400) [-782.006] * [-779.312] (-780.697) (-779.808) (-781.326) -- 0:00:39
Average standard deviation of split frequencies: 0.007649
385500 -- (-781.244) (-783.847) [-780.250] (-780.537) * [-780.953] (-787.902) (-783.842) (-780.343) -- 0:00:39
386000 -- [-783.245] (-780.062) (-779.708) (-780.158) * (-779.144) [-787.898] (-782.040) (-778.948) -- 0:00:39
386500 -- (-783.250) (-780.816) (-782.138) [-781.366] * [-778.736] (-781.638) (-779.419) (-779.325) -- 0:00:39
387000 -- [-780.785] (-781.720) (-782.209) (-780.714) * [-778.824] (-782.460) (-778.616) (-780.295) -- 0:00:39
387500 -- (-783.917) (-780.851) [-781.140] (-779.219) * (-781.344) (-783.433) (-780.211) [-780.658] -- 0:00:39
388000 -- (-781.676) (-785.921) (-780.967) [-781.525] * [-779.944] (-783.506) (-778.969) (-779.600) -- 0:00:39
388500 -- (-782.099) (-778.944) (-780.211) [-781.063] * [-782.003] (-781.687) (-779.528) (-778.759) -- 0:00:39
389000 -- (-781.221) (-779.069) [-778.955] (-781.113) * (-783.409) [-782.012] (-780.532) (-781.826) -- 0:00:39
389500 -- (-783.651) [-783.759] (-779.841) (-781.394) * (-782.372) (-781.087) [-779.511] (-781.410) -- 0:00:39
390000 -- (-781.882) (-779.222) (-779.727) [-784.343] * (-780.712) [-782.306] (-780.236) (-781.589) -- 0:00:39
Average standard deviation of split frequencies: 0.008447
390500 -- (-783.633) [-782.163] (-780.724) (-782.455) * [-781.155] (-781.472) (-782.988) (-779.945) -- 0:00:39
391000 -- (-782.076) (-785.798) [-781.088] (-781.422) * (-781.308) [-779.035] (-781.415) (-781.114) -- 0:00:38
391500 -- (-781.574) (-784.530) (-785.126) [-782.788] * [-779.296] (-781.697) (-780.955) (-780.875) -- 0:00:38
392000 -- (-783.015) [-778.923] (-784.205) (-780.519) * [-780.012] (-781.457) (-781.222) (-780.238) -- 0:00:38
392500 -- [-785.445] (-780.014) (-779.799) (-786.698) * (-783.957) [-778.783] (-780.033) (-778.735) -- 0:00:38
393000 -- (-780.933) (-779.899) (-785.975) [-782.771] * (-782.134) [-779.818] (-779.349) (-781.103) -- 0:00:38
393500 -- (-784.150) [-781.153] (-783.393) (-779.623) * (-783.608) [-780.931] (-782.512) (-781.144) -- 0:00:38
394000 -- (-782.217) (-779.442) [-783.174] (-780.610) * (-779.308) [-782.966] (-785.514) (-781.669) -- 0:00:38
394500 -- (-780.892) [-779.507] (-779.045) (-780.440) * [-779.717] (-779.821) (-783.109) (-784.469) -- 0:00:38
395000 -- (-780.111) (-781.618) (-780.352) [-781.109] * [-779.637] (-779.318) (-781.068) (-780.952) -- 0:00:38
Average standard deviation of split frequencies: 0.007870
395500 -- [-780.686] (-780.038) (-778.776) (-783.457) * [-780.103] (-781.788) (-781.394) (-779.038) -- 0:00:39
396000 -- (-779.995) (-781.656) [-779.071] (-781.576) * [-780.429] (-780.253) (-779.491) (-779.796) -- 0:00:39
396500 -- (-782.033) (-783.697) [-781.743] (-780.412) * (-779.939) (-780.184) [-782.432] (-784.053) -- 0:00:39
397000 -- (-783.218) (-780.290) (-779.448) [-780.595] * [-779.239] (-780.734) (-781.556) (-786.067) -- 0:00:39
397500 -- (-780.325) (-780.289) (-781.045) [-781.170] * (-782.329) [-782.173] (-778.969) (-780.825) -- 0:00:39
398000 -- (-779.284) [-779.670] (-783.477) (-782.379) * (-781.807) (-781.079) (-779.812) [-779.766] -- 0:00:39
398500 -- (-781.924) (-780.419) (-782.589) [-780.091] * (-779.571) [-781.814] (-780.619) (-783.476) -- 0:00:39
399000 -- [-779.701] (-779.083) (-782.317) (-779.447) * (-779.317) (-779.026) (-782.944) [-783.569] -- 0:00:39
399500 -- (-782.274) [-779.576] (-783.325) (-781.375) * (-781.943) (-781.455) [-780.869] (-784.412) -- 0:00:39
400000 -- (-781.286) (-779.122) [-780.270] (-783.795) * (-780.731) (-781.949) (-782.688) [-786.022] -- 0:00:39
Average standard deviation of split frequencies: 0.008236
400500 -- (-779.109) (-779.116) [-781.750] (-780.508) * [-779.548] (-781.370) (-782.127) (-781.116) -- 0:00:38
401000 -- (-781.347) [-779.018] (-783.649) (-779.648) * [-778.876] (-781.607) (-780.399) (-780.938) -- 0:00:38
401500 -- (-787.299) (-780.638) [-784.614] (-780.919) * (-779.757) (-780.356) [-783.137] (-781.961) -- 0:00:38
402000 -- (-779.874) (-779.391) [-782.614] (-780.365) * (-779.435) (-779.562) (-783.746) [-781.272] -- 0:00:38
402500 -- [-780.246] (-779.474) (-781.639) (-780.571) * (-780.340) [-779.637] (-780.096) (-782.284) -- 0:00:38
403000 -- (-781.208) [-781.139] (-781.350) (-780.578) * (-784.806) (-781.971) (-781.994) [-779.178] -- 0:00:38
403500 -- (-783.102) [-779.783] (-782.264) (-781.330) * (-778.985) (-780.356) (-780.247) [-782.024] -- 0:00:38
404000 -- (-782.947) [-780.129] (-779.091) (-783.677) * (-780.043) (-786.197) (-779.769) [-781.504] -- 0:00:38
404500 -- (-780.303) (-783.944) [-781.258] (-787.662) * (-783.024) (-779.311) [-779.766] (-781.707) -- 0:00:38
405000 -- (-780.095) (-783.975) [-779.975] (-785.710) * [-779.912] (-779.690) (-779.947) (-781.861) -- 0:00:38
Average standard deviation of split frequencies: 0.008515
405500 -- (-779.397) (-780.778) (-781.885) [-781.780] * (-779.331) (-779.744) [-778.999] (-781.580) -- 0:00:38
406000 -- (-780.357) (-784.377) [-778.928] (-780.116) * (-780.010) [-780.073] (-782.941) (-780.599) -- 0:00:38
406500 -- (-779.552) [-781.970] (-782.671) (-780.375) * (-783.858) [-783.067] (-780.300) (-781.705) -- 0:00:37
407000 -- (-780.807) (-781.352) [-781.827] (-784.423) * (-783.291) (-782.216) [-781.572] (-779.850) -- 0:00:37
407500 -- [-781.236] (-782.841) (-783.238) (-780.916) * (-784.483) (-782.593) [-780.079] (-780.336) -- 0:00:37
408000 -- (-787.905) [-781.730] (-787.449) (-781.186) * [-786.597] (-778.914) (-781.372) (-779.098) -- 0:00:37
408500 -- (-784.617) [-781.328] (-782.909) (-780.949) * (-781.548) [-778.833] (-782.082) (-781.319) -- 0:00:37
409000 -- (-782.922) (-787.234) [-782.382] (-784.943) * (-783.397) [-779.363] (-782.953) (-780.813) -- 0:00:37
409500 -- (-784.745) [-784.545] (-782.788) (-780.661) * (-780.871) [-779.951] (-779.194) (-780.641) -- 0:00:37
410000 -- (-783.225) [-785.449] (-780.016) (-785.009) * (-780.876) (-779.644) [-779.905] (-780.486) -- 0:00:37
Average standard deviation of split frequencies: 0.007630
410500 -- (-779.458) [-780.563] (-783.901) (-780.764) * (-779.549) (-780.422) [-779.937] (-782.805) -- 0:00:37
411000 -- (-779.496) [-778.741] (-779.470) (-779.753) * (-781.740) (-780.014) (-780.056) [-779.426] -- 0:00:37
411500 -- (-781.680) (-781.314) (-780.115) [-779.579] * (-783.825) (-779.756) (-782.809) [-780.150] -- 0:00:37
412000 -- (-779.556) (-783.272) (-784.864) [-781.036] * (-780.140) [-779.744] (-779.133) (-780.128) -- 0:00:38
412500 -- (-785.122) (-782.543) (-780.151) [-780.707] * (-781.475) (-782.002) [-782.128] (-780.935) -- 0:00:38
413000 -- [-780.753] (-780.700) (-780.444) (-781.553) * (-781.343) [-779.645] (-781.788) (-779.480) -- 0:00:38
413500 -- (-779.015) [-779.022] (-779.568) (-780.196) * (-781.695) [-778.737] (-779.586) (-782.225) -- 0:00:38
414000 -- (-780.412) (-780.338) [-779.077] (-782.000) * (-787.316) (-778.737) (-779.834) [-781.033] -- 0:00:38
414500 -- (-784.561) [-781.311] (-780.287) (-779.736) * (-784.703) (-780.382) (-781.784) [-780.849] -- 0:00:38
415000 -- [-781.672] (-780.747) (-784.890) (-785.351) * (-780.658) (-783.299) (-780.917) [-779.431] -- 0:00:38
Average standard deviation of split frequencies: 0.008199
415500 -- (-781.430) [-780.602] (-782.145) (-784.593) * [-780.294] (-779.953) (-781.447) (-779.892) -- 0:00:37
416000 -- (-781.121) (-780.797) [-780.234] (-780.286) * (-779.514) (-781.477) (-779.918) [-779.194] -- 0:00:37
416500 -- (-781.929) (-778.973) [-780.238] (-779.662) * (-780.888) (-778.930) (-781.325) [-779.237] -- 0:00:37
417000 -- (-780.368) (-778.819) (-780.454) [-779.459] * (-779.962) (-779.578) (-779.114) [-780.926] -- 0:00:37
417500 -- (-780.367) (-782.669) [-778.969] (-780.444) * (-781.118) (-779.333) [-779.012] (-782.575) -- 0:00:37
418000 -- (-782.529) (-779.635) (-780.440) [-778.754] * (-779.732) (-780.776) [-780.192] (-779.292) -- 0:00:37
418500 -- [-779.695] (-779.775) (-781.057) (-779.656) * (-781.062) [-779.513] (-779.140) (-779.383) -- 0:00:37
419000 -- (-780.574) [-779.805] (-780.400) (-780.072) * (-781.048) (-781.143) (-779.152) [-781.547] -- 0:00:37
419500 -- (-779.248) (-781.571) [-781.118] (-781.296) * [-782.814] (-781.687) (-780.327) (-783.170) -- 0:00:37
420000 -- [-783.975] (-781.561) (-781.946) (-780.197) * [-780.016] (-781.314) (-781.353) (-780.602) -- 0:00:37
Average standard deviation of split frequencies: 0.008194
420500 -- (-779.619) [-779.774] (-780.149) (-779.002) * [-779.292] (-781.881) (-780.730) (-781.353) -- 0:00:37
421000 -- (-782.446) (-779.821) (-780.095) [-780.580] * (-781.507) (-781.249) (-781.249) [-781.418] -- 0:00:37
421500 -- [-779.488] (-780.234) (-780.588) (-783.933) * (-779.753) [-781.503] (-781.241) (-779.812) -- 0:00:37
422000 -- (-779.996) (-780.992) [-779.207] (-781.851) * (-783.866) [-780.429] (-779.722) (-781.530) -- 0:00:36
422500 -- [-780.969] (-782.856) (-781.645) (-781.553) * (-782.756) [-779.446] (-780.305) (-780.761) -- 0:00:36
423000 -- [-781.840] (-783.844) (-782.978) (-780.332) * [-780.598] (-781.626) (-780.190) (-781.565) -- 0:00:36
423500 -- [-780.362] (-786.643) (-780.888) (-781.908) * (-779.784) (-783.738) [-779.515] (-781.518) -- 0:00:36
424000 -- [-783.456] (-786.410) (-782.107) (-784.075) * (-781.907) (-780.208) [-781.721] (-785.347) -- 0:00:36
424500 -- (-780.665) (-785.397) [-780.702] (-785.675) * [-782.290] (-779.372) (-779.322) (-782.244) -- 0:00:36
425000 -- (-781.156) [-782.905] (-781.929) (-779.680) * (-780.771) [-778.905] (-778.694) (-782.835) -- 0:00:36
Average standard deviation of split frequencies: 0.008092
425500 -- [-780.772] (-780.532) (-783.527) (-779.558) * (-778.707) [-780.236] (-779.656) (-780.861) -- 0:00:36
426000 -- (-779.723) [-780.620] (-780.069) (-778.692) * (-778.989) [-780.526] (-781.426) (-783.011) -- 0:00:36
426500 -- [-781.674] (-781.566) (-788.219) (-780.075) * (-782.810) (-778.879) [-780.526] (-779.540) -- 0:00:36
427000 -- (-782.142) (-782.294) [-781.170] (-781.950) * (-785.822) [-780.107] (-779.428) (-780.609) -- 0:00:36
427500 -- [-779.668] (-779.339) (-785.558) (-779.192) * (-779.388) [-780.992] (-779.217) (-780.791) -- 0:00:36
428000 -- (-780.801) [-780.863] (-779.962) (-781.625) * (-779.816) (-781.828) (-779.762) [-781.098] -- 0:00:37
428500 -- (-782.497) (-780.951) [-779.516] (-779.210) * [-780.034] (-779.784) (-781.442) (-778.919) -- 0:00:37
429000 -- (-783.652) [-782.421] (-779.406) (-780.440) * (-780.947) [-782.900] (-780.890) (-779.203) -- 0:00:37
429500 -- [-782.176] (-781.773) (-779.979) (-781.610) * (-782.112) (-782.486) [-780.056] (-782.919) -- 0:00:37
430000 -- (-780.625) (-782.926) [-781.687] (-780.039) * (-780.669) (-780.567) (-784.588) [-781.339] -- 0:00:37
Average standard deviation of split frequencies: 0.007727
430500 -- (-782.332) [-782.619] (-780.623) (-784.010) * (-783.366) (-781.311) (-783.764) [-779.569] -- 0:00:37
431000 -- (-779.503) (-780.953) (-781.220) [-782.186] * (-781.254) [-780.249] (-783.356) (-780.337) -- 0:00:36
431500 -- (-782.042) (-779.278) [-780.581] (-780.456) * (-779.077) (-779.728) [-779.589] (-781.245) -- 0:00:36
432000 -- (-781.547) (-778.989) (-786.371) [-779.447] * (-779.767) [-780.720] (-781.413) (-780.933) -- 0:00:36
432500 -- (-784.235) [-782.079] (-786.032) (-778.515) * (-787.656) (-780.316) [-780.936] (-780.363) -- 0:00:36
433000 -- (-782.574) (-786.876) (-786.805) [-780.297] * (-782.417) [-780.180] (-781.791) (-781.386) -- 0:00:36
433500 -- [-780.529] (-782.196) (-783.381) (-778.543) * (-781.684) (-782.494) [-779.974] (-780.014) -- 0:00:36
434000 -- [-779.815] (-783.689) (-787.801) (-780.159) * (-780.732) [-780.315] (-778.990) (-778.997) -- 0:00:36
434500 -- (-779.881) (-784.575) (-779.487) [-780.951] * (-784.434) (-782.790) [-779.433] (-780.403) -- 0:00:36
435000 -- [-779.994] (-779.615) (-780.802) (-782.629) * (-784.811) (-784.059) (-779.463) [-780.952] -- 0:00:36
Average standard deviation of split frequencies: 0.007950
435500 -- [-780.728] (-780.215) (-780.852) (-781.630) * [-786.119] (-781.057) (-781.831) (-778.888) -- 0:00:36
436000 -- (-780.160) (-784.144) (-782.139) [-782.823] * (-781.568) (-783.142) (-784.035) [-780.359] -- 0:00:36
436500 -- (-780.699) (-782.082) [-781.166] (-780.585) * (-783.507) [-780.752] (-779.542) (-779.844) -- 0:00:36
437000 -- [-781.723] (-778.760) (-784.354) (-784.113) * (-780.548) [-779.071] (-779.461) (-781.723) -- 0:00:36
437500 -- [-783.476] (-781.346) (-779.942) (-782.408) * (-781.290) (-780.775) (-778.932) [-779.751] -- 0:00:36
438000 -- (-782.051) (-782.683) [-780.303] (-782.307) * (-779.080) (-780.981) [-784.380] (-780.310) -- 0:00:35
438500 -- (-784.330) [-778.653] (-780.864) (-779.677) * (-779.382) (-781.622) [-779.837] (-779.995) -- 0:00:35
439000 -- (-780.635) (-779.994) [-782.419] (-780.598) * (-783.220) (-779.768) (-780.489) [-782.337] -- 0:00:35
439500 -- [-781.404] (-779.935) (-779.862) (-780.133) * (-781.042) (-783.247) (-781.953) [-780.361] -- 0:00:35
440000 -- [-780.160] (-781.237) (-789.135) (-780.081) * [-779.544] (-782.833) (-779.058) (-780.507) -- 0:00:35
Average standard deviation of split frequencies: 0.007677
440500 -- (-780.058) (-778.942) (-787.674) [-781.637] * [-781.400] (-781.805) (-782.034) (-781.772) -- 0:00:35
441000 -- (-781.320) [-780.676] (-780.077) (-781.794) * [-780.919] (-784.612) (-782.504) (-783.521) -- 0:00:35
441500 -- [-780.334] (-780.195) (-780.902) (-783.186) * (-781.627) (-784.366) (-782.222) [-781.871] -- 0:00:35
442000 -- [-784.264] (-786.426) (-779.667) (-780.524) * [-780.681] (-787.225) (-781.001) (-782.962) -- 0:00:35
442500 -- [-780.055] (-781.914) (-781.393) (-779.120) * (-781.575) (-783.164) [-779.816] (-782.008) -- 0:00:35
443000 -- (-781.331) (-783.373) [-781.177] (-778.704) * (-781.171) (-780.844) (-779.574) [-780.671] -- 0:00:35
443500 -- [-782.034] (-780.749) (-783.597) (-779.165) * (-778.867) (-784.528) (-779.005) [-779.800] -- 0:00:35
444000 -- (-781.227) (-779.586) [-781.589] (-784.121) * (-782.475) [-781.267] (-779.621) (-780.008) -- 0:00:36
444500 -- [-778.941] (-781.024) (-780.606) (-779.874) * (-779.064) (-781.275) [-783.185] (-781.567) -- 0:00:36
445000 -- [-780.555] (-780.265) (-781.585) (-781.746) * (-779.744) (-780.983) [-781.807] (-785.349) -- 0:00:36
Average standard deviation of split frequencies: 0.007337
445500 -- [-780.722] (-780.423) (-779.669) (-782.761) * (-780.071) (-779.607) (-782.788) [-783.144] -- 0:00:36
446000 -- (-782.036) (-779.838) [-780.011] (-781.087) * (-780.066) (-780.024) (-781.583) [-780.987] -- 0:00:36
446500 -- (-783.030) (-780.400) [-779.087] (-780.870) * [-780.866] (-782.741) (-779.415) (-782.705) -- 0:00:35
447000 -- [-780.807] (-781.034) (-785.158) (-779.475) * (-780.782) (-781.273) (-780.484) [-781.254] -- 0:00:35
447500 -- (-781.274) (-779.941) [-781.611] (-780.033) * (-779.511) [-779.387] (-784.341) (-792.228) -- 0:00:35
448000 -- [-780.953] (-780.000) (-785.026) (-781.945) * [-785.548] (-780.144) (-781.912) (-784.507) -- 0:00:35
448500 -- [-781.506] (-779.562) (-783.678) (-782.339) * (-784.442) (-780.660) [-781.355] (-778.873) -- 0:00:35
449000 -- (-782.547) (-779.720) (-782.007) [-780.261] * (-783.944) (-783.064) [-781.360] (-785.221) -- 0:00:35
449500 -- (-785.469) (-779.554) [-782.455] (-779.135) * (-783.234) (-781.730) (-779.757) [-779.317] -- 0:00:35
450000 -- [-781.836] (-779.429) (-778.773) (-779.182) * (-781.711) (-787.055) (-779.837) [-779.916] -- 0:00:35
Average standard deviation of split frequencies: 0.006276
450500 -- (-779.584) (-780.174) [-778.669] (-784.449) * (-782.100) (-786.837) (-784.168) [-780.704] -- 0:00:35
451000 -- (-779.955) [-779.168] (-778.768) (-784.071) * (-780.043) (-786.746) [-780.277] (-786.301) -- 0:00:35
451500 -- [-779.062] (-783.345) (-780.142) (-780.886) * (-779.852) [-783.868] (-780.573) (-783.158) -- 0:00:35
452000 -- (-780.466) [-781.012] (-779.664) (-782.477) * [-779.483] (-780.131) (-781.817) (-780.662) -- 0:00:35
452500 -- (-781.770) (-782.454) [-779.053] (-779.274) * (-782.274) (-779.369) [-779.494] (-781.235) -- 0:00:35
453000 -- (-781.538) (-780.319) (-779.914) [-780.696] * (-783.717) [-780.149] (-781.029) (-781.000) -- 0:00:35
453500 -- (-788.181) [-779.106] (-780.863) (-781.263) * (-782.827) (-781.648) [-782.992] (-782.517) -- 0:00:34
454000 -- [-783.547] (-781.255) (-782.234) (-781.084) * (-779.713) [-779.308] (-779.056) (-781.330) -- 0:00:34
454500 -- (-778.855) (-781.801) [-779.689] (-786.058) * [-782.219] (-779.799) (-780.133) (-779.560) -- 0:00:34
455000 -- [-781.242] (-782.545) (-780.470) (-779.979) * (-778.795) (-781.203) (-786.573) [-782.452] -- 0:00:34
Average standard deviation of split frequencies: 0.007480
455500 -- [-781.003] (-784.452) (-785.815) (-780.596) * (-781.217) (-783.716) [-781.077] (-779.610) -- 0:00:34
456000 -- (-781.169) (-783.697) (-781.246) [-781.447] * [-779.346] (-783.446) (-779.799) (-780.985) -- 0:00:34
456500 -- (-781.454) (-781.182) [-783.811] (-780.805) * (-780.660) (-780.016) [-779.429] (-780.639) -- 0:00:34
457000 -- (-780.890) (-779.415) [-782.002] (-780.606) * (-780.843) [-785.078] (-779.917) (-782.353) -- 0:00:34
457500 -- (-782.996) (-778.807) [-779.390] (-788.534) * (-781.132) (-785.826) (-780.078) [-782.356] -- 0:00:34
458000 -- (-783.693) (-779.408) [-782.131] (-785.680) * (-781.333) [-780.131] (-781.526) (-784.842) -- 0:00:34
458500 -- (-779.709) (-782.283) [-781.969] (-783.882) * (-779.283) (-783.529) [-781.383] (-788.764) -- 0:00:34
459000 -- (-779.860) [-779.461] (-783.974) (-779.714) * (-779.187) [-782.854] (-784.870) (-782.697) -- 0:00:34
459500 -- (-780.576) (-781.271) [-781.057] (-784.471) * [-780.691] (-781.891) (-783.082) (-784.396) -- 0:00:35
460000 -- (-781.234) (-780.011) [-782.867] (-782.068) * [-781.146] (-779.300) (-784.244) (-781.807) -- 0:00:35
Average standard deviation of split frequencies: 0.007803
460500 -- (-781.925) (-780.354) [-780.847] (-784.848) * (-781.332) [-779.055] (-781.869) (-779.919) -- 0:00:35
461000 -- [-784.639] (-783.094) (-783.481) (-781.970) * (-780.232) [-779.842] (-782.449) (-778.836) -- 0:00:35
461500 -- (-782.922) [-784.067] (-780.546) (-780.213) * (-782.608) (-781.248) (-780.744) [-779.254] -- 0:00:35
462000 -- (-782.077) (-779.319) (-778.831) [-779.983] * (-779.500) [-780.631] (-781.137) (-785.232) -- 0:00:34
462500 -- [-782.220] (-779.576) (-779.962) (-780.378) * (-779.939) (-780.100) [-781.395] (-779.606) -- 0:00:34
463000 -- (-782.761) [-779.419] (-783.650) (-786.295) * (-783.213) [-781.840] (-779.157) (-783.442) -- 0:00:34
463500 -- (-782.375) (-782.966) [-781.238] (-782.418) * (-783.217) (-784.177) (-779.603) [-780.827] -- 0:00:34
464000 -- (-782.986) (-779.704) (-788.778) [-780.190] * (-778.993) [-783.530] (-781.227) (-783.124) -- 0:00:34
464500 -- (-781.298) [-778.965] (-784.431) (-779.490) * [-782.151] (-781.343) (-779.200) (-783.561) -- 0:00:34
465000 -- (-781.864) [-779.597] (-781.621) (-780.342) * (-783.327) (-779.877) [-779.005] (-788.770) -- 0:00:34
Average standard deviation of split frequencies: 0.007141
465500 -- (-779.659) (-782.608) (-785.346) [-780.328] * (-781.011) (-782.013) (-779.202) [-783.993] -- 0:00:34
466000 -- [-778.814] (-781.996) (-779.653) (-780.608) * (-781.411) [-782.077] (-779.576) (-780.859) -- 0:00:34
466500 -- [-780.554] (-780.810) (-780.724) (-782.073) * [-784.567] (-785.680) (-779.433) (-778.978) -- 0:00:34
467000 -- (-779.260) [-782.410] (-781.374) (-783.067) * (-784.147) (-780.637) (-782.877) [-782.626] -- 0:00:34
467500 -- (-778.856) (-782.490) (-781.103) [-781.245] * [-781.171] (-779.226) (-781.174) (-780.140) -- 0:00:34
468000 -- (-780.766) [-779.758] (-781.550) (-780.209) * (-779.320) [-779.175] (-779.817) (-779.304) -- 0:00:34
468500 -- (-782.376) (-780.564) (-782.300) [-781.609] * (-780.427) [-780.316] (-780.340) (-781.012) -- 0:00:34
469000 -- [-780.013] (-779.759) (-780.341) (-783.621) * (-780.484) (-782.701) [-781.132] (-782.456) -- 0:00:33
469500 -- (-779.614) (-779.423) [-779.629] (-783.712) * (-779.631) [-782.308] (-779.956) (-780.907) -- 0:00:33
470000 -- [-779.286] (-781.652) (-781.347) (-785.255) * (-779.032) [-782.166] (-785.156) (-781.388) -- 0:00:33
Average standard deviation of split frequencies: 0.007261
470500 -- (-780.819) [-780.953] (-781.336) (-780.474) * [-780.942] (-780.384) (-780.541) (-778.841) -- 0:00:33
471000 -- [-781.337] (-780.345) (-782.330) (-782.153) * (-783.588) (-779.062) (-782.063) [-779.766] -- 0:00:33
471500 -- [-778.534] (-779.130) (-779.463) (-781.960) * (-781.440) [-779.572] (-783.226) (-779.449) -- 0:00:33
472000 -- (-779.100) [-779.844] (-780.526) (-781.581) * [-781.787] (-783.214) (-781.628) (-781.636) -- 0:00:33
472500 -- [-784.830] (-782.534) (-780.212) (-780.694) * [-779.347] (-785.951) (-781.289) (-780.609) -- 0:00:33
473000 -- [-780.895] (-781.773) (-782.350) (-783.070) * (-780.451) (-782.661) (-780.495) [-784.783] -- 0:00:33
473500 -- (-781.350) (-779.457) (-779.546) [-782.170] * (-780.986) [-780.519] (-781.010) (-780.638) -- 0:00:33
474000 -- (-780.549) [-779.986] (-780.161) (-779.337) * (-780.678) (-780.977) [-781.474] (-779.345) -- 0:00:33
474500 -- [-782.620] (-781.522) (-781.642) (-779.289) * [-780.099] (-785.615) (-779.677) (-779.961) -- 0:00:33
475000 -- (-783.390) [-780.463] (-778.901) (-779.973) * (-782.381) (-779.863) [-783.938] (-781.907) -- 0:00:33
Average standard deviation of split frequencies: 0.007748
475500 -- (-784.816) (-782.648) [-779.116] (-781.791) * (-779.104) [-780.933] (-782.227) (-780.649) -- 0:00:34
476000 -- (-781.771) [-780.885] (-779.566) (-783.348) * (-779.053) (-779.201) (-783.682) [-786.436] -- 0:00:34
476500 -- (-779.066) (-780.632) (-779.702) [-778.935] * (-783.464) [-779.309] (-779.181) (-787.940) -- 0:00:34
477000 -- (-784.927) (-781.683) [-782.313] (-782.186) * [-779.897] (-779.834) (-782.300) (-788.256) -- 0:00:33
477500 -- (-783.637) (-783.414) [-783.166] (-779.843) * (-780.518) [-782.308] (-780.571) (-786.119) -- 0:00:33
478000 -- (-782.397) (-782.327) [-783.464] (-780.828) * [-779.981] (-781.434) (-779.964) (-780.527) -- 0:00:33
478500 -- [-779.549] (-781.536) (-781.168) (-780.631) * (-782.734) (-782.505) (-781.683) [-782.049] -- 0:00:33
479000 -- [-779.994] (-782.030) (-783.916) (-779.053) * [-778.740] (-779.949) (-785.520) (-781.113) -- 0:00:33
479500 -- [-781.705] (-782.163) (-780.190) (-782.562) * (-778.711) (-781.228) [-781.448] (-780.751) -- 0:00:33
480000 -- (-781.932) [-779.484] (-782.540) (-780.657) * (-779.148) [-781.978] (-780.541) (-779.172) -- 0:00:33
Average standard deviation of split frequencies: 0.008030
480500 -- (-780.610) [-779.483] (-783.474) (-779.934) * [-779.001] (-782.037) (-779.267) (-778.984) -- 0:00:33
481000 -- (-782.397) (-783.330) [-779.440] (-780.992) * (-784.768) (-780.018) [-780.624] (-778.698) -- 0:00:33
481500 -- (-781.023) (-784.558) [-779.285] (-780.025) * (-783.966) [-781.305] (-781.140) (-780.585) -- 0:00:33
482000 -- (-780.055) (-781.577) [-778.758] (-780.002) * (-782.120) (-782.395) (-781.561) [-782.230] -- 0:00:33
482500 -- (-779.564) (-782.658) (-779.584) [-779.269] * (-780.390) [-780.324] (-779.525) (-782.590) -- 0:00:33
483000 -- (-781.215) (-782.704) [-779.533] (-781.032) * (-780.419) [-781.175] (-782.377) (-781.643) -- 0:00:33
483500 -- [-782.980] (-784.032) (-781.096) (-780.889) * (-786.001) [-781.396] (-781.742) (-783.906) -- 0:00:33
484000 -- [-780.541] (-788.585) (-782.571) (-782.996) * [-779.099] (-780.388) (-782.214) (-780.362) -- 0:00:33
484500 -- (-785.893) [-781.098] (-783.048) (-783.826) * [-781.090] (-781.654) (-781.585) (-779.756) -- 0:00:32
485000 -- (-783.200) (-782.085) (-782.452) [-781.707] * [-779.627] (-779.584) (-782.812) (-781.638) -- 0:00:32
Average standard deviation of split frequencies: 0.008216
485500 -- (-781.777) (-779.170) [-781.832] (-782.504) * [-781.588] (-780.442) (-781.022) (-778.795) -- 0:00:32
486000 -- (-780.366) (-781.786) (-780.305) [-782.522] * (-779.661) (-779.685) [-779.102] (-781.393) -- 0:00:32
486500 -- (-780.442) [-779.627] (-778.938) (-782.727) * [-784.942] (-781.617) (-782.300) (-780.998) -- 0:00:32
487000 -- (-782.778) (-780.416) [-779.214] (-779.562) * (-783.451) (-781.839) (-782.155) [-780.390] -- 0:00:32
487500 -- (-779.779) (-782.330) (-780.293) [-779.479] * (-779.404) (-783.134) (-780.309) [-779.097] -- 0:00:32
488000 -- [-779.745] (-782.341) (-781.562) (-779.705) * (-785.780) [-785.667] (-780.616) (-781.102) -- 0:00:32
488500 -- (-781.438) (-787.281) (-783.423) [-784.442] * (-783.240) [-781.876] (-780.467) (-781.919) -- 0:00:32
489000 -- [-780.401] (-779.631) (-782.328) (-782.221) * (-779.599) (-782.557) (-780.847) [-782.368] -- 0:00:32
489500 -- (-780.837) (-780.004) (-782.498) [-789.043] * (-780.957) (-779.290) [-782.841] (-779.735) -- 0:00:32
490000 -- (-779.619) (-780.579) [-781.733] (-786.275) * (-780.850) (-779.048) (-782.479) [-780.785] -- 0:00:32
Average standard deviation of split frequencies: 0.007969
490500 -- (-782.527) [-780.416] (-781.797) (-782.608) * [-780.122] (-782.580) (-782.299) (-781.870) -- 0:00:32
491000 -- (-780.836) [-783.287] (-779.633) (-781.088) * (-780.173) (-781.350) [-779.983] (-781.091) -- 0:00:32
491500 -- (-781.838) (-781.854) [-784.715] (-780.521) * (-779.814) [-779.206] (-780.111) (-782.211) -- 0:00:32
492000 -- [-785.465] (-780.936) (-778.965) (-780.264) * (-779.976) [-779.864] (-783.044) (-780.506) -- 0:00:33
492500 -- [-781.340] (-785.180) (-779.262) (-779.901) * [-781.321] (-780.697) (-781.199) (-779.246) -- 0:00:32
493000 -- [-782.613] (-780.517) (-779.781) (-781.128) * [-780.359] (-780.628) (-782.885) (-779.217) -- 0:00:32
493500 -- (-780.862) [-780.838] (-781.999) (-782.771) * (-780.451) [-779.740] (-782.904) (-778.938) -- 0:00:32
494000 -- (-781.515) (-780.457) [-780.191] (-780.539) * (-778.933) (-780.538) (-778.964) [-778.873] -- 0:00:32
494500 -- [-783.536] (-781.059) (-779.549) (-782.973) * (-779.691) (-781.690) (-780.581) [-781.750] -- 0:00:32
495000 -- (-783.972) (-779.957) [-785.502] (-780.584) * (-779.727) (-783.177) [-782.035] (-780.704) -- 0:00:32
Average standard deviation of split frequencies: 0.008554
495500 -- (-778.869) [-781.202] (-781.464) (-780.797) * (-781.004) [-778.503] (-779.595) (-779.851) -- 0:00:32
496000 -- (-778.987) (-779.909) (-780.737) [-779.462] * (-781.274) [-780.429] (-781.869) (-781.675) -- 0:00:32
496500 -- (-780.408) (-780.445) [-780.656] (-778.456) * (-780.683) (-781.546) (-785.433) [-781.075] -- 0:00:32
497000 -- [-778.581] (-779.478) (-783.426) (-780.612) * (-779.637) [-779.268] (-785.761) (-778.713) -- 0:00:32
497500 -- [-780.930] (-781.672) (-783.679) (-788.806) * (-780.631) (-787.853) [-782.045] (-781.711) -- 0:00:32
498000 -- (-780.080) (-781.833) [-781.021] (-781.405) * [-779.973] (-779.493) (-785.338) (-782.275) -- 0:00:32
498500 -- [-779.507] (-780.259) (-781.731) (-781.044) * (-781.186) [-779.058] (-781.434) (-779.387) -- 0:00:32
499000 -- (-779.298) (-780.509) [-781.837] (-783.429) * (-780.046) (-779.344) [-780.879] (-778.982) -- 0:00:32
499500 -- (-782.552) [-780.234] (-779.416) (-779.867) * (-783.073) (-779.279) (-782.756) [-780.853] -- 0:00:32
500000 -- (-781.439) [-782.738] (-784.030) (-780.908) * (-779.303) (-779.398) [-778.805] (-779.881) -- 0:00:32
Average standard deviation of split frequencies: 0.008585
500500 -- (-781.113) [-780.985] (-788.209) (-781.439) * [-780.004] (-780.673) (-779.638) (-779.155) -- 0:00:31
501000 -- (-778.875) (-778.984) [-783.032] (-781.824) * (-782.224) [-779.284] (-779.049) (-779.011) -- 0:00:31
501500 -- (-780.812) (-782.879) [-780.363] (-779.932) * [-779.193] (-781.736) (-783.287) (-781.581) -- 0:00:31
502000 -- [-779.824] (-783.088) (-779.537) (-781.456) * (-779.069) (-781.991) [-779.893] (-782.637) -- 0:00:31
502500 -- [-779.326] (-782.891) (-784.604) (-781.269) * (-778.910) (-780.530) [-786.339] (-782.486) -- 0:00:31
503000 -- (-781.788) (-783.937) [-781.615] (-778.927) * (-779.257) [-780.625] (-782.035) (-782.473) -- 0:00:31
503500 -- (-787.819) (-782.955) [-779.020] (-786.733) * (-781.717) (-780.162) [-780.635] (-780.232) -- 0:00:31
504000 -- (-788.349) (-782.341) [-780.171] (-782.244) * (-782.526) (-782.870) [-779.094] (-783.795) -- 0:00:31
504500 -- (-781.745) [-780.044] (-782.631) (-784.925) * [-784.607] (-780.332) (-779.337) (-779.318) -- 0:00:31
505000 -- (-782.259) [-778.723] (-780.533) (-780.831) * (-779.507) (-779.055) (-783.840) [-780.452] -- 0:00:31
Average standard deviation of split frequencies: 0.008823
505500 -- (-781.397) (-780.640) (-782.531) [-780.383] * (-779.426) (-779.312) (-781.894) [-782.591] -- 0:00:31
506000 -- (-781.700) [-780.228] (-781.312) (-783.231) * (-779.812) (-779.821) (-781.556) [-781.260] -- 0:00:31
506500 -- (-781.477) [-780.885] (-783.599) (-785.275) * (-780.903) [-778.999] (-780.345) (-782.116) -- 0:00:31
507000 -- (-786.895) [-782.522] (-781.030) (-779.788) * (-780.350) (-782.316) [-780.532] (-782.725) -- 0:00:31
507500 -- [-779.733] (-782.587) (-780.405) (-780.843) * [-780.529] (-781.326) (-780.497) (-780.924) -- 0:00:31
508000 -- (-781.480) (-782.103) (-779.554) [-786.535] * (-782.567) (-787.280) (-781.929) [-780.942] -- 0:00:31
508500 -- (-781.042) (-783.268) (-778.569) [-783.872] * (-779.297) [-783.322] (-780.098) (-785.354) -- 0:00:31
509000 -- (-779.738) (-781.515) (-782.976) [-780.440] * (-781.534) (-779.505) [-780.584] (-780.049) -- 0:00:31
509500 -- (-779.768) [-782.870] (-780.577) (-782.137) * (-781.417) (-780.738) [-780.254] (-781.649) -- 0:00:31
510000 -- (-780.492) (-782.335) [-781.903] (-779.637) * (-782.892) [-781.492] (-784.325) (-782.196) -- 0:00:31
Average standard deviation of split frequencies: 0.009000
510500 -- (-780.803) [-780.388] (-779.061) (-780.225) * (-782.265) (-781.715) [-781.495] (-785.146) -- 0:00:31
511000 -- (-780.668) (-778.789) [-779.437] (-781.373) * (-788.333) (-779.918) [-780.627] (-784.677) -- 0:00:31
511500 -- (-783.790) [-781.608] (-779.506) (-779.750) * (-781.859) (-781.881) (-782.641) [-780.329] -- 0:00:31
512000 -- (-780.706) [-779.873] (-779.488) (-784.945) * (-780.743) (-779.403) [-780.051] (-782.066) -- 0:00:31
512500 -- (-783.950) (-779.210) [-779.471] (-782.016) * (-778.850) [-781.638] (-781.030) (-778.858) -- 0:00:31
513000 -- (-778.904) [-778.833] (-782.628) (-778.642) * (-783.218) (-780.572) [-780.501] (-779.143) -- 0:00:31
513500 -- (-781.987) (-778.806) [-782.511] (-781.417) * (-779.821) (-779.343) (-779.855) [-779.798] -- 0:00:31
514000 -- (-782.235) [-778.702] (-783.083) (-783.240) * (-781.425) (-780.497) (-782.507) [-780.553] -- 0:00:31
514500 -- (-781.770) (-780.930) [-781.733] (-779.800) * (-781.794) (-778.701) [-781.489] (-780.666) -- 0:00:31
515000 -- (-781.064) (-778.999) (-781.928) [-779.681] * (-780.154) (-779.683) (-783.045) [-781.842] -- 0:00:31
Average standard deviation of split frequencies: 0.008736
515500 -- (-780.632) (-782.553) (-780.637) [-781.881] * (-779.622) (-781.803) [-781.019] (-780.967) -- 0:00:31
516000 -- (-780.447) (-785.061) [-783.760] (-779.747) * (-780.539) [-783.718] (-781.843) (-784.387) -- 0:00:30
516500 -- (-782.133) (-780.237) (-785.585) [-779.634] * [-780.362] (-781.131) (-782.074) (-781.048) -- 0:00:30
517000 -- (-778.990) (-780.618) (-779.999) [-779.523] * [-783.781] (-779.897) (-781.032) (-781.323) -- 0:00:30
517500 -- (-781.721) [-780.918] (-780.474) (-781.833) * (-780.769) (-781.210) (-783.799) [-779.677] -- 0:00:30
518000 -- [-783.906] (-779.274) (-779.027) (-780.317) * (-783.043) [-782.013] (-781.929) (-780.614) -- 0:00:30
518500 -- (-781.523) (-781.509) (-781.216) [-780.043] * (-779.365) (-779.048) (-779.612) [-781.643] -- 0:00:30
519000 -- (-781.962) [-779.343] (-784.730) (-781.948) * (-779.691) (-781.240) (-780.489) [-780.635] -- 0:00:30
519500 -- (-785.812) (-780.767) [-780.599] (-780.036) * (-779.193) (-780.090) [-781.351] (-779.637) -- 0:00:30
520000 -- (-783.009) [-780.369] (-782.129) (-785.223) * [-778.755] (-780.692) (-784.224) (-783.709) -- 0:00:30
Average standard deviation of split frequencies: 0.008255
520500 -- (-784.974) [-780.200] (-781.887) (-779.957) * (-780.145) [-783.904] (-782.332) (-784.722) -- 0:00:30
521000 -- [-781.135] (-779.718) (-779.701) (-782.820) * [-782.018] (-779.096) (-783.714) (-784.815) -- 0:00:30
521500 -- (-780.673) (-780.818) [-778.927] (-781.935) * (-782.451) (-781.120) (-781.644) [-782.688] -- 0:00:30
522000 -- (-779.133) [-779.474] (-782.741) (-780.531) * (-782.171) [-781.257] (-782.633) (-784.973) -- 0:00:30
522500 -- (-780.295) [-779.407] (-780.149) (-780.211) * [-781.745] (-781.857) (-782.940) (-780.295) -- 0:00:30
523000 -- (-779.788) (-780.087) [-779.828] (-781.994) * [-780.345] (-780.752) (-783.878) (-779.101) -- 0:00:30
523500 -- (-780.767) (-782.475) [-779.382] (-790.175) * (-781.085) (-785.432) (-783.509) [-778.968] -- 0:00:30
524000 -- (-782.608) [-781.282] (-779.560) (-785.356) * (-779.620) [-779.623] (-785.421) (-781.879) -- 0:00:29
524500 -- [-782.443] (-779.239) (-780.337) (-779.656) * [-778.919] (-779.928) (-783.972) (-779.326) -- 0:00:30
525000 -- (-779.668) (-780.644) (-783.081) [-780.846] * (-778.948) [-784.471] (-779.884) (-780.714) -- 0:00:30
Average standard deviation of split frequencies: 0.008488
525500 -- (-780.809) (-783.343) (-780.476) [-779.452] * (-779.519) (-782.989) [-779.339] (-781.038) -- 0:00:30
526000 -- (-785.968) [-779.641] (-781.904) (-779.797) * [-780.235] (-780.163) (-780.225) (-780.913) -- 0:00:30
526500 -- (-780.110) (-779.922) (-779.365) [-783.187] * (-783.497) (-781.207) (-783.909) [-779.953] -- 0:00:30
527000 -- (-782.752) [-783.623] (-780.375) (-783.214) * (-782.768) [-779.687] (-782.129) (-779.973) -- 0:00:30
527500 -- (-783.268) (-780.289) (-780.035) [-778.979] * [-782.324] (-781.593) (-779.770) (-780.807) -- 0:00:30
528000 -- (-781.483) (-780.705) (-781.110) [-779.069] * (-781.919) [-779.748] (-780.812) (-781.114) -- 0:00:30
528500 -- (-781.722) [-779.383] (-784.677) (-781.112) * (-783.111) (-779.812) [-782.372] (-779.419) -- 0:00:30
529000 -- [-778.951] (-781.522) (-778.821) (-781.910) * (-780.595) (-779.985) [-781.687] (-781.283) -- 0:00:30
529500 -- (-781.516) [-789.971] (-780.244) (-780.536) * (-781.455) (-781.765) (-781.592) [-780.694] -- 0:00:30
530000 -- [-780.882] (-779.885) (-785.012) (-781.946) * (-779.511) [-779.583] (-779.534) (-781.086) -- 0:00:30
Average standard deviation of split frequencies: 0.008831
530500 -- (-778.942) (-783.124) (-780.825) [-779.722] * (-781.289) (-780.111) [-779.019] (-781.011) -- 0:00:30
531000 -- [-779.423] (-784.460) (-782.008) (-781.552) * (-780.710) [-781.342] (-780.469) (-782.119) -- 0:00:30
531500 -- (-781.932) (-781.591) [-783.045] (-780.573) * (-779.668) (-784.105) [-780.746] (-780.388) -- 0:00:29
532000 -- (-781.885) [-780.551] (-781.542) (-780.762) * (-780.997) [-783.200] (-783.783) (-780.638) -- 0:00:29
532500 -- [-783.164] (-781.529) (-781.669) (-779.262) * (-782.432) (-789.546) (-780.038) [-781.301] -- 0:00:29
533000 -- (-780.262) [-782.937] (-783.114) (-780.618) * [-782.068] (-788.338) (-782.885) (-786.606) -- 0:00:29
533500 -- (-782.067) (-779.686) [-780.901] (-779.295) * (-780.192) (-784.682) [-780.965] (-782.148) -- 0:00:29
534000 -- [-780.912] (-782.769) (-780.160) (-780.759) * (-782.415) [-783.279] (-778.809) (-779.127) -- 0:00:29
534500 -- (-780.656) [-780.576] (-781.331) (-782.713) * (-781.024) (-783.400) [-778.770] (-783.769) -- 0:00:29
535000 -- (-789.175) (-783.048) (-784.116) [-782.681] * [-780.065] (-782.087) (-783.344) (-779.418) -- 0:00:29
Average standard deviation of split frequencies: 0.008174
535500 -- (-780.312) [-781.806] (-784.183) (-781.442) * [-779.029] (-780.564) (-784.496) (-780.738) -- 0:00:29
536000 -- [-779.019] (-783.888) (-780.310) (-779.191) * [-780.567] (-782.422) (-783.999) (-779.531) -- 0:00:29
536500 -- [-783.590] (-780.662) (-779.148) (-779.884) * (-779.244) (-784.975) (-784.722) [-779.630] -- 0:00:29
537000 -- (-784.232) (-781.926) [-779.063] (-782.232) * (-780.309) [-780.124] (-786.527) (-779.642) -- 0:00:29
537500 -- (-785.183) [-780.328] (-782.108) (-782.164) * [-779.346] (-781.874) (-781.992) (-780.540) -- 0:00:29
538000 -- (-786.830) [-781.574] (-780.475) (-782.793) * (-779.485) (-781.540) [-780.727] (-781.391) -- 0:00:29
538500 -- (-785.189) (-780.555) (-781.315) [-781.787] * (-788.437) (-782.047) [-780.923] (-781.319) -- 0:00:29
539000 -- (-780.805) (-780.008) (-780.693) [-779.044] * (-783.333) (-780.808) [-779.737] (-782.159) -- 0:00:29
539500 -- (-784.719) (-779.764) (-783.781) [-780.421] * (-788.698) (-780.705) [-779.447] (-784.519) -- 0:00:29
540000 -- (-780.079) [-786.132] (-781.363) (-780.285) * (-782.534) (-780.152) [-782.194] (-782.689) -- 0:00:28
Average standard deviation of split frequencies: 0.008392
540500 -- (-779.602) [-780.186] (-784.714) (-780.887) * (-780.825) (-782.165) (-782.102) [-781.122] -- 0:00:29
541000 -- (-780.530) [-779.844] (-780.013) (-781.214) * (-781.882) (-778.944) (-780.708) [-779.669] -- 0:00:29
541500 -- (-781.319) (-781.508) [-779.784] (-783.117) * (-784.544) (-781.086) (-779.506) [-783.030] -- 0:00:29
542000 -- (-781.181) [-779.922] (-780.951) (-780.102) * (-780.573) (-780.963) [-779.774] (-782.952) -- 0:00:29
542500 -- (-780.954) (-781.496) (-781.719) [-780.382] * [-779.752] (-781.748) (-785.319) (-781.375) -- 0:00:29
543000 -- (-780.451) [-780.286] (-778.965) (-779.060) * (-784.327) (-781.086) (-784.135) [-782.059] -- 0:00:29
543500 -- (-784.258) [-780.438] (-782.159) (-780.947) * (-779.755) [-781.329] (-782.140) (-787.897) -- 0:00:29
544000 -- (-780.555) [-778.660] (-783.018) (-779.707) * (-779.884) [-783.950] (-795.976) (-780.984) -- 0:00:29
544500 -- [-779.531] (-779.992) (-782.401) (-780.001) * [-780.606] (-785.628) (-784.506) (-779.731) -- 0:00:29
545000 -- (-781.922) (-781.435) (-780.021) [-781.317] * (-780.974) (-780.924) [-779.249] (-780.013) -- 0:00:29
Average standard deviation of split frequencies: 0.008786
545500 -- (-779.821) (-782.688) (-781.143) [-779.632] * (-782.997) (-781.124) (-782.182) [-779.455] -- 0:00:29
546000 -- (-780.940) (-782.372) [-780.611] (-783.416) * [-787.832] (-781.674) (-781.500) (-781.261) -- 0:00:29
546500 -- (-778.892) (-781.318) [-780.369] (-780.149) * (-782.272) [-782.748] (-783.622) (-779.750) -- 0:00:29
547000 -- [-779.111] (-782.816) (-781.892) (-784.513) * (-780.616) (-780.721) (-780.634) [-779.358] -- 0:00:28
547500 -- [-780.028] (-781.958) (-781.408) (-780.551) * (-783.069) [-786.812] (-780.527) (-782.305) -- 0:00:28
548000 -- (-786.196) [-780.940] (-783.962) (-781.023) * (-781.260) [-784.171] (-779.040) (-780.817) -- 0:00:28
548500 -- (-783.085) (-780.881) (-786.480) [-781.057] * (-783.604) [-780.678] (-783.439) (-779.288) -- 0:00:28
549000 -- (-780.403) (-780.297) [-782.309] (-780.978) * (-784.361) (-782.261) (-782.309) [-779.200] -- 0:00:28
549500 -- [-781.032] (-779.687) (-781.784) (-779.939) * (-787.454) (-781.145) (-781.595) [-779.403] -- 0:00:28
550000 -- [-780.330] (-778.747) (-780.299) (-780.390) * [-779.003] (-781.564) (-780.554) (-782.886) -- 0:00:28
Average standard deviation of split frequencies: 0.008561
550500 -- [-779.517] (-782.311) (-782.706) (-781.991) * (-782.428) (-783.891) (-779.064) [-781.010] -- 0:00:28
551000 -- (-782.498) [-780.723] (-783.803) (-781.906) * [-782.491] (-784.047) (-780.454) (-784.205) -- 0:00:28
551500 -- (-781.455) (-783.216) (-782.338) [-781.038] * (-779.334) (-785.399) (-782.189) [-779.588] -- 0:00:28
552000 -- [-781.834] (-779.653) (-780.859) (-780.668) * (-779.340) (-780.454) (-785.212) [-779.136] -- 0:00:28
552500 -- (-782.670) [-782.337] (-781.318) (-782.056) * (-781.147) (-785.894) [-784.645] (-779.226) -- 0:00:28
553000 -- (-783.332) (-781.185) [-781.780] (-779.094) * (-782.951) (-782.061) [-782.758] (-781.825) -- 0:00:28
553500 -- (-780.009) [-780.686] (-780.669) (-779.106) * [-781.858] (-782.920) (-779.707) (-780.140) -- 0:00:28
554000 -- (-779.174) [-780.122] (-782.125) (-781.142) * [-779.822] (-780.213) (-782.946) (-780.556) -- 0:00:28
554500 -- [-779.185] (-781.032) (-781.883) (-783.584) * (-780.299) (-782.733) [-779.984] (-781.563) -- 0:00:28
555000 -- (-779.379) (-780.443) (-780.796) [-780.033] * [-782.438] (-780.678) (-781.002) (-781.746) -- 0:00:28
Average standard deviation of split frequencies: 0.008678
555500 -- (-779.401) (-782.568) [-779.862] (-780.501) * [-781.715] (-780.028) (-780.320) (-781.408) -- 0:00:28
556000 -- (-780.651) (-781.743) [-779.924] (-779.768) * (-786.585) [-781.998] (-781.249) (-780.443) -- 0:00:27
556500 -- [-778.717] (-781.973) (-780.224) (-782.998) * [-784.272] (-784.924) (-782.493) (-783.074) -- 0:00:27
557000 -- (-782.685) (-781.067) [-779.899] (-786.161) * (-778.813) (-780.231) [-781.434] (-780.840) -- 0:00:28
557500 -- (-779.362) (-783.423) [-783.374] (-782.329) * [-783.401] (-784.740) (-784.936) (-779.908) -- 0:00:28
558000 -- [-780.086] (-782.825) (-781.793) (-789.334) * (-781.817) (-782.296) [-779.904] (-783.937) -- 0:00:28
558500 -- (-781.561) (-785.144) (-780.406) [-781.975] * (-785.752) [-781.197] (-779.161) (-782.711) -- 0:00:28
559000 -- [-781.499] (-782.857) (-780.651) (-780.069) * [-781.393] (-779.901) (-778.907) (-784.082) -- 0:00:28
559500 -- (-781.314) (-788.230) (-778.902) [-782.421] * (-778.918) [-781.342] (-779.609) (-782.002) -- 0:00:28
560000 -- (-780.405) (-782.536) [-782.331] (-781.579) * (-779.818) (-781.053) (-780.544) [-781.734] -- 0:00:28
Average standard deviation of split frequencies: 0.009100
560500 -- (-780.959) (-782.828) (-779.999) [-780.526] * (-779.858) [-781.411] (-782.251) (-781.057) -- 0:00:28
561000 -- (-780.100) [-781.848] (-781.712) (-783.315) * [-782.137] (-781.725) (-780.300) (-782.629) -- 0:00:28
561500 -- (-779.489) [-785.325] (-778.455) (-779.420) * [-782.080] (-783.269) (-780.400) (-782.833) -- 0:00:28
562000 -- (-780.352) [-786.038] (-779.571) (-783.509) * [-780.179] (-781.745) (-780.357) (-784.600) -- 0:00:28
562500 -- (-783.344) [-780.178] (-783.301) (-781.524) * (-781.731) [-782.825] (-779.461) (-782.838) -- 0:00:28
563000 -- [-779.933] (-780.991) (-781.776) (-782.884) * (-780.830) (-780.450) [-778.813] (-781.828) -- 0:00:27
563500 -- (-779.281) [-779.366] (-783.526) (-779.948) * (-783.258) (-784.395) (-780.677) [-781.754] -- 0:00:27
564000 -- (-780.377) (-780.100) [-779.569] (-780.319) * (-781.784) (-781.325) [-780.282] (-780.064) -- 0:00:27
564500 -- (-780.950) (-779.025) (-782.212) [-780.345] * (-781.366) (-779.671) [-780.069] (-781.748) -- 0:00:27
565000 -- (-779.820) [-780.289] (-779.822) (-780.861) * (-784.007) (-782.235) [-780.307] (-779.073) -- 0:00:27
Average standard deviation of split frequencies: 0.008427
565500 -- (-781.232) (-780.558) (-779.933) [-783.877] * [-783.067] (-781.046) (-779.799) (-782.470) -- 0:00:27
566000 -- [-783.515] (-780.348) (-781.706) (-780.826) * (-782.680) [-780.404] (-783.577) (-782.567) -- 0:00:27
566500 -- (-786.186) [-778.857] (-780.088) (-782.836) * (-781.570) [-780.420] (-779.282) (-784.181) -- 0:00:27
567000 -- [-780.089] (-778.780) (-782.623) (-781.584) * (-779.390) (-779.331) [-778.976] (-780.021) -- 0:00:27
567500 -- (-780.145) (-780.441) (-779.627) [-783.991] * (-782.893) [-782.103] (-783.858) (-784.056) -- 0:00:27
568000 -- (-781.177) (-780.445) (-782.764) [-782.756] * [-781.658] (-779.947) (-781.132) (-780.140) -- 0:00:27
568500 -- (-780.022) (-779.734) (-782.343) [-784.416] * (-781.149) (-778.949) [-779.392] (-780.736) -- 0:00:27
569000 -- (-781.853) (-781.240) (-781.450) [-781.323] * (-780.489) [-779.975] (-782.024) (-779.589) -- 0:00:27
569500 -- [-781.383] (-782.339) (-779.660) (-784.555) * (-781.635) (-779.611) [-778.774] (-780.747) -- 0:00:27
570000 -- (-785.198) [-781.302] (-780.400) (-780.603) * (-782.069) [-781.032] (-780.281) (-781.229) -- 0:00:27
Average standard deviation of split frequencies: 0.008406
570500 -- (-782.618) (-780.832) [-781.679] (-780.105) * (-783.878) (-781.107) [-779.439] (-779.874) -- 0:00:27
571000 -- (-781.788) (-780.972) [-783.777] (-781.274) * (-786.549) (-780.078) (-779.374) [-780.804] -- 0:00:27
571500 -- [-779.861] (-782.214) (-779.901) (-780.444) * [-785.046] (-783.783) (-781.493) (-782.193) -- 0:00:26
572000 -- (-780.380) (-780.277) (-781.397) [-779.988] * [-781.614] (-780.596) (-782.388) (-782.552) -- 0:00:26
572500 -- [-780.983] (-780.446) (-781.674) (-780.855) * (-784.117) (-783.359) (-783.704) [-781.555] -- 0:00:26
573000 -- (-783.769) [-780.335] (-780.063) (-781.492) * (-783.729) [-781.026] (-783.851) (-781.329) -- 0:00:26
573500 -- [-781.368] (-784.862) (-779.935) (-780.326) * [-780.012] (-780.451) (-782.962) (-782.213) -- 0:00:27
574000 -- (-784.948) [-782.734] (-783.796) (-781.296) * (-780.596) [-780.983] (-779.297) (-783.862) -- 0:00:27
574500 -- (-787.296) (-783.163) [-781.678] (-782.121) * [-782.393] (-780.639) (-780.522) (-780.344) -- 0:00:27
575000 -- (-780.604) (-780.142) [-780.751] (-779.665) * [-778.950] (-780.468) (-785.487) (-780.673) -- 0:00:27
Average standard deviation of split frequencies: 0.008184
575500 -- (-780.705) (-783.297) [-781.013] (-780.285) * [-778.918] (-781.608) (-780.195) (-780.276) -- 0:00:27
576000 -- [-779.067] (-789.811) (-781.071) (-781.938) * (-778.765) (-783.485) (-779.534) [-782.268] -- 0:00:27
576500 -- (-780.586) (-787.352) (-779.774) [-780.206] * (-779.200) (-786.480) (-780.952) [-779.925] -- 0:00:27
577000 -- (-781.548) [-781.567] (-782.351) (-782.299) * [-780.124] (-782.875) (-783.163) (-780.228) -- 0:00:27
577500 -- (-780.811) [-782.648] (-780.661) (-780.187) * [-779.160] (-779.369) (-787.274) (-780.578) -- 0:00:27
578000 -- (-780.185) (-782.107) (-782.776) [-783.449] * [-780.244] (-779.604) (-784.886) (-778.839) -- 0:00:27
578500 -- (-781.771) (-782.962) [-778.991] (-783.587) * (-782.640) (-781.445) (-782.750) [-782.254] -- 0:00:26
579000 -- [-784.726] (-779.713) (-780.907) (-779.677) * (-782.004) (-779.762) [-778.516] (-780.795) -- 0:00:26
579500 -- (-779.753) (-779.797) (-781.290) [-779.301] * [-782.822] (-779.225) (-781.121) (-781.506) -- 0:00:26
580000 -- (-780.727) (-781.059) (-780.761) [-779.122] * (-779.178) (-780.400) (-780.992) [-780.602] -- 0:00:26
Average standard deviation of split frequencies: 0.007975
580500 -- (-781.254) (-779.994) [-779.307] (-780.912) * [-781.080] (-782.198) (-779.471) (-780.091) -- 0:00:26
581000 -- [-782.459] (-780.035) (-781.088) (-779.358) * (-785.691) [-781.961] (-781.687) (-781.326) -- 0:00:26
581500 -- (-784.212) (-779.962) (-780.183) [-781.275] * (-785.448) [-781.046] (-781.276) (-780.901) -- 0:00:26
582000 -- (-784.298) (-781.963) [-780.791] (-781.220) * (-780.481) [-779.213] (-781.148) (-779.059) -- 0:00:26
582500 -- (-780.495) [-780.703] (-780.798) (-780.041) * (-780.421) (-779.017) (-788.288) [-780.165] -- 0:00:26
583000 -- [-780.086] (-779.609) (-780.277) (-783.479) * [-778.624] (-778.929) (-785.793) (-781.094) -- 0:00:26
583500 -- [-779.980] (-781.121) (-779.020) (-780.761) * [-779.620] (-780.338) (-779.786) (-780.386) -- 0:00:26
584000 -- (-779.952) (-780.665) (-780.807) [-779.783] * (-778.705) [-782.436] (-782.958) (-779.595) -- 0:00:26
584500 -- [-780.702] (-780.740) (-786.801) (-782.121) * (-779.650) [-779.656] (-781.731) (-781.562) -- 0:00:26
585000 -- (-780.178) (-781.160) [-779.802] (-783.350) * [-781.047] (-779.960) (-785.592) (-780.645) -- 0:00:26
Average standard deviation of split frequencies: 0.008281
585500 -- [-780.869] (-786.338) (-779.092) (-782.182) * (-781.567) (-779.449) [-780.741] (-780.056) -- 0:00:26
586000 -- (-779.384) (-780.372) [-779.935] (-779.883) * (-781.958) [-779.694] (-780.376) (-779.499) -- 0:00:26
586500 -- [-779.174] (-782.227) (-778.749) (-780.687) * (-779.747) [-779.623] (-781.700) (-780.252) -- 0:00:26
587000 -- [-778.836] (-781.601) (-779.923) (-780.054) * (-781.220) (-783.298) (-779.574) [-779.553] -- 0:00:26
587500 -- (-779.949) (-780.171) [-781.164] (-779.356) * (-780.733) [-780.093] (-785.626) (-780.224) -- 0:00:25
588000 -- (-781.486) [-779.506] (-784.205) (-781.420) * (-780.362) (-779.610) [-780.469] (-784.209) -- 0:00:25
588500 -- (-779.455) (-782.515) (-785.185) [-778.876] * (-780.399) [-779.618] (-782.678) (-784.756) -- 0:00:25
589000 -- (-781.155) (-781.613) [-780.659] (-782.954) * (-779.850) [-779.114] (-783.359) (-782.829) -- 0:00:25
589500 -- [-779.204] (-782.142) (-780.273) (-780.481) * [-778.869] (-779.899) (-782.277) (-785.553) -- 0:00:26
590000 -- (-784.974) [-780.442] (-781.981) (-780.098) * (-779.968) (-784.128) [-780.330] (-782.842) -- 0:00:26
Average standard deviation of split frequencies: 0.008873
590500 -- (-780.636) [-781.722] (-781.827) (-779.197) * (-783.251) [-781.418] (-783.718) (-782.069) -- 0:00:26
591000 -- (-780.403) [-779.549] (-785.471) (-778.594) * (-780.779) (-779.729) [-786.271] (-781.950) -- 0:00:26
591500 -- (-784.049) (-781.921) [-786.406] (-778.550) * (-780.222) [-779.235] (-784.659) (-783.208) -- 0:00:26
592000 -- (-779.565) (-780.047) [-779.890] (-781.153) * (-779.124) (-781.061) (-781.176) [-783.495] -- 0:00:26
592500 -- [-779.715] (-779.936) (-780.887) (-780.739) * (-784.562) [-780.278] (-780.755) (-782.496) -- 0:00:26
593000 -- (-780.245) (-782.589) (-782.516) [-780.067] * (-780.445) [-780.106] (-782.038) (-782.990) -- 0:00:26
593500 -- [-779.364] (-782.852) (-781.391) (-781.021) * (-779.903) (-780.866) (-779.757) [-783.588] -- 0:00:26
594000 -- [-779.692] (-780.267) (-780.232) (-783.908) * (-783.664) [-782.952] (-784.963) (-781.621) -- 0:00:25
594500 -- [-779.698] (-780.449) (-779.931) (-780.907) * [-783.080] (-779.880) (-784.356) (-780.246) -- 0:00:25
595000 -- (-780.071) (-780.210) (-779.760) [-781.584] * (-783.356) [-780.028] (-781.541) (-780.059) -- 0:00:25
Average standard deviation of split frequencies: 0.008453
595500 -- [-780.069] (-784.303) (-781.961) (-779.541) * (-786.435) [-781.075] (-781.443) (-783.109) -- 0:00:25
596000 -- (-779.852) (-781.129) (-780.636) [-779.252] * (-786.674) (-782.548) (-782.704) [-783.375] -- 0:00:25
596500 -- (-780.800) [-780.873] (-780.464) (-782.031) * (-784.470) [-781.100] (-779.688) (-782.909) -- 0:00:25
597000 -- (-783.567) (-784.128) (-781.558) [-778.934] * (-784.610) (-780.584) (-781.413) [-779.726] -- 0:00:25
597500 -- (-780.298) (-780.734) [-782.017] (-781.284) * (-780.976) (-779.375) [-779.780] (-779.735) -- 0:00:25
598000 -- [-778.956] (-780.402) (-780.554) (-787.742) * (-780.582) [-779.773] (-781.145) (-780.497) -- 0:00:25
598500 -- [-779.451] (-779.928) (-781.878) (-782.237) * [-779.952] (-783.741) (-784.797) (-782.514) -- 0:00:25
599000 -- (-781.448) (-784.454) (-787.292) [-780.955] * (-781.672) (-780.928) (-778.948) [-781.847] -- 0:00:25
599500 -- (-783.820) (-779.247) [-780.857] (-780.404) * (-782.774) (-782.935) [-781.148] (-779.086) -- 0:00:25
600000 -- (-782.982) [-778.958] (-782.612) (-779.620) * [-783.813] (-781.147) (-780.517) (-781.053) -- 0:00:25
Average standard deviation of split frequencies: 0.007799
600500 -- (-783.800) [-781.930] (-782.956) (-779.456) * [-780.065] (-780.425) (-784.886) (-782.971) -- 0:00:25
601000 -- [-781.032] (-782.869) (-781.341) (-782.217) * (-784.558) [-782.633] (-781.685) (-783.844) -- 0:00:25
601500 -- (-783.558) (-784.141) [-781.372] (-781.558) * (-782.027) (-779.370) (-780.115) [-779.703] -- 0:00:25
602000 -- [-781.850] (-779.791) (-778.664) (-779.965) * (-779.824) (-779.982) [-778.857] (-779.580) -- 0:00:25
602500 -- [-782.251] (-782.427) (-781.780) (-780.116) * [-781.523] (-781.272) (-779.777) (-780.409) -- 0:00:25
603000 -- (-780.814) [-785.037] (-782.346) (-779.562) * (-780.903) (-783.116) (-780.014) [-780.117] -- 0:00:25
603500 -- (-781.310) (-780.559) (-780.767) [-779.390] * (-786.693) (-781.246) [-780.999] (-780.429) -- 0:00:24
604000 -- (-782.377) [-778.950] (-783.519) (-782.811) * (-782.684) (-780.680) [-782.695] (-782.972) -- 0:00:24
604500 -- (-786.532) [-778.709] (-779.731) (-781.349) * (-778.896) [-779.749] (-782.065) (-779.943) -- 0:00:24
605000 -- (-784.698) [-779.432] (-781.532) (-779.078) * (-779.947) [-779.250] (-781.429) (-781.246) -- 0:00:24
Average standard deviation of split frequencies: 0.007536
605500 -- (-780.416) [-780.210] (-782.601) (-781.183) * (-783.249) (-780.464) (-786.394) [-780.997] -- 0:00:25
606000 -- (-781.156) (-779.981) (-782.904) [-783.861] * (-782.396) [-781.587] (-784.692) (-781.766) -- 0:00:25
606500 -- [-780.485] (-779.879) (-779.440) (-784.105) * (-783.955) [-780.360] (-780.352) (-779.610) -- 0:00:25
607000 -- (-779.073) (-780.303) [-779.569] (-782.705) * (-780.526) (-780.243) [-780.763] (-783.912) -- 0:00:25
607500 -- [-779.675] (-780.948) (-781.362) (-786.481) * (-779.458) (-784.316) (-781.387) [-780.655] -- 0:00:25
608000 -- (-779.234) (-782.718) (-781.626) [-781.632] * (-779.266) [-778.859] (-780.056) (-779.154) -- 0:00:25
608500 -- [-781.904] (-781.056) (-781.620) (-781.209) * (-780.473) (-781.953) [-779.976] (-780.201) -- 0:00:25
609000 -- [-779.246] (-785.557) (-779.718) (-778.682) * [-780.048] (-784.233) (-780.099) (-781.698) -- 0:00:25
609500 -- (-780.516) (-785.774) [-780.104] (-778.637) * (-782.959) (-780.116) (-779.738) [-779.690] -- 0:00:24
610000 -- (-781.025) (-788.619) [-779.865] (-780.893) * [-780.056] (-780.297) (-779.622) (-780.353) -- 0:00:24
Average standard deviation of split frequencies: 0.007816
610500 -- [-780.833] (-782.217) (-780.918) (-779.765) * (-779.036) (-780.912) [-784.002] (-781.711) -- 0:00:24
611000 -- [-779.738] (-783.055) (-781.548) (-782.776) * (-781.022) (-781.480) [-786.478] (-778.919) -- 0:00:24
611500 -- (-780.003) (-785.196) [-782.416] (-780.014) * (-783.574) [-780.087] (-782.813) (-781.858) -- 0:00:24
612000 -- [-779.270] (-781.316) (-784.863) (-780.344) * (-778.855) (-780.019) (-779.417) [-782.947] -- 0:00:24
612500 -- (-779.511) [-780.412] (-785.643) (-779.631) * (-780.909) (-780.950) [-778.871] (-781.478) -- 0:00:24
613000 -- [-780.658] (-781.674) (-780.478) (-780.711) * [-780.674] (-781.693) (-779.453) (-780.890) -- 0:00:24
613500 -- (-783.300) (-780.308) (-781.948) [-783.393] * [-781.928] (-781.392) (-780.201) (-783.076) -- 0:00:24
614000 -- (-781.058) (-781.026) [-782.633] (-780.152) * [-783.125] (-783.060) (-779.767) (-782.256) -- 0:00:24
614500 -- [-780.050] (-780.386) (-780.775) (-781.519) * (-783.070) [-781.354] (-780.009) (-781.227) -- 0:00:24
615000 -- [-778.959] (-782.346) (-780.073) (-780.794) * (-780.709) [-780.306] (-782.765) (-781.281) -- 0:00:24
Average standard deviation of split frequencies: 0.007142
615500 -- (-780.954) [-785.677] (-779.516) (-779.340) * (-778.900) [-779.297] (-783.074) (-782.579) -- 0:00:24
616000 -- [-780.677] (-782.511) (-779.595) (-781.317) * (-782.526) [-781.359] (-781.564) (-785.193) -- 0:00:24
616500 -- (-779.569) (-780.778) (-783.304) [-781.478] * (-781.831) [-781.783] (-781.936) (-782.847) -- 0:00:24
617000 -- (-784.026) (-784.155) (-780.994) [-780.600] * (-783.490) (-782.106) [-781.527] (-780.299) -- 0:00:24
617500 -- [-780.074] (-783.033) (-781.762) (-780.571) * [-781.074] (-781.213) (-782.487) (-780.794) -- 0:00:24
618000 -- [-781.795] (-783.873) (-779.114) (-779.724) * (-782.870) (-782.956) [-779.941] (-781.496) -- 0:00:24
618500 -- (-779.763) (-786.209) [-778.731] (-782.156) * (-780.905) [-779.825] (-781.240) (-781.469) -- 0:00:24
619000 -- (-780.159) (-784.526) (-781.332) [-778.963] * [-781.303] (-781.921) (-782.802) (-782.873) -- 0:00:24
619500 -- (-779.756) (-791.060) [-780.275] (-778.919) * (-780.936) (-780.661) (-781.514) [-782.145] -- 0:00:23
620000 -- (-780.327) (-791.947) (-781.281) [-784.697] * (-778.828) (-779.975) (-786.067) [-779.274] -- 0:00:23
Average standard deviation of split frequencies: 0.007190
620500 -- (-779.920) (-785.511) [-781.739] (-784.607) * (-782.908) (-781.858) (-781.620) [-780.028] -- 0:00:23
621000 -- (-783.014) [-780.745] (-780.921) (-781.106) * [-781.958] (-780.926) (-778.862) (-779.582) -- 0:00:23
621500 -- (-784.860) [-780.954] (-779.904) (-781.265) * (-783.039) (-783.134) [-780.554] (-785.282) -- 0:00:24
622000 -- [-780.372] (-784.283) (-779.573) (-779.807) * (-782.853) [-781.724] (-781.299) (-780.441) -- 0:00:24
622500 -- (-780.683) (-781.517) (-780.135) [-780.493] * (-783.562) [-780.796] (-779.480) (-779.629) -- 0:00:24
623000 -- (-782.534) (-781.271) (-782.352) [-781.123] * [-780.698] (-779.567) (-780.941) (-782.642) -- 0:00:24
623500 -- (-779.970) (-780.690) (-784.541) [-779.869] * (-780.010) [-782.211] (-782.364) (-782.366) -- 0:00:24
624000 -- (-785.898) (-781.107) (-784.610) [-780.491] * (-780.197) [-779.499] (-780.602) (-783.552) -- 0:00:24
624500 -- (-782.995) (-780.840) (-784.697) [-782.801] * (-781.794) (-780.945) [-781.575] (-782.979) -- 0:00:24
625000 -- (-784.608) [-780.889] (-784.446) (-782.595) * (-781.846) [-781.114] (-780.336) (-784.003) -- 0:00:24
Average standard deviation of split frequencies: 0.007179
625500 -- (-784.165) [-780.931] (-779.270) (-780.044) * (-779.567) (-780.040) [-781.960] (-782.000) -- 0:00:23
626000 -- [-786.022] (-779.773) (-780.230) (-779.335) * [-778.883] (-782.073) (-784.646) (-779.772) -- 0:00:23
626500 -- (-784.296) (-780.256) [-780.000] (-780.291) * (-781.011) (-779.814) (-786.072) [-779.793] -- 0:00:23
627000 -- (-781.168) (-783.839) (-781.700) [-778.990] * (-782.725) [-780.287] (-784.222) (-780.374) -- 0:00:23
627500 -- (-780.558) (-779.496) [-785.892] (-778.990) * (-780.013) [-779.096] (-780.225) (-782.491) -- 0:00:23
628000 -- (-778.906) [-781.679] (-780.349) (-782.034) * [-779.616] (-779.361) (-781.023) (-784.693) -- 0:00:23
628500 -- (-779.570) (-783.737) (-781.393) [-783.408] * (-782.374) (-780.729) (-780.989) [-779.848] -- 0:00:23
629000 -- (-780.174) (-781.383) [-781.545] (-780.066) * (-780.551) [-779.784] (-780.946) (-785.886) -- 0:00:23
629500 -- (-780.603) (-781.462) (-779.496) [-778.811] * (-783.398) (-785.569) [-779.317] (-782.401) -- 0:00:23
630000 -- (-782.157) (-780.921) [-782.544] (-783.968) * (-780.795) (-782.383) (-779.476) [-783.136] -- 0:00:23
Average standard deviation of split frequencies: 0.006927
630500 -- [-780.406] (-783.553) (-780.384) (-782.320) * [-778.679] (-782.508) (-784.991) (-782.078) -- 0:00:23
631000 -- (-783.360) (-781.383) [-780.464] (-782.856) * (-782.231) (-779.686) (-782.343) [-781.245] -- 0:00:23
631500 -- [-781.427] (-780.046) (-780.739) (-782.682) * [-781.357] (-780.363) (-780.040) (-781.179) -- 0:00:23
632000 -- (-779.242) (-780.159) (-781.238) [-781.630] * (-785.341) [-784.095] (-781.216) (-783.183) -- 0:00:23
632500 -- [-779.507] (-782.168) (-781.216) (-779.973) * (-781.181) [-781.354] (-782.036) (-781.442) -- 0:00:23
633000 -- (-779.922) [-780.686] (-785.254) (-781.727) * (-785.782) (-781.385) (-784.900) [-781.686] -- 0:00:23
633500 -- [-779.464] (-781.437) (-781.178) (-787.064) * [-780.410] (-783.080) (-783.636) (-781.854) -- 0:00:23
634000 -- (-781.157) (-781.451) [-782.120] (-779.533) * (-780.832) (-778.988) [-779.761] (-778.951) -- 0:00:23
634500 -- (-782.778) [-779.614] (-782.375) (-780.238) * [-783.300] (-780.678) (-779.949) (-781.858) -- 0:00:23
635000 -- (-779.191) [-781.765] (-780.365) (-783.131) * (-781.924) [-778.994] (-779.689) (-780.311) -- 0:00:22
Average standard deviation of split frequencies: 0.006770
635500 -- (-779.365) [-781.385] (-781.000) (-783.628) * (-781.530) [-783.704] (-783.747) (-779.786) -- 0:00:22
636000 -- (-781.242) [-782.035] (-780.590) (-782.627) * [-782.743] (-787.920) (-783.031) (-779.805) -- 0:00:22
636500 -- (-779.397) (-784.417) (-781.323) [-780.349] * (-781.766) (-782.640) (-786.800) [-780.212] -- 0:00:22
637000 -- (-779.204) (-779.901) [-781.864] (-784.685) * [-783.796] (-785.943) (-783.209) (-780.250) -- 0:00:22
637500 -- [-779.184] (-781.838) (-779.715) (-779.813) * (-788.585) (-789.666) (-783.153) [-779.696] -- 0:00:22
638000 -- (-779.518) (-782.772) (-782.829) [-778.988] * (-781.013) (-786.440) (-787.208) [-780.664] -- 0:00:23
638500 -- (-778.936) (-781.472) [-780.918] (-784.162) * (-780.997) (-787.989) (-781.295) [-779.356] -- 0:00:23
639000 -- [-780.246] (-780.818) (-783.983) (-779.555) * [-780.600] (-785.529) (-779.793) (-780.998) -- 0:00:23
639500 -- [-778.609] (-780.703) (-782.443) (-779.230) * (-781.033) (-780.806) (-779.996) [-778.935] -- 0:00:23
640000 -- [-780.059] (-778.668) (-783.863) (-784.061) * (-780.044) [-781.740] (-783.955) (-781.944) -- 0:00:23
Average standard deviation of split frequencies: 0.007496
640500 -- [-779.857] (-779.544) (-784.657) (-782.445) * (-780.930) (-779.102) [-779.589] (-782.028) -- 0:00:23
641000 -- [-780.054] (-779.866) (-784.062) (-780.854) * (-782.139) (-779.717) [-780.346] (-782.925) -- 0:00:22
641500 -- (-780.313) (-779.957) [-782.189] (-783.181) * [-779.628] (-780.633) (-778.780) (-780.653) -- 0:00:22
642000 -- (-782.073) (-779.236) [-781.027] (-779.483) * (-782.837) (-780.668) (-780.559) [-780.703] -- 0:00:22
642500 -- (-781.432) [-778.939] (-780.603) (-783.339) * (-779.090) (-779.585) [-781.212] (-779.716) -- 0:00:22
643000 -- (-781.801) (-779.593) (-779.898) [-781.333] * (-779.295) (-780.435) (-780.772) [-781.453] -- 0:00:22
643500 -- (-787.052) [-778.606] (-781.958) (-786.499) * [-780.930] (-784.291) (-779.395) (-783.290) -- 0:00:22
644000 -- (-784.023) (-780.915) (-784.771) [-778.646] * (-781.984) (-780.778) [-779.635] (-783.693) -- 0:00:22
644500 -- (-780.045) (-780.355) [-779.425] (-781.101) * (-782.633) [-781.585] (-779.374) (-782.054) -- 0:00:22
645000 -- (-783.170) (-779.605) (-779.556) [-785.116] * [-779.584] (-781.175) (-780.922) (-782.233) -- 0:00:22
Average standard deviation of split frequencies: 0.007160
645500 -- (-782.031) [-781.822] (-780.241) (-787.817) * (-781.654) [-782.488] (-783.084) (-781.772) -- 0:00:22
646000 -- (-780.824) [-780.668] (-780.061) (-784.452) * (-779.584) [-781.431] (-778.831) (-780.989) -- 0:00:22
646500 -- (-784.095) (-783.389) [-779.520] (-782.884) * [-779.515] (-780.390) (-780.951) (-780.733) -- 0:00:22
647000 -- (-782.579) (-780.630) [-779.697] (-787.589) * (-779.066) [-781.214] (-781.223) (-779.833) -- 0:00:22
647500 -- (-781.445) (-780.053) [-778.890] (-782.708) * (-782.881) [-780.953] (-782.631) (-780.021) -- 0:00:22
648000 -- (-784.074) (-781.634) (-779.199) [-782.581] * (-780.454) (-779.699) (-782.335) [-780.515] -- 0:00:22
648500 -- (-783.673) (-782.675) [-779.587] (-779.785) * (-781.431) (-779.233) [-780.210] (-783.096) -- 0:00:22
649000 -- (-780.229) [-784.920] (-781.842) (-779.459) * (-783.360) (-779.304) (-780.691) [-784.155] -- 0:00:22
649500 -- (-780.548) (-780.930) [-779.125] (-780.232) * (-780.281) (-780.958) [-779.158] (-782.521) -- 0:00:22
650000 -- [-782.128] (-781.407) (-780.513) (-779.362) * (-780.704) (-779.946) (-780.049) [-782.445] -- 0:00:22
Average standard deviation of split frequencies: 0.007607
650500 -- (-779.273) (-779.419) (-783.298) [-778.806] * (-783.343) [-781.439] (-779.653) (-788.499) -- 0:00:22
651000 -- [-780.485] (-780.483) (-782.087) (-779.365) * (-779.668) [-783.316] (-783.032) (-778.663) -- 0:00:21
651500 -- (-780.976) (-778.890) (-781.265) [-779.399] * [-781.682] (-784.275) (-780.952) (-780.811) -- 0:00:21
652000 -- (-781.677) (-782.060) (-784.170) [-780.508] * [-781.456] (-779.189) (-781.063) (-782.603) -- 0:00:21
652500 -- (-780.687) [-779.977] (-787.103) (-779.780) * (-780.014) (-781.175) [-780.584] (-782.072) -- 0:00:21
653000 -- (-780.955) (-782.111) [-780.457] (-779.931) * (-783.107) (-782.384) (-780.525) [-782.109] -- 0:00:21
653500 -- (-780.163) (-778.835) (-781.564) [-779.582] * [-781.067] (-781.552) (-779.102) (-782.031) -- 0:00:21
654000 -- (-785.617) (-779.433) (-781.418) [-779.269] * (-779.519) [-779.060] (-783.120) (-781.029) -- 0:00:22
654500 -- [-778.777] (-782.881) (-784.737) (-781.167) * (-779.774) [-781.961] (-782.213) (-779.856) -- 0:00:22
655000 -- [-779.405] (-779.268) (-779.453) (-781.401) * [-781.181] (-783.036) (-779.427) (-782.017) -- 0:00:22
Average standard deviation of split frequencies: 0.007635
655500 -- [-778.822] (-780.423) (-780.350) (-780.859) * [-779.650] (-781.109) (-783.808) (-781.903) -- 0:00:22
656000 -- [-781.210] (-783.689) (-779.607) (-781.173) * (-782.657) (-779.874) (-781.926) [-780.517] -- 0:00:22
656500 -- [-783.560] (-780.770) (-780.705) (-781.831) * (-780.546) (-783.320) (-784.695) [-783.380] -- 0:00:21
657000 -- (-783.688) (-781.896) [-782.077] (-779.114) * (-781.842) (-781.410) (-782.264) [-781.643] -- 0:00:21
657500 -- (-783.760) [-782.663] (-779.904) (-785.350) * (-781.046) [-779.899] (-782.752) (-780.487) -- 0:00:21
658000 -- [-779.269] (-780.234) (-780.492) (-780.502) * (-781.903) (-779.363) [-779.984] (-783.700) -- 0:00:21
658500 -- (-780.253) (-781.204) (-779.875) [-779.522] * (-784.067) (-779.925) (-779.746) [-778.988] -- 0:00:21
659000 -- [-780.886] (-781.595) (-782.767) (-786.650) * (-782.141) [-780.734] (-781.198) (-779.347) -- 0:00:21
659500 -- (-780.369) (-781.294) [-779.365] (-782.741) * (-783.608) [-780.362] (-782.279) (-780.689) -- 0:00:21
660000 -- (-779.666) [-780.308] (-782.019) (-783.664) * (-783.783) (-784.224) [-782.305] (-780.262) -- 0:00:21
Average standard deviation of split frequencies: 0.008072
660500 -- (-779.568) (-783.804) (-780.827) [-780.216] * (-783.893) (-780.828) (-780.101) [-779.532] -- 0:00:21
661000 -- (-779.264) [-779.009] (-781.565) (-779.087) * (-779.864) (-781.711) [-780.850] (-782.347) -- 0:00:21
661500 -- [-780.402] (-780.986) (-778.794) (-781.916) * (-780.066) (-784.199) (-779.940) [-783.650] -- 0:00:21
662000 -- (-779.846) (-783.058) (-780.371) [-780.648] * (-779.505) [-781.007] (-780.627) (-780.303) -- 0:00:21
662500 -- (-780.300) (-781.988) (-780.656) [-786.099] * (-779.202) [-779.660] (-781.322) (-780.508) -- 0:00:21
663000 -- (-779.529) (-780.185) [-779.719] (-780.132) * [-780.323] (-780.781) (-781.275) (-780.231) -- 0:00:21
663500 -- (-780.101) (-779.723) [-779.701] (-780.335) * (-781.024) [-781.715] (-780.271) (-778.899) -- 0:00:21
664000 -- (-781.513) [-780.156] (-779.027) (-784.231) * [-782.552] (-779.899) (-779.476) (-781.645) -- 0:00:21
664500 -- (-779.166) (-780.764) [-784.903] (-784.266) * [-782.674] (-780.255) (-779.456) (-780.687) -- 0:00:21
665000 -- (-779.232) (-780.581) (-784.976) [-780.348] * (-782.066) (-778.602) (-781.478) [-779.765] -- 0:00:21
Average standard deviation of split frequencies: 0.007874
665500 -- [-780.594] (-780.434) (-783.652) (-780.129) * (-780.833) (-782.254) (-782.799) [-778.833] -- 0:00:21
666000 -- [-785.605] (-782.438) (-779.332) (-781.724) * (-780.418) (-779.885) [-783.820] (-779.965) -- 0:00:21
666500 -- (-780.512) [-780.532] (-778.846) (-780.057) * (-780.352) (-781.593) (-780.621) [-779.670] -- 0:00:21
667000 -- (-779.714) [-779.410] (-780.715) (-783.217) * (-781.705) (-780.345) [-782.582] (-781.057) -- 0:00:20
667500 -- [-779.854] (-779.410) (-782.236) (-786.167) * (-783.927) (-783.690) [-781.415] (-779.662) -- 0:00:20
668000 -- (-782.981) (-780.340) (-779.352) [-785.700] * (-781.021) (-784.067) (-781.257) [-780.104] -- 0:00:20
668500 -- (-782.160) (-780.171) (-779.685) [-780.359] * (-781.262) (-781.128) [-779.738] (-784.918) -- 0:00:20
669000 -- (-781.070) (-781.387) (-779.376) [-781.637] * [-781.096] (-778.984) (-779.667) (-781.764) -- 0:00:20
669500 -- [-779.844] (-780.099) (-779.124) (-781.644) * (-779.515) (-780.154) [-781.953] (-780.689) -- 0:00:20
670000 -- (-783.246) (-779.419) [-779.626] (-779.513) * (-779.171) (-783.408) [-780.875] (-780.894) -- 0:00:20
Average standard deviation of split frequencies: 0.007951
670500 -- (-779.970) (-781.117) [-781.710] (-780.480) * (-779.298) (-780.531) (-784.680) [-780.029] -- 0:00:21
671000 -- (-778.900) (-783.554) [-782.425] (-783.578) * (-782.883) [-780.979] (-782.821) (-780.559) -- 0:00:21
671500 -- (-779.949) [-781.060] (-779.884) (-784.871) * (-779.366) (-780.999) (-781.332) [-781.129] -- 0:00:21
672000 -- (-780.067) (-783.154) [-781.161] (-782.048) * (-779.128) [-781.041] (-785.971) (-783.128) -- 0:00:20
672500 -- (-781.369) (-779.913) [-780.880] (-779.597) * [-780.072] (-781.188) (-780.788) (-783.810) -- 0:00:20
673000 -- (-785.513) (-780.097) [-781.322] (-778.662) * (-780.070) [-782.728] (-784.046) (-786.087) -- 0:00:20
673500 -- (-787.859) [-780.917] (-780.684) (-781.493) * (-779.064) (-786.241) (-782.333) [-782.692] -- 0:00:20
674000 -- [-781.994] (-782.236) (-780.750) (-779.955) * (-783.187) (-781.797) [-782.015] (-781.799) -- 0:00:20
674500 -- (-781.896) (-781.275) [-779.042] (-780.601) * (-779.582) (-781.564) [-780.922] (-779.741) -- 0:00:20
675000 -- (-779.090) (-779.345) [-781.137] (-780.601) * (-779.814) (-782.153) (-779.206) [-778.774] -- 0:00:20
Average standard deviation of split frequencies: 0.008194
675500 -- (-779.848) (-780.397) (-781.527) [-781.141] * (-782.719) (-785.041) [-780.664] (-781.777) -- 0:00:20
676000 -- [-783.415] (-785.279) (-782.452) (-782.085) * (-780.972) (-784.929) (-784.464) [-783.886] -- 0:00:20
676500 -- (-781.912) (-781.167) (-783.361) [-781.882] * (-782.326) [-781.487] (-785.573) (-781.125) -- 0:00:20
677000 -- [-782.641] (-784.283) (-779.823) (-780.839) * [-781.971] (-780.092) (-782.977) (-780.736) -- 0:00:20
677500 -- [-779.919] (-779.930) (-781.258) (-781.662) * (-780.868) (-781.478) [-782.701] (-780.259) -- 0:00:20
678000 -- (-779.653) [-778.900] (-781.843) (-780.971) * (-779.477) (-785.233) [-781.500] (-782.894) -- 0:00:20
678500 -- [-781.038] (-779.533) (-779.488) (-782.521) * (-781.795) (-781.883) [-781.566] (-783.681) -- 0:00:20
679000 -- (-780.898) [-780.108] (-779.103) (-780.969) * (-781.197) (-784.432) [-779.999] (-780.027) -- 0:00:20
679500 -- (-780.455) [-780.257] (-782.217) (-779.476) * (-784.791) [-780.172] (-783.310) (-782.138) -- 0:00:20
680000 -- [-782.502] (-779.589) (-783.764) (-781.497) * [-781.663] (-780.706) (-780.271) (-781.959) -- 0:00:20
Average standard deviation of split frequencies: 0.008484
680500 -- (-778.715) [-779.462] (-779.993) (-779.892) * (-780.557) (-781.613) [-780.279] (-781.915) -- 0:00:20
681000 -- (-779.848) [-782.257] (-779.215) (-779.884) * [-783.026] (-781.458) (-780.364) (-779.771) -- 0:00:20
681500 -- (-782.665) (-783.978) (-779.162) [-782.814] * [-778.591] (-779.390) (-780.358) (-780.025) -- 0:00:20
682000 -- [-779.826] (-782.240) (-778.819) (-784.338) * [-779.446] (-781.304) (-780.736) (-781.945) -- 0:00:20
682500 -- (-781.284) [-779.967] (-779.486) (-780.274) * (-778.993) [-783.534] (-780.360) (-782.909) -- 0:00:20
683000 -- (-781.587) (-780.483) (-781.070) [-780.354] * [-778.738] (-781.524) (-781.034) (-782.208) -- 0:00:19
683500 -- (-780.327) (-781.046) (-780.654) [-780.617] * (-779.010) (-782.435) [-780.143] (-782.626) -- 0:00:19
684000 -- (-781.577) [-780.626] (-786.619) (-780.039) * [-780.126] (-780.069) (-779.270) (-780.454) -- 0:00:19
684500 -- [-784.009] (-781.739) (-780.621) (-779.195) * (-781.115) (-780.597) [-779.276] (-783.982) -- 0:00:19
685000 -- (-785.658) (-781.012) (-779.934) [-778.874] * (-782.458) (-782.937) [-780.645] (-780.819) -- 0:00:19
Average standard deviation of split frequencies: 0.008031
685500 -- (-789.079) (-781.434) [-778.891] (-781.081) * (-780.735) [-778.972] (-781.160) (-778.914) -- 0:00:19
686000 -- (-784.629) (-779.501) (-778.942) [-782.238] * [-780.118] (-781.529) (-782.225) (-778.808) -- 0:00:19
686500 -- (-778.634) [-779.581] (-781.844) (-779.825) * (-782.599) (-782.151) [-781.209] (-782.917) -- 0:00:19
687000 -- [-780.225] (-788.532) (-779.757) (-779.738) * [-781.969] (-781.518) (-780.598) (-780.005) -- 0:00:19
687500 -- (-779.752) (-780.806) [-783.392] (-780.132) * [-780.769] (-781.554) (-781.130) (-782.986) -- 0:00:20
688000 -- (-780.269) (-782.259) (-781.894) [-779.587] * (-782.857) [-780.344] (-780.222) (-779.642) -- 0:00:19
688500 -- [-780.309] (-779.212) (-780.379) (-788.863) * (-782.816) [-783.938] (-780.215) (-782.620) -- 0:00:19
689000 -- (-781.796) (-780.064) (-782.325) [-779.924] * (-778.959) (-783.144) (-779.581) [-783.632] -- 0:00:19
689500 -- (-780.530) (-780.159) [-780.625] (-779.341) * (-782.356) (-781.418) [-781.879] (-781.462) -- 0:00:19
690000 -- (-781.387) (-780.006) (-785.241) [-781.181] * (-779.500) (-779.977) (-782.087) [-781.276] -- 0:00:19
Average standard deviation of split frequencies: 0.008318
690500 -- (-780.610) (-780.914) (-781.707) [-781.283] * (-792.715) [-779.977] (-780.004) (-780.433) -- 0:00:19
691000 -- (-781.227) [-779.347] (-781.429) (-781.059) * [-782.365] (-781.976) (-780.045) (-779.245) -- 0:00:19
691500 -- (-780.319) (-783.953) [-782.925] (-781.493) * (-780.994) [-779.991] (-779.041) (-782.534) -- 0:00:19
692000 -- (-779.027) [-781.437] (-781.750) (-781.408) * (-781.401) (-780.727) [-782.822] (-782.257) -- 0:00:19
692500 -- (-783.936) (-783.410) (-783.109) [-780.533] * (-782.734) [-780.727] (-782.607) (-781.235) -- 0:00:19
693000 -- (-788.077) (-781.716) (-780.784) [-780.855] * (-779.042) (-782.288) (-781.861) [-783.007] -- 0:00:19
693500 -- (-783.407) [-780.819] (-782.702) (-779.722) * (-783.042) (-782.100) (-781.503) [-782.894] -- 0:00:19
694000 -- (-781.207) [-781.057] (-781.725) (-780.591) * (-781.011) [-780.354] (-782.555) (-782.179) -- 0:00:19
694500 -- (-785.565) [-783.399] (-782.509) (-779.195) * [-780.598] (-781.764) (-783.205) (-785.503) -- 0:00:19
695000 -- (-784.490) (-779.109) [-778.789] (-779.229) * (-779.698) [-785.246] (-781.559) (-783.861) -- 0:00:19
Average standard deviation of split frequencies: 0.008974
695500 -- (-784.272) [-779.568] (-781.756) (-778.902) * [-780.522] (-787.467) (-778.749) (-779.742) -- 0:00:19
696000 -- (-782.374) [-779.628] (-780.471) (-782.447) * (-784.887) (-782.998) [-779.783] (-782.702) -- 0:00:19
696500 -- (-779.660) [-783.618] (-779.786) (-782.681) * (-781.816) (-782.708) (-779.089) [-780.930] -- 0:00:19
697000 -- (-781.782) [-780.232] (-779.724) (-781.404) * (-781.167) (-783.111) [-779.757] (-779.612) -- 0:00:19
697500 -- [-780.384] (-779.687) (-781.118) (-779.480) * [-781.802] (-782.740) (-780.351) (-779.293) -- 0:00:19
698000 -- [-780.836] (-780.373) (-779.538) (-781.079) * [-785.722] (-781.496) (-782.130) (-780.118) -- 0:00:19
698500 -- (-780.671) (-779.159) (-784.422) [-780.269] * [-781.372] (-781.147) (-780.368) (-779.347) -- 0:00:18
699000 -- (-779.636) (-781.901) [-779.635] (-780.312) * (-782.173) (-779.626) [-782.074] (-782.212) -- 0:00:18
699500 -- (-783.384) (-780.906) (-782.521) [-780.297] * (-779.541) [-779.455] (-780.654) (-782.309) -- 0:00:18
700000 -- (-783.312) (-782.554) (-780.469) [-780.708] * (-781.040) [-782.928] (-781.474) (-780.147) -- 0:00:18
Average standard deviation of split frequencies: 0.008388
700500 -- (-781.690) [-781.295] (-780.097) (-781.773) * (-780.574) (-784.186) (-780.823) [-780.872] -- 0:00:18
701000 -- (-778.758) (-781.970) (-782.083) [-783.973] * (-780.149) (-782.847) (-783.434) [-780.784] -- 0:00:18
701500 -- (-779.622) (-782.103) [-780.120] (-779.587) * (-781.764) (-783.974) [-779.642] (-781.048) -- 0:00:18
702000 -- [-780.403] (-782.311) (-781.086) (-779.445) * (-780.119) (-785.570) [-783.755] (-781.887) -- 0:00:18
702500 -- (-781.407) (-780.108) [-781.042] (-779.242) * (-781.360) [-783.658] (-780.356) (-779.515) -- 0:00:18
703000 -- (-782.991) (-781.822) [-782.551] (-780.809) * [-779.341] (-781.674) (-783.128) (-785.576) -- 0:00:18
703500 -- [-780.471] (-783.198) (-779.552) (-782.200) * [-781.886] (-786.514) (-779.556) (-781.330) -- 0:00:18
704000 -- (-782.357) [-785.050] (-778.947) (-779.703) * (-783.585) (-783.986) [-779.471] (-781.543) -- 0:00:18
704500 -- [-778.967] (-782.008) (-778.579) (-779.431) * (-781.082) (-784.765) [-779.646] (-786.600) -- 0:00:18
705000 -- (-780.869) (-781.276) (-782.822) [-779.774] * [-779.597] (-783.312) (-779.608) (-784.237) -- 0:00:18
Average standard deviation of split frequencies: 0.008722
705500 -- (-779.847) (-780.421) (-783.011) [-779.829] * (-778.842) (-781.697) (-780.339) [-783.254] -- 0:00:18
706000 -- (-780.288) (-780.988) [-779.422] (-782.093) * (-783.955) [-780.730] (-781.001) (-783.047) -- 0:00:18
706500 -- (-781.172) (-779.746) (-780.084) [-782.058] * (-781.690) [-780.424] (-782.697) (-780.334) -- 0:00:18
707000 -- (-781.611) (-779.930) (-780.330) [-780.627] * [-779.793] (-780.250) (-780.438) (-782.439) -- 0:00:18
707500 -- [-781.409] (-783.040) (-782.479) (-781.474) * (-780.912) (-779.033) [-779.227] (-778.882) -- 0:00:18
708000 -- (-779.977) (-784.873) [-780.793] (-785.881) * [-781.254] (-779.282) (-779.338) (-781.767) -- 0:00:18
708500 -- (-779.296) [-782.670] (-781.487) (-779.315) * (-782.839) (-779.927) [-779.416] (-784.618) -- 0:00:18
709000 -- (-781.413) [-783.657] (-780.472) (-783.026) * (-780.894) [-779.502] (-780.139) (-781.457) -- 0:00:18
709500 -- (-779.105) [-781.826] (-782.561) (-782.759) * (-781.415) (-778.897) [-782.110] (-784.487) -- 0:00:18
710000 -- (-779.395) [-779.574] (-780.262) (-781.027) * (-786.545) (-782.010) [-781.966] (-780.131) -- 0:00:18
Average standard deviation of split frequencies: 0.009369
710500 -- (-781.430) [-779.464] (-780.417) (-783.196) * (-779.578) (-780.953) (-779.405) [-779.688] -- 0:00:18
711000 -- (-780.227) (-781.278) (-780.007) [-782.231] * (-781.452) (-781.813) [-780.616] (-779.174) -- 0:00:18
711500 -- (-783.662) (-781.340) (-781.963) [-781.594] * [-783.118] (-780.703) (-783.367) (-780.087) -- 0:00:18
712000 -- (-780.485) (-780.242) [-780.357] (-786.491) * (-780.749) (-780.914) [-781.671] (-782.699) -- 0:00:18
712500 -- [-781.011] (-788.680) (-779.511) (-781.687) * (-783.061) [-779.733] (-781.411) (-780.611) -- 0:00:18
713000 -- (-782.944) [-785.062] (-780.962) (-779.355) * [-781.775] (-783.249) (-781.607) (-781.383) -- 0:00:18
713500 -- [-782.821] (-782.982) (-782.457) (-780.104) * [-781.423] (-780.045) (-781.906) (-780.756) -- 0:00:18
714000 -- (-783.644) (-780.542) (-782.561) [-779.210] * (-779.680) (-781.941) (-781.998) [-780.850] -- 0:00:18
714500 -- (-781.699) [-779.913] (-782.048) (-779.745) * (-781.656) (-780.073) [-782.062] (-778.929) -- 0:00:17
715000 -- (-779.614) [-779.110] (-781.179) (-779.625) * [-779.113] (-779.800) (-781.350) (-780.336) -- 0:00:17
Average standard deviation of split frequencies: 0.009423
715500 -- (-781.411) [-779.255] (-779.557) (-782.777) * [-779.439] (-784.021) (-782.385) (-789.858) -- 0:00:17
716000 -- (-784.754) (-784.636) (-782.104) [-782.411] * (-781.493) (-781.492) [-780.178] (-781.583) -- 0:00:17
716500 -- (-782.082) (-781.660) (-782.414) [-783.334] * (-785.492) (-780.465) (-780.506) [-780.612] -- 0:00:17
717000 -- [-780.295] (-782.354) (-780.761) (-788.329) * (-779.522) (-781.506) [-781.731] (-782.326) -- 0:00:17
717500 -- (-784.003) [-779.953] (-780.941) (-781.890) * (-780.483) [-780.554] (-779.133) (-785.527) -- 0:00:17
718000 -- (-782.229) [-779.974] (-781.264) (-778.643) * (-782.426) (-781.125) [-779.807] (-782.935) -- 0:00:17
718500 -- (-783.903) (-779.994) [-784.384] (-779.736) * (-780.746) (-780.619) [-783.499] (-780.048) -- 0:00:17
719000 -- (-780.938) [-781.613] (-783.709) (-780.164) * [-779.568] (-780.307) (-783.853) (-781.561) -- 0:00:17
719500 -- [-782.557] (-782.224) (-780.050) (-781.643) * (-782.629) (-782.010) (-779.855) [-780.322] -- 0:00:17
720000 -- (-782.669) (-784.407) (-781.086) [-781.115] * (-782.479) (-781.093) [-779.952] (-780.369) -- 0:00:17
Average standard deviation of split frequencies: 0.010343
720500 -- (-782.457) [-780.690] (-781.096) (-780.842) * (-781.875) (-780.166) [-781.094] (-780.058) -- 0:00:17
721000 -- (-780.169) (-783.573) (-782.110) [-783.210] * (-780.342) (-780.884) [-779.554] (-780.398) -- 0:00:17
721500 -- [-779.604] (-782.919) (-781.462) (-779.672) * (-780.539) (-781.947) (-779.573) [-780.123] -- 0:00:17
722000 -- (-780.077) [-780.315] (-782.070) (-779.878) * (-782.882) (-781.650) [-780.217] (-780.016) -- 0:00:17
722500 -- (-780.209) (-782.195) [-780.684] (-779.781) * (-782.655) (-784.534) [-782.786] (-781.736) -- 0:00:17
723000 -- (-781.683) (-783.987) (-779.047) [-780.333] * (-780.380) [-782.767] (-784.029) (-782.299) -- 0:00:17
723500 -- (-784.703) [-781.965] (-781.686) (-781.899) * (-779.377) (-780.068) [-781.973] (-780.643) -- 0:00:17
724000 -- (-779.184) (-780.403) [-779.442] (-781.574) * (-780.198) (-779.872) [-779.070] (-780.716) -- 0:00:17
724500 -- (-779.438) [-779.438] (-779.273) (-784.586) * [-781.209] (-784.291) (-779.047) (-778.886) -- 0:00:17
725000 -- (-778.804) (-783.240) (-779.537) [-783.183] * (-784.130) (-781.631) (-782.695) [-780.170] -- 0:00:17
Average standard deviation of split frequencies: 0.010186
725500 -- (-779.229) [-781.097] (-783.025) (-779.781) * (-784.698) [-785.557] (-780.622) (-783.032) -- 0:00:17
726000 -- (-782.047) (-778.498) (-784.043) [-780.662] * (-784.502) (-780.932) (-779.480) [-783.242] -- 0:00:17
726500 -- (-780.318) (-780.769) (-780.687) [-779.570] * (-780.738) [-778.894] (-780.191) (-782.791) -- 0:00:17
727000 -- [-779.801] (-780.912) (-779.592) (-783.655) * [-780.827] (-779.696) (-781.427) (-782.594) -- 0:00:17
727500 -- (-781.943) (-781.205) [-780.738] (-778.962) * (-780.233) [-779.199] (-782.958) (-781.327) -- 0:00:17
728000 -- (-782.047) [-779.672] (-782.670) (-778.836) * [-780.297] (-779.712) (-785.844) (-782.797) -- 0:00:17
728500 -- (-780.668) (-780.132) (-779.647) [-778.832] * [-780.177] (-778.925) (-782.398) (-787.522) -- 0:00:17
729000 -- [-779.060] (-781.620) (-780.704) (-782.277) * [-782.400] (-778.767) (-782.294) (-780.918) -- 0:00:17
729500 -- [-780.730] (-779.334) (-781.686) (-782.953) * (-781.186) (-778.846) [-779.968] (-780.150) -- 0:00:17
730000 -- (-782.595) (-780.849) (-781.609) [-780.434] * (-780.347) (-780.540) [-781.235] (-779.004) -- 0:00:17
Average standard deviation of split frequencies: 0.010524
730500 -- (-781.819) [-784.743] (-783.457) (-780.763) * (-780.793) [-780.906] (-778.650) (-780.379) -- 0:00:16
731000 -- (-783.803) (-780.069) (-780.676) [-779.719] * (-779.318) (-781.068) (-779.584) [-781.254] -- 0:00:16
731500 -- [-780.342] (-780.709) (-780.977) (-780.874) * [-780.123] (-781.206) (-778.664) (-781.501) -- 0:00:16
732000 -- (-781.031) (-783.089) (-780.930) [-780.863] * [-785.256] (-781.773) (-781.521) (-780.423) -- 0:00:16
732500 -- (-780.994) (-784.847) (-780.498) [-780.920] * [-785.691] (-782.981) (-781.554) (-780.082) -- 0:00:16
733000 -- (-780.268) (-780.788) [-779.645] (-780.297) * (-781.057) (-780.390) [-780.719] (-783.591) -- 0:00:16
733500 -- (-782.805) (-780.776) [-780.229] (-781.952) * [-786.454] (-782.505) (-786.725) (-781.888) -- 0:00:16
734000 -- (-780.485) (-783.121) [-779.288] (-780.790) * (-781.836) (-787.003) (-779.437) [-780.898] -- 0:00:16
734500 -- (-781.217) (-780.648) (-780.165) [-782.291] * (-778.783) (-781.807) [-782.575] (-782.002) -- 0:00:16
735000 -- (-783.485) (-779.416) (-783.174) [-780.965] * (-780.710) [-781.112] (-782.290) (-781.194) -- 0:00:16
Average standard deviation of split frequencies: 0.010088
735500 -- (-781.029) (-781.433) (-785.933) [-779.895] * (-782.777) (-782.503) (-779.744) [-783.633] -- 0:00:16
736000 -- (-780.082) (-779.365) [-785.132] (-782.053) * (-786.155) (-786.258) [-779.759] (-781.160) -- 0:00:16
736500 -- (-781.477) [-782.123] (-780.745) (-781.465) * (-781.916) (-784.014) [-781.545] (-781.566) -- 0:00:16
737000 -- (-782.655) (-780.623) (-783.481) [-781.842] * (-783.218) [-781.211] (-780.971) (-779.650) -- 0:00:16
737500 -- (-780.437) (-783.788) [-781.472] (-781.933) * (-781.564) (-780.426) (-781.413) [-782.378] -- 0:00:16
738000 -- (-781.019) (-780.012) (-779.655) [-779.730] * [-783.002] (-783.790) (-781.159) (-779.636) -- 0:00:16
738500 -- (-781.597) [-782.553] (-779.416) (-779.805) * (-783.033) (-779.876) (-780.100) [-782.426] -- 0:00:16
739000 -- (-783.717) [-780.112] (-783.952) (-784.012) * (-781.774) [-780.324] (-779.520) (-779.382) -- 0:00:16
739500 -- (-781.729) (-780.512) (-783.842) [-783.896] * (-779.677) [-779.176] (-779.277) (-780.360) -- 0:00:16
740000 -- [-780.352] (-782.726) (-781.722) (-784.647) * (-781.569) [-778.699] (-784.045) (-782.081) -- 0:00:16
Average standard deviation of split frequencies: 0.010382
740500 -- (-780.573) [-778.814] (-783.369) (-779.896) * (-786.026) (-779.416) [-780.972] (-782.974) -- 0:00:16
741000 -- (-780.287) (-781.939) (-782.812) [-782.053] * (-785.505) (-781.331) [-782.851] (-778.922) -- 0:00:16
741500 -- (-781.791) (-779.259) [-780.478] (-779.525) * [-788.020] (-786.086) (-781.812) (-780.323) -- 0:00:16
742000 -- (-782.156) [-784.590] (-779.801) (-779.080) * [-782.974] (-783.487) (-784.877) (-783.457) -- 0:00:16
742500 -- (-781.217) [-782.487] (-783.015) (-780.607) * (-781.974) [-780.286] (-781.197) (-789.254) -- 0:00:16
743000 -- [-779.357] (-786.087) (-781.817) (-780.114) * [-779.044] (-784.305) (-779.163) (-782.360) -- 0:00:16
743500 -- (-784.354) [-780.948] (-785.297) (-782.377) * (-780.473) (-779.540) [-782.588] (-780.077) -- 0:00:16
744000 -- [-780.499] (-780.165) (-782.317) (-783.595) * (-781.242) (-779.549) [-780.312] (-779.451) -- 0:00:16
744500 -- (-783.617) [-779.016] (-781.794) (-779.179) * [-780.884] (-781.429) (-781.897) (-780.838) -- 0:00:16
745000 -- (-780.008) [-781.176] (-781.614) (-780.928) * (-779.163) (-780.420) [-780.151] (-780.554) -- 0:00:16
Average standard deviation of split frequencies: 0.011098
745500 -- (-780.589) [-782.194] (-782.326) (-781.948) * (-781.886) (-781.339) (-780.648) [-781.254] -- 0:00:16
746000 -- (-779.329) [-779.536] (-778.578) (-779.342) * (-783.867) (-779.875) [-781.465] (-781.960) -- 0:00:16
746500 -- [-779.248] (-783.964) (-778.485) (-779.548) * (-779.598) (-781.199) (-780.673) [-780.683] -- 0:00:15
747000 -- (-785.585) (-782.911) [-781.430] (-782.811) * (-778.696) (-780.235) [-781.959] (-781.364) -- 0:00:15
747500 -- (-782.894) (-779.820) [-780.051] (-783.359) * (-782.247) (-781.685) [-780.087] (-783.110) -- 0:00:15
748000 -- (-783.554) [-779.625] (-781.002) (-780.532) * (-780.858) (-779.689) [-782.007] (-782.902) -- 0:00:15
748500 -- [-780.813] (-778.860) (-782.046) (-780.309) * [-782.233] (-780.139) (-780.262) (-779.029) -- 0:00:15
749000 -- (-780.576) (-782.459) (-779.782) [-779.483] * (-780.134) [-779.401] (-781.183) (-780.282) -- 0:00:15
749500 -- (-782.428) (-781.684) [-778.752] (-780.363) * (-779.863) (-780.775) (-780.088) [-779.815] -- 0:00:15
750000 -- (-780.516) [-780.764] (-780.435) (-780.700) * (-779.950) (-782.699) (-779.261) [-781.365] -- 0:00:15
Average standard deviation of split frequencies: 0.010479
750500 -- (-780.826) [-780.055] (-784.476) (-780.348) * (-781.315) [-781.189] (-780.906) (-782.517) -- 0:00:15
751000 -- [-783.101] (-779.948) (-781.150) (-779.639) * (-782.562) [-780.057] (-782.533) (-783.586) -- 0:00:15
751500 -- (-784.249) (-779.193) (-782.116) [-780.396] * (-780.697) (-782.509) (-781.546) [-783.634] -- 0:00:15
752000 -- (-787.062) [-780.698] (-781.243) (-780.651) * [-779.011] (-785.978) (-779.098) (-780.238) -- 0:00:15
752500 -- (-781.464) [-783.853] (-779.344) (-782.592) * (-782.985) (-780.539) (-782.011) [-781.621] -- 0:00:15
753000 -- (-782.118) [-781.681] (-783.874) (-785.249) * (-781.782) [-779.696] (-780.102) (-784.453) -- 0:00:15
753500 -- (-780.151) [-780.359] (-780.922) (-781.504) * (-782.209) (-787.387) (-783.066) [-781.530] -- 0:00:15
754000 -- (-781.639) [-780.077] (-781.319) (-780.478) * (-779.317) (-780.195) (-779.284) [-778.653] -- 0:00:15
754500 -- (-782.252) (-783.829) (-781.341) [-787.327] * (-780.364) (-780.445) [-783.690] (-781.451) -- 0:00:15
755000 -- (-782.440) [-783.252] (-780.767) (-782.307) * (-779.368) [-783.899] (-784.490) (-783.708) -- 0:00:15
Average standard deviation of split frequencies: 0.009938
755500 -- (-783.346) (-781.026) [-781.958] (-782.664) * (-782.004) (-781.887) (-779.756) [-780.033] -- 0:00:15
756000 -- (-782.378) (-779.272) [-780.689] (-781.636) * (-780.754) (-780.510) [-779.541] (-779.732) -- 0:00:15
756500 -- (-781.635) [-779.351] (-780.449) (-780.831) * (-782.929) [-782.081] (-780.549) (-779.542) -- 0:00:15
757000 -- (-780.374) (-781.520) (-781.229) [-779.621] * (-780.817) (-782.969) (-779.717) [-778.800] -- 0:00:15
757500 -- [-784.135] (-780.313) (-781.648) (-780.441) * (-780.065) (-779.691) (-779.721) [-781.533] -- 0:00:15
758000 -- [-779.925] (-778.925) (-782.102) (-780.712) * (-780.606) [-780.835] (-781.197) (-781.989) -- 0:00:15
758500 -- (-780.490) (-781.104) [-779.620] (-781.467) * (-785.325) (-781.744) (-780.379) [-781.226] -- 0:00:15
759000 -- (-781.195) (-780.023) (-783.609) [-780.833] * (-783.844) (-783.459) (-782.995) [-782.308] -- 0:00:15
759500 -- (-781.898) [-779.971] (-780.559) (-781.458) * (-784.651) [-782.837] (-781.376) (-780.244) -- 0:00:15
760000 -- (-778.750) [-780.485] (-780.304) (-780.221) * (-784.936) (-784.033) (-783.519) [-778.745] -- 0:00:15
Average standard deviation of split frequencies: 0.010264
760500 -- [-785.294] (-780.766) (-780.518) (-781.460) * (-779.137) [-781.151] (-782.214) (-780.299) -- 0:00:15
761000 -- [-784.095] (-781.518) (-781.229) (-781.264) * [-782.607] (-783.350) (-780.860) (-780.041) -- 0:00:15
761500 -- (-783.002) (-780.205) (-779.515) [-780.382] * [-782.764] (-784.354) (-779.167) (-781.067) -- 0:00:15
762000 -- (-782.822) [-779.399] (-780.157) (-780.059) * (-784.805) (-781.544) [-780.721] (-779.212) -- 0:00:14
762500 -- [-783.244] (-780.304) (-781.652) (-779.727) * (-783.098) (-780.528) (-781.887) [-781.411] -- 0:00:14
763000 -- (-783.009) (-783.683) [-780.901] (-779.370) * (-782.400) (-784.350) [-781.548] (-780.572) -- 0:00:14
763500 -- (-779.312) [-780.757] (-780.412) (-779.594) * (-783.180) (-783.594) (-783.098) [-782.657] -- 0:00:14
764000 -- (-779.078) (-779.054) [-781.263] (-781.725) * (-781.554) (-784.538) (-781.845) [-780.557] -- 0:00:14
764500 -- (-778.839) [-778.711] (-782.435) (-782.675) * [-781.358] (-783.303) (-781.408) (-781.102) -- 0:00:14
765000 -- [-779.648] (-779.693) (-781.531) (-780.903) * (-780.206) (-783.736) [-781.339] (-782.401) -- 0:00:14
Average standard deviation of split frequencies: 0.010462
765500 -- (-784.236) (-781.070) (-781.049) [-781.275] * [-780.310] (-789.898) (-780.356) (-784.710) -- 0:00:14
766000 -- (-779.887) (-779.337) (-781.971) [-778.683] * (-784.596) [-785.309] (-788.575) (-785.462) -- 0:00:14
766500 -- (-783.787) [-778.682] (-781.002) (-788.879) * (-781.344) [-782.221] (-781.166) (-780.838) -- 0:00:14
767000 -- (-781.102) [-779.375] (-778.637) (-779.026) * [-781.841] (-783.272) (-782.931) (-781.672) -- 0:00:14
767500 -- (-781.873) (-780.712) [-778.559] (-779.488) * (-784.567) (-782.317) [-781.526] (-784.541) -- 0:00:14
768000 -- (-781.186) (-783.314) [-780.382] (-779.488) * (-781.142) [-780.700] (-780.389) (-782.685) -- 0:00:14
768500 -- (-786.685) (-779.603) [-779.783] (-779.736) * (-781.989) [-784.843] (-783.465) (-781.333) -- 0:00:14
769000 -- (-780.969) (-780.972) [-780.972] (-779.997) * (-781.760) (-789.484) [-779.227] (-788.452) -- 0:00:14
769500 -- (-781.421) (-783.900) [-779.603] (-778.833) * (-781.760) [-782.148] (-779.227) (-780.268) -- 0:00:14
770000 -- (-780.847) (-782.156) (-779.791) [-780.581] * (-781.948) (-780.062) [-781.018] (-780.503) -- 0:00:14
Average standard deviation of split frequencies: 0.010236
770500 -- (-779.142) (-781.325) [-779.160] (-781.859) * [-781.834] (-780.974) (-781.134) (-780.338) -- 0:00:14
771000 -- [-781.522] (-781.883) (-779.011) (-780.720) * (-780.300) (-779.527) [-781.700] (-781.002) -- 0:00:14
771500 -- (-781.910) [-780.153] (-778.578) (-781.854) * (-784.044) [-780.342] (-781.077) (-779.904) -- 0:00:14
772000 -- (-783.456) [-780.223] (-778.493) (-782.438) * [-781.060] (-780.807) (-784.377) (-779.278) -- 0:00:14
772500 -- [-780.730] (-781.692) (-788.443) (-780.640) * (-781.248) [-781.839] (-783.112) (-780.361) -- 0:00:14
773000 -- (-781.131) [-781.142] (-783.708) (-780.326) * (-780.231) (-780.898) (-779.296) [-780.206] -- 0:00:14
773500 -- [-782.163] (-779.633) (-781.605) (-781.305) * [-783.410] (-779.719) (-778.760) (-781.123) -- 0:00:14
774000 -- (-783.666) [-780.253] (-782.239) (-781.718) * (-785.446) (-782.190) [-779.053] (-782.554) -- 0:00:14
774500 -- (-779.522) (-780.131) [-781.243] (-781.227) * (-779.699) [-780.779] (-782.208) (-780.733) -- 0:00:14
775000 -- (-779.582) (-784.941) [-780.128] (-781.290) * (-780.174) [-780.114] (-782.420) (-781.629) -- 0:00:14
Average standard deviation of split frequencies: 0.010821
775500 -- (-779.270) (-785.877) [-780.413] (-785.451) * (-780.362) [-778.832] (-779.258) (-786.066) -- 0:00:14
776000 -- (-781.226) (-781.013) (-782.437) [-782.227] * (-779.660) (-780.548) [-779.058] (-781.351) -- 0:00:14
776500 -- (-781.150) (-778.670) [-782.157] (-780.375) * (-781.317) (-780.037) (-781.681) [-780.168] -- 0:00:14
777000 -- (-778.577) (-779.281) (-779.885) [-780.437] * (-784.514) (-779.828) [-781.551] (-782.226) -- 0:00:14
777500 -- (-780.242) [-779.866] (-781.485) (-780.844) * (-780.411) (-779.180) [-780.133] (-781.837) -- 0:00:14
778000 -- (-779.735) (-785.245) [-781.556] (-780.949) * (-780.555) [-779.802] (-781.042) (-780.833) -- 0:00:13
778500 -- (-779.728) (-781.797) [-779.490] (-785.775) * (-779.238) (-779.551) (-786.310) [-779.700] -- 0:00:13
779000 -- (-780.459) [-779.508] (-779.913) (-781.595) * (-779.927) (-780.549) (-783.783) [-779.330] -- 0:00:13
779500 -- (-783.555) (-783.214) (-784.521) [-780.218] * (-779.739) [-781.898] (-780.995) (-779.078) -- 0:00:13
780000 -- [-782.883] (-779.996) (-783.007) (-779.696) * [-779.729] (-780.136) (-783.110) (-781.724) -- 0:00:13
Average standard deviation of split frequencies: 0.010341
780500 -- (-782.800) (-782.568) [-785.112] (-779.149) * (-783.173) (-784.342) (-781.826) [-781.959] -- 0:00:13
781000 -- (-782.009) (-780.075) (-780.786) [-780.644] * (-781.488) (-780.010) (-782.510) [-781.874] -- 0:00:13
781500 -- [-783.229] (-781.956) (-781.935) (-782.707) * (-782.503) (-779.940) [-779.436] (-779.189) -- 0:00:13
782000 -- (-783.810) (-780.454) (-781.514) [-782.577] * (-782.188) (-781.342) [-780.166] (-780.129) -- 0:00:13
782500 -- (-790.210) (-780.428) (-783.350) [-780.500] * (-779.915) (-780.270) (-780.914) [-780.903] -- 0:00:13
783000 -- [-781.811] (-780.802) (-779.578) (-779.838) * (-783.830) [-779.878] (-780.122) (-781.807) -- 0:00:13
783500 -- [-781.180] (-781.597) (-780.991) (-780.959) * (-784.236) [-779.931] (-780.139) (-785.784) -- 0:00:13
784000 -- (-780.891) [-780.862] (-781.528) (-780.662) * (-781.099) [-782.185] (-780.120) (-783.090) -- 0:00:13
784500 -- (-779.647) (-780.757) [-779.779] (-779.090) * (-779.230) (-780.774) [-781.699] (-786.047) -- 0:00:13
785000 -- (-780.254) (-779.664) [-779.812] (-778.858) * [-779.560] (-779.218) (-780.190) (-785.018) -- 0:00:13
Average standard deviation of split frequencies: 0.010654
785500 -- (-781.497) [-785.232] (-781.780) (-783.132) * [-779.178] (-779.286) (-780.023) (-781.326) -- 0:00:13
786000 -- [-779.792] (-780.352) (-782.350) (-782.801) * (-780.501) [-780.342] (-780.163) (-782.935) -- 0:00:13
786500 -- (-779.675) (-779.812) [-781.373] (-782.705) * [-780.541] (-780.710) (-779.964) (-779.168) -- 0:00:13
787000 -- (-781.813) (-779.654) [-782.954] (-779.833) * (-780.011) (-783.601) (-780.027) [-778.886] -- 0:00:13
787500 -- (-781.556) [-780.748] (-780.031) (-782.493) * (-779.546) (-784.547) [-780.486] (-779.653) -- 0:00:13
788000 -- [-779.770] (-781.807) (-780.277) (-779.857) * [-780.154] (-781.176) (-780.040) (-779.262) -- 0:00:13
788500 -- (-782.872) [-781.344] (-782.898) (-780.657) * (-780.141) (-780.978) [-779.764] (-780.588) -- 0:00:13
789000 -- (-778.894) (-781.305) [-780.227] (-783.358) * (-784.074) (-780.226) [-782.428] (-783.817) -- 0:00:13
789500 -- (-779.143) [-779.254] (-779.659) (-779.119) * (-781.631) [-780.100] (-781.486) (-784.607) -- 0:00:13
790000 -- (-781.275) [-779.736] (-783.447) (-779.018) * [-781.548] (-781.328) (-781.531) (-781.389) -- 0:00:13
Average standard deviation of split frequencies: 0.010016
790500 -- (-782.573) (-784.278) [-779.379] (-779.170) * [-781.342] (-780.755) (-780.246) (-782.405) -- 0:00:13
791000 -- (-783.099) (-780.470) (-780.903) [-780.203] * [-780.967] (-779.196) (-781.426) (-783.945) -- 0:00:13
791500 -- (-783.308) (-779.403) (-780.570) [-781.031] * (-780.569) [-783.310] (-780.478) (-779.038) -- 0:00:13
792000 -- (-782.586) (-780.354) [-779.743] (-780.032) * (-779.983) [-779.205] (-779.389) (-779.558) -- 0:00:13
792500 -- (-782.075) (-779.234) (-778.735) [-780.589] * (-784.431) (-779.261) (-780.906) [-780.558] -- 0:00:13
793000 -- (-779.521) (-779.443) [-779.983] (-780.435) * (-782.411) [-781.004] (-782.471) (-783.456) -- 0:00:13
793500 -- [-784.122] (-780.876) (-779.609) (-779.555) * (-785.841) (-780.296) (-779.644) [-780.290] -- 0:00:13
794000 -- (-781.017) (-781.421) (-779.829) [-782.648] * (-782.266) [-784.078] (-779.333) (-782.329) -- 0:00:12
794500 -- (-779.352) (-783.021) [-779.447] (-785.513) * (-781.888) (-787.011) [-780.040] (-780.999) -- 0:00:12
795000 -- [-780.802] (-779.995) (-780.715) (-783.995) * (-780.500) (-780.542) (-782.505) [-780.646] -- 0:00:12
Average standard deviation of split frequencies: 0.009673
795500 -- (-781.604) (-780.371) [-779.523] (-780.917) * (-780.990) (-783.935) [-781.138] (-783.393) -- 0:00:12
796000 -- (-780.252) (-781.371) [-779.765] (-786.052) * [-781.753] (-782.633) (-783.309) (-780.672) -- 0:00:12
796500 -- (-780.300) (-780.560) [-779.331] (-782.515) * [-780.427] (-783.582) (-781.278) (-783.544) -- 0:00:12
797000 -- (-779.947) (-779.926) (-785.121) [-782.771] * (-783.284) (-779.529) [-780.415] (-786.480) -- 0:00:12
797500 -- (-779.871) (-780.900) [-781.136] (-780.051) * [-781.942] (-780.007) (-781.833) (-779.935) -- 0:00:12
798000 -- [-779.666] (-784.104) (-781.167) (-779.174) * [-779.740] (-779.148) (-780.385) (-780.183) -- 0:00:12
798500 -- (-779.478) (-783.550) (-781.380) [-780.583] * [-779.147] (-782.683) (-780.679) (-779.670) -- 0:00:12
799000 -- [-782.399] (-782.992) (-780.214) (-782.206) * (-779.698) (-779.744) (-782.204) [-782.323] -- 0:00:12
799500 -- (-780.292) (-781.119) (-782.515) [-781.331] * [-780.410] (-782.347) (-785.593) (-781.063) -- 0:00:12
800000 -- (-781.377) [-784.534] (-785.995) (-780.078) * [-781.021] (-781.864) (-779.974) (-783.542) -- 0:00:12
Average standard deviation of split frequencies: 0.009734
800500 -- (-785.018) (-781.116) (-782.985) [-783.098] * [-780.884] (-780.958) (-780.494) (-780.498) -- 0:00:12
801000 -- (-784.326) [-779.816] (-779.642) (-784.242) * (-781.784) (-781.347) (-780.620) [-779.760] -- 0:00:12
801500 -- (-781.827) (-780.687) (-781.020) [-779.570] * [-782.148] (-782.802) (-783.729) (-779.920) -- 0:00:12
802000 -- (-780.103) (-779.900) (-780.152) [-784.265] * (-780.411) (-779.383) (-780.423) [-780.445] -- 0:00:12
802500 -- (-780.974) [-782.939] (-779.810) (-782.361) * (-779.451) (-780.734) [-781.174] (-781.921) -- 0:00:12
803000 -- (-780.270) (-783.321) [-780.409] (-781.899) * [-780.371] (-782.069) (-781.726) (-781.586) -- 0:00:12
803500 -- [-780.947] (-784.873) (-787.443) (-780.860) * [-782.233] (-781.001) (-784.400) (-779.050) -- 0:00:12
804000 -- (-780.111) [-779.363] (-780.451) (-779.984) * [-782.119] (-781.567) (-785.013) (-779.153) -- 0:00:12
804500 -- (-779.145) [-781.157] (-783.618) (-780.666) * (-782.325) (-781.796) [-785.327] (-780.615) -- 0:00:12
805000 -- (-779.433) (-779.508) [-779.629] (-779.312) * (-782.126) (-779.825) (-782.334) [-781.779] -- 0:00:12
Average standard deviation of split frequencies: 0.009475
805500 -- (-779.170) (-779.993) (-786.477) [-783.979] * (-783.322) (-781.058) (-780.048) [-786.161] -- 0:00:12
806000 -- [-779.107] (-786.164) (-782.567) (-782.469) * (-779.708) (-780.870) [-780.823] (-785.227) -- 0:00:12
806500 -- (-780.087) (-782.801) (-782.216) [-782.313] * (-780.426) (-781.192) [-781.818] (-787.898) -- 0:00:12
807000 -- (-779.999) (-782.853) [-782.160] (-780.253) * (-783.858) (-782.802) (-781.117) [-780.059] -- 0:00:12
807500 -- [-780.222] (-782.228) (-783.385) (-780.700) * (-780.653) (-780.559) [-780.418] (-778.854) -- 0:00:12
808000 -- (-780.666) [-781.390] (-784.009) (-780.694) * (-781.065) [-783.620] (-782.828) (-778.774) -- 0:00:12
808500 -- (-782.062) (-781.722) [-782.366] (-783.366) * (-780.551) (-781.010) [-779.758] (-781.230) -- 0:00:12
809000 -- (-780.660) (-782.531) (-784.790) [-780.106] * (-781.326) [-779.303] (-779.886) (-779.720) -- 0:00:12
809500 -- [-780.296] (-782.158) (-783.236) (-780.422) * (-783.848) (-780.195) (-780.337) [-778.880] -- 0:00:12
810000 -- (-785.451) (-779.651) [-782.155] (-787.135) * (-783.490) (-780.212) (-780.476) [-779.692] -- 0:00:11
Average standard deviation of split frequencies: 0.009304
810500 -- (-784.549) [-781.358] (-784.576) (-781.641) * (-785.388) (-782.158) [-781.584] (-782.897) -- 0:00:11
811000 -- (-781.811) (-784.082) [-783.115] (-779.116) * (-783.055) (-783.292) [-780.540] (-779.927) -- 0:00:11
811500 -- (-781.801) (-785.265) [-780.732] (-779.349) * (-779.350) (-782.062) (-783.160) [-780.107] -- 0:00:11
812000 -- (-782.077) (-782.594) (-780.889) [-778.853] * (-781.819) (-780.428) (-781.342) [-782.282] -- 0:00:11
812500 -- (-778.864) (-780.916) (-779.782) [-779.105] * (-783.926) (-783.596) (-780.653) [-781.066] -- 0:00:11
813000 -- (-778.971) (-779.683) [-780.358] (-779.077) * (-783.402) [-780.478] (-782.001) (-782.756) -- 0:00:11
813500 -- (-779.342) (-778.868) [-780.253] (-781.212) * (-785.989) (-779.391) (-781.190) [-783.568] -- 0:00:11
814000 -- (-780.490) (-779.296) [-781.206] (-781.592) * [-779.536] (-786.212) (-781.195) (-780.101) -- 0:00:11
814500 -- [-779.630] (-778.725) (-781.590) (-780.237) * [-779.300] (-781.743) (-782.445) (-781.029) -- 0:00:11
815000 -- (-780.625) (-786.234) [-785.159] (-780.409) * (-780.553) [-783.944] (-784.447) (-780.590) -- 0:00:11
Average standard deviation of split frequencies: 0.009205
815500 -- (-779.533) (-783.183) (-780.881) [-779.810] * (-780.660) [-780.135] (-785.025) (-779.838) -- 0:00:11
816000 -- (-783.329) [-780.341] (-782.256) (-779.282) * (-780.643) (-780.653) [-779.711] (-778.919) -- 0:00:11
816500 -- (-780.768) [-778.789] (-780.914) (-780.907) * (-780.230) (-780.515) [-780.156] (-778.711) -- 0:00:11
817000 -- (-782.942) (-779.475) (-780.813) [-780.555] * (-779.361) [-783.058] (-784.772) (-781.698) -- 0:00:11
817500 -- [-783.192] (-781.409) (-783.349) (-782.223) * [-781.749] (-782.775) (-781.106) (-780.637) -- 0:00:11
818000 -- [-781.938] (-780.119) (-779.771) (-782.040) * (-781.789) (-785.343) [-779.153] (-780.712) -- 0:00:11
818500 -- [-780.871] (-784.591) (-781.039) (-780.827) * (-783.301) [-780.747] (-783.290) (-781.570) -- 0:00:11
819000 -- (-782.335) (-782.939) (-787.579) [-782.078] * (-779.983) (-779.371) (-780.265) [-780.795] -- 0:00:11
819500 -- (-784.046) [-783.121] (-781.685) (-786.404) * (-781.481) (-779.437) (-782.106) [-782.754] -- 0:00:11
820000 -- (-783.273) (-779.841) [-780.518] (-783.967) * (-778.955) (-779.059) [-781.930] (-779.609) -- 0:00:11
Average standard deviation of split frequencies: 0.009229
820500 -- (-779.903) [-780.577] (-779.754) (-779.760) * [-780.711] (-780.278) (-779.285) (-779.808) -- 0:00:11
821000 -- (-780.712) [-785.094] (-780.026) (-784.015) * [-780.404] (-780.662) (-780.890) (-782.599) -- 0:00:11
821500 -- (-781.389) (-780.993) [-779.428] (-779.020) * [-782.267] (-779.404) (-779.626) (-780.681) -- 0:00:11
822000 -- [-784.177] (-779.600) (-781.758) (-780.973) * (-779.793) [-780.440] (-782.153) (-783.167) -- 0:00:11
822500 -- [-781.388] (-779.606) (-781.282) (-781.520) * (-780.963) (-780.617) (-779.688) [-779.101] -- 0:00:11
823000 -- [-782.607] (-783.358) (-779.975) (-781.753) * (-780.784) (-780.208) (-780.657) [-780.763] -- 0:00:11
823500 -- (-782.400) [-779.790] (-781.481) (-780.046) * [-779.722] (-779.456) (-779.790) (-779.253) -- 0:00:11
824000 -- (-782.375) [-780.724] (-781.682) (-781.970) * (-782.628) (-780.167) (-782.085) [-780.032] -- 0:00:11
824500 -- (-780.859) (-783.628) [-781.305] (-779.704) * [-780.286] (-780.846) (-784.741) (-780.110) -- 0:00:11
825000 -- [-780.931] (-784.286) (-782.732) (-779.151) * (-780.066) (-781.638) [-778.983] (-782.678) -- 0:00:11
Average standard deviation of split frequencies: 0.009017
825500 -- (-780.440) [-781.781] (-784.474) (-778.755) * [-780.484] (-781.458) (-778.827) (-780.059) -- 0:00:10
826000 -- (-779.602) (-780.620) (-779.942) [-781.288] * (-778.639) (-781.694) (-779.513) [-782.502] -- 0:00:10
826500 -- [-779.389] (-779.942) (-784.699) (-779.823) * (-781.164) [-779.543] (-781.518) (-783.979) -- 0:00:10
827000 -- [-782.376] (-781.924) (-782.943) (-780.946) * (-781.958) (-779.489) [-780.147] (-782.369) -- 0:00:10
827500 -- (-782.275) [-781.714] (-782.678) (-781.254) * [-779.658] (-784.837) (-780.992) (-779.753) -- 0:00:10
828000 -- [-782.548] (-780.035) (-780.041) (-784.330) * (-780.084) [-784.371] (-780.338) (-781.043) -- 0:00:10
828500 -- (-782.327) (-780.447) [-780.283] (-779.699) * (-781.696) (-782.803) (-779.129) [-781.544] -- 0:00:10
829000 -- [-780.290] (-779.349) (-779.300) (-780.133) * (-781.258) (-781.264) [-781.104] (-780.987) -- 0:00:10
829500 -- [-784.423] (-782.367) (-780.358) (-780.371) * (-785.294) (-781.637) [-781.326] (-779.654) -- 0:00:10
830000 -- [-784.448] (-782.012) (-779.825) (-782.346) * (-783.327) (-780.912) [-780.556] (-779.436) -- 0:00:10
Average standard deviation of split frequencies: 0.008929
830500 -- (-781.748) (-785.833) (-779.791) [-781.755] * (-781.263) [-781.153] (-779.901) (-779.714) -- 0:00:10
831000 -- (-778.791) [-781.696] (-780.492) (-782.268) * (-780.049) (-780.977) [-785.364] (-785.257) -- 0:00:10
831500 -- (-782.967) [-780.574] (-778.616) (-783.212) * (-779.120) [-778.887] (-781.359) (-779.633) -- 0:00:10
832000 -- (-782.331) [-782.997] (-779.379) (-779.914) * [-782.816] (-780.100) (-782.196) (-780.414) -- 0:00:10
832500 -- [-782.563] (-780.707) (-780.966) (-781.172) * (-780.585) (-778.669) [-781.415] (-780.104) -- 0:00:10
833000 -- [-783.582] (-779.525) (-779.614) (-782.317) * [-780.675] (-778.732) (-781.719) (-782.575) -- 0:00:10
833500 -- (-783.171) (-781.727) [-781.823] (-781.177) * [-781.559] (-780.507) (-784.298) (-779.199) -- 0:00:10
834000 -- (-782.030) [-782.290] (-782.516) (-781.908) * (-780.286) (-783.689) (-782.908) [-779.046] -- 0:00:10
834500 -- (-781.868) [-780.858] (-781.113) (-782.270) * (-779.396) (-779.852) (-789.616) [-782.280] -- 0:00:10
835000 -- (-780.326) (-780.981) [-781.032] (-780.125) * (-780.925) (-779.758) [-779.671] (-781.162) -- 0:00:10
Average standard deviation of split frequencies: 0.009172
835500 -- (-781.498) (-780.732) [-781.994] (-780.700) * [-782.448] (-783.100) (-779.930) (-778.990) -- 0:00:10
836000 -- [-779.071] (-781.027) (-780.146) (-780.957) * (-781.197) (-782.171) (-783.750) [-779.085] -- 0:00:10
836500 -- (-783.416) [-779.746] (-780.664) (-782.799) * (-779.360) (-779.559) (-783.876) [-779.106] -- 0:00:10
837000 -- (-780.917) [-780.190] (-782.058) (-782.809) * [-780.288] (-780.549) (-782.416) (-779.838) -- 0:00:10
837500 -- (-782.747) [-779.651] (-781.569) (-782.030) * (-780.935) [-786.071] (-783.887) (-779.159) -- 0:00:10
838000 -- (-780.641) (-781.060) [-780.742] (-782.791) * [-779.544] (-780.700) (-781.262) (-779.435) -- 0:00:10
838500 -- [-779.089] (-780.342) (-781.940) (-781.616) * (-779.824) (-779.896) (-787.431) [-782.524] -- 0:00:10
839000 -- (-780.585) (-781.637) [-781.504] (-779.580) * (-781.990) (-788.738) [-780.369] (-780.105) -- 0:00:10
839500 -- (-781.805) [-780.760] (-778.792) (-779.063) * (-784.876) (-786.723) (-778.901) [-779.132] -- 0:00:10
840000 -- (-780.210) (-783.780) [-781.747] (-780.708) * (-780.308) (-782.514) [-780.239] (-779.357) -- 0:00:10
Average standard deviation of split frequencies: 0.008785
840500 -- (-780.287) (-783.268) (-781.321) [-780.525] * (-781.466) [-782.517] (-784.860) (-783.855) -- 0:00:10
841000 -- (-781.185) (-782.688) [-780.116] (-782.016) * [-780.088] (-780.232) (-779.257) (-781.455) -- 0:00:10
841500 -- (-783.354) (-782.094) (-781.358) [-780.340] * (-779.566) (-780.340) (-780.426) [-780.417] -- 0:00:09
842000 -- [-781.799] (-781.808) (-781.038) (-780.305) * [-779.968] (-782.183) (-781.540) (-781.284) -- 0:00:09
842500 -- [-781.002] (-779.423) (-780.601) (-781.968) * (-779.562) (-779.157) (-781.730) [-783.990] -- 0:00:09
843000 -- (-785.308) [-779.793] (-780.266) (-781.281) * [-781.084] (-782.795) (-781.735) (-779.663) -- 0:00:09
843500 -- [-779.459] (-780.386) (-782.567) (-783.159) * [-779.223] (-783.685) (-782.113) (-780.983) -- 0:00:09
844000 -- [-781.876] (-778.928) (-781.867) (-780.191) * [-780.269] (-783.112) (-784.576) (-779.179) -- 0:00:09
844500 -- (-779.856) (-783.279) [-782.443] (-781.603) * [-781.403] (-783.755) (-782.087) (-782.001) -- 0:00:09
845000 -- (-783.793) (-783.304) [-779.862] (-784.602) * [-783.445] (-781.485) (-781.756) (-779.595) -- 0:00:09
Average standard deviation of split frequencies: 0.008395
845500 -- (-783.185) (-781.114) (-780.531) [-784.674] * (-780.564) [-779.755] (-782.196) (-780.953) -- 0:00:09
846000 -- [-779.572] (-783.373) (-781.589) (-779.597) * (-780.724) (-778.857) (-781.080) [-780.847] -- 0:00:09
846500 -- (-779.438) (-786.361) [-781.341] (-780.731) * (-780.313) [-783.683] (-784.068) (-781.582) -- 0:00:09
847000 -- (-784.250) (-784.680) (-781.963) [-780.823] * (-782.724) (-779.836) (-780.081) [-778.483] -- 0:00:09
847500 -- (-778.803) (-784.335) (-781.523) [-779.719] * (-781.723) (-779.597) [-780.434] (-779.753) -- 0:00:09
848000 -- (-779.100) [-780.053] (-782.727) (-780.340) * (-784.844) (-780.140) (-780.320) [-780.352] -- 0:00:09
848500 -- (-779.275) (-778.819) (-781.546) [-781.000] * (-779.609) (-783.832) [-781.182] (-779.314) -- 0:00:09
849000 -- (-780.742) (-780.415) [-780.441] (-780.353) * (-783.928) (-780.765) (-781.329) [-779.653] -- 0:00:09
849500 -- (-781.625) (-779.293) [-779.672] (-779.580) * (-784.874) (-781.509) [-780.614] (-785.858) -- 0:00:09
850000 -- [-781.634] (-779.239) (-783.786) (-781.492) * (-780.846) (-780.944) (-781.990) [-785.834] -- 0:00:09
Average standard deviation of split frequencies: 0.008497
850500 -- (-783.591) (-779.549) (-784.802) [-781.929] * (-782.765) (-781.940) (-783.970) [-780.953] -- 0:00:09
851000 -- [-779.842] (-779.540) (-781.350) (-783.901) * (-779.808) [-783.865] (-781.580) (-779.259) -- 0:00:09
851500 -- (-779.527) (-782.598) [-779.828] (-782.961) * [-782.487] (-781.185) (-781.487) (-780.897) -- 0:00:09
852000 -- [-781.386] (-780.951) (-782.394) (-785.443) * (-785.564) [-783.231] (-780.436) (-782.628) -- 0:00:09
852500 -- [-781.848] (-782.084) (-785.266) (-781.968) * (-782.322) [-780.177] (-779.736) (-783.865) -- 0:00:09
853000 -- (-783.844) (-788.348) (-780.828) [-783.235] * (-779.727) (-782.608) (-779.944) [-781.956] -- 0:00:09
853500 -- (-779.561) (-780.356) [-779.339] (-781.154) * [-780.021] (-780.638) (-781.103) (-780.783) -- 0:00:09
854000 -- (-780.222) [-780.301] (-780.328) (-784.157) * (-780.912) (-780.455) (-779.905) [-783.091] -- 0:00:09
854500 -- (-780.488) (-780.501) [-781.969] (-786.141) * [-780.072] (-779.704) (-779.347) (-783.511) -- 0:00:09
855000 -- (-780.340) (-782.596) [-781.235] (-784.341) * (-783.018) (-785.237) [-782.924] (-783.391) -- 0:00:09
Average standard deviation of split frequencies: 0.008481
855500 -- (-780.161) (-782.472) [-779.408] (-780.352) * [-779.395] (-779.160) (-779.167) (-783.101) -- 0:00:09
856000 -- (-783.104) (-786.141) [-782.510] (-782.049) * (-780.750) [-780.489] (-779.730) (-778.854) -- 0:00:09
856500 -- (-779.238) [-782.258] (-782.014) (-780.188) * (-780.657) (-780.544) (-781.223) [-779.925] -- 0:00:09
857000 -- (-779.315) (-781.336) [-784.335] (-782.775) * [-779.821] (-780.455) (-781.568) (-779.953) -- 0:00:09
857500 -- (-780.898) [-779.664] (-779.874) (-783.886) * (-782.179) (-780.743) (-779.911) [-783.847] -- 0:00:08
858000 -- (-780.531) (-780.538) [-780.002] (-781.818) * (-779.487) [-780.798] (-787.773) (-782.293) -- 0:00:08
858500 -- (-781.405) (-780.455) [-779.885] (-782.042) * [-779.276] (-784.362) (-783.371) (-783.713) -- 0:00:08
859000 -- (-783.175) (-783.941) [-779.451] (-780.801) * [-779.191] (-779.827) (-781.343) (-782.876) -- 0:00:08
859500 -- (-780.697) (-779.093) (-780.630) [-778.888] * (-779.890) (-780.364) [-779.072] (-782.277) -- 0:00:08
860000 -- (-780.618) (-781.364) [-782.339] (-779.372) * (-780.399) (-780.593) [-781.511] (-779.423) -- 0:00:08
Average standard deviation of split frequencies: 0.008946
860500 -- (-783.265) [-781.447] (-783.072) (-782.697) * (-794.238) (-781.256) (-785.293) [-779.232] -- 0:00:08
861000 -- (-781.602) (-782.411) (-783.509) [-782.963] * (-787.204) (-785.148) [-785.282] (-781.037) -- 0:00:08
861500 -- (-781.175) (-781.388) [-782.056] (-781.351) * (-780.041) [-779.524] (-783.883) (-780.040) -- 0:00:08
862000 -- (-781.604) [-779.955] (-778.946) (-783.173) * (-779.563) [-780.485] (-783.680) (-783.509) -- 0:00:08
862500 -- (-782.062) (-779.501) (-780.567) [-781.776] * [-782.454] (-781.293) (-780.652) (-780.758) -- 0:00:08
863000 -- (-781.123) (-780.484) (-779.857) [-781.806] * (-779.858) [-782.305] (-786.339) (-782.326) -- 0:00:08
863500 -- (-780.821) (-782.251) [-783.303] (-782.384) * (-780.889) (-782.799) [-779.872] (-781.077) -- 0:00:08
864000 -- (-783.256) [-779.197] (-779.440) (-780.368) * [-783.860] (-780.093) (-783.527) (-780.100) -- 0:00:08
864500 -- [-780.221] (-779.687) (-780.530) (-778.966) * (-779.559) (-780.329) [-784.400] (-781.829) -- 0:00:08
865000 -- (-782.938) (-780.696) [-781.390] (-783.095) * [-779.203] (-782.695) (-780.068) (-783.588) -- 0:00:08
Average standard deviation of split frequencies: 0.008746
865500 -- (-778.959) [-783.357] (-780.054) (-782.025) * (-780.220) (-779.984) (-780.092) [-783.769] -- 0:00:08
866000 -- [-779.114] (-782.382) (-778.968) (-779.153) * (-782.369) [-780.038] (-781.965) (-779.305) -- 0:00:08
866500 -- (-781.355) [-779.893] (-779.871) (-788.635) * (-780.882) [-781.705] (-779.607) (-780.943) -- 0:00:08
867000 -- (-780.541) [-786.212] (-779.237) (-778.544) * (-782.695) [-781.292] (-782.898) (-779.949) -- 0:00:08
867500 -- (-780.137) (-780.810) (-778.760) [-779.252] * (-782.032) (-782.777) (-780.360) [-779.861] -- 0:00:08
868000 -- [-781.717] (-780.075) (-779.993) (-778.972) * [-778.638] (-782.307) (-780.515) (-780.201) -- 0:00:08
868500 -- (-780.056) (-782.104) [-782.240] (-781.112) * (-779.664) [-781.730] (-783.793) (-781.885) -- 0:00:08
869000 -- (-786.172) [-781.346] (-783.146) (-778.827) * (-779.234) [-780.654] (-781.065) (-783.642) -- 0:00:08
869500 -- [-780.658] (-784.000) (-781.479) (-779.146) * (-783.072) (-784.060) [-780.509] (-781.301) -- 0:00:08
870000 -- [-782.754] (-779.733) (-780.277) (-781.799) * (-787.104) (-783.810) [-780.855] (-782.253) -- 0:00:08
Average standard deviation of split frequencies: 0.008663
870500 -- (-781.967) [-778.919] (-779.743) (-780.442) * [-784.452] (-783.824) (-781.815) (-781.310) -- 0:00:08
871000 -- (-784.319) [-779.312] (-780.940) (-779.440) * [-782.949] (-780.946) (-779.979) (-783.769) -- 0:00:08
871500 -- (-781.040) (-779.990) [-781.172] (-782.222) * (-780.425) [-789.220] (-780.808) (-780.990) -- 0:00:08
872000 -- (-782.898) (-779.415) [-782.172] (-779.963) * (-782.374) (-780.435) (-784.511) [-781.544] -- 0:00:08
872500 -- (-782.098) [-781.819] (-780.492) (-782.810) * (-781.710) (-783.251) (-779.828) [-783.154] -- 0:00:08
873000 -- [-781.701] (-785.882) (-779.613) (-782.635) * (-780.785) (-781.320) [-779.534] (-781.864) -- 0:00:08
873500 -- (-780.094) [-781.078] (-781.253) (-781.291) * (-781.843) [-784.283] (-781.171) (-779.398) -- 0:00:07
874000 -- (-782.361) (-779.788) (-781.057) [-780.354] * (-780.553) [-783.240] (-783.962) (-781.069) -- 0:00:07
874500 -- [-780.049] (-781.013) (-781.898) (-781.688) * [-779.381] (-786.492) (-778.658) (-779.964) -- 0:00:07
875000 -- (-779.238) [-780.704] (-779.496) (-781.595) * [-781.228] (-785.066) (-778.658) (-780.062) -- 0:00:07
Average standard deviation of split frequencies: 0.008913
875500 -- (-782.023) (-784.386) (-781.910) [-783.013] * [-779.441] (-782.614) (-780.791) (-779.630) -- 0:00:07
876000 -- (-783.843) (-782.337) (-782.889) [-779.371] * (-781.591) (-779.928) (-782.153) [-779.301] -- 0:00:07
876500 -- (-783.140) (-781.787) [-780.303] (-782.234) * (-781.106) (-779.898) (-779.758) [-779.089] -- 0:00:07
877000 -- [-780.657] (-780.718) (-780.409) (-783.068) * [-779.732] (-788.333) (-781.038) (-780.056) -- 0:00:07
877500 -- (-779.757) (-782.609) (-781.999) [-779.341] * (-779.706) (-785.007) [-781.841] (-779.985) -- 0:00:07
878000 -- (-780.109) (-781.119) (-780.047) [-780.588] * (-782.689) (-780.696) [-780.058] (-781.954) -- 0:00:07
878500 -- [-781.170] (-780.686) (-780.990) (-779.845) * (-780.553) (-779.042) (-780.559) [-782.017] -- 0:00:07
879000 -- (-780.821) [-780.185] (-781.715) (-779.793) * [-780.315] (-780.014) (-779.441) (-779.438) -- 0:00:07
879500 -- (-781.414) (-780.182) (-783.704) [-779.979] * (-780.608) (-778.690) [-781.962] (-782.799) -- 0:00:07
880000 -- (-782.109) [-778.988] (-779.637) (-779.037) * (-781.001) (-784.629) (-780.094) [-778.910] -- 0:00:07
Average standard deviation of split frequencies: 0.008899
880500 -- (-781.351) (-781.016) [-781.269] (-780.624) * (-782.808) (-782.983) [-780.492] (-779.421) -- 0:00:07
881000 -- (-782.529) (-779.272) (-782.372) [-780.624] * (-780.127) (-780.789) [-781.411] (-782.374) -- 0:00:07
881500 -- (-780.136) (-779.426) (-780.696) [-780.705] * (-783.728) [-781.302] (-781.110) (-778.983) -- 0:00:07
882000 -- (-779.712) (-779.513) (-781.289) [-779.941] * (-785.990) (-780.727) (-779.938) [-779.838] -- 0:00:07
882500 -- (-779.899) (-781.386) (-780.992) [-780.346] * (-780.139) [-781.990] (-782.813) (-782.612) -- 0:00:07
883000 -- [-779.904] (-779.122) (-780.018) (-781.423) * (-778.887) [-781.352] (-780.582) (-780.278) -- 0:00:07
883500 -- (-778.676) (-782.855) [-781.419] (-782.149) * (-780.448) [-779.574] (-781.898) (-781.668) -- 0:00:07
884000 -- [-778.553] (-781.773) (-779.786) (-784.218) * (-781.824) [-779.944] (-783.102) (-781.100) -- 0:00:07
884500 -- (-778.605) (-784.079) [-781.576] (-782.048) * [-783.809] (-779.651) (-779.649) (-779.803) -- 0:00:07
885000 -- (-782.477) (-779.606) (-785.673) [-779.519] * (-779.956) (-785.009) (-779.546) [-778.649] -- 0:00:07
Average standard deviation of split frequencies: 0.008480
885500 -- (-780.908) [-781.238] (-784.364) (-781.685) * (-783.437) (-782.169) [-779.567] (-779.413) -- 0:00:07
886000 -- (-780.262) [-780.428] (-781.690) (-780.761) * (-779.683) (-780.104) (-779.873) [-781.649] -- 0:00:07
886500 -- (-780.508) (-780.193) [-782.335] (-778.774) * (-781.940) [-781.172] (-779.870) (-781.287) -- 0:00:07
887000 -- (-780.966) (-782.608) [-781.378] (-778.708) * (-781.963) (-780.198) [-780.651] (-780.441) -- 0:00:07
887500 -- (-781.722) (-779.289) [-779.179] (-778.883) * [-779.872] (-779.059) (-781.279) (-780.278) -- 0:00:07
888000 -- [-780.431] (-778.633) (-780.968) (-782.858) * (-781.655) (-780.112) (-784.338) [-782.694] -- 0:00:07
888500 -- [-779.937] (-780.087) (-780.901) (-780.753) * (-780.345) (-781.670) (-780.870) [-779.937] -- 0:00:07
889000 -- (-780.273) (-778.949) (-778.895) [-780.934] * (-781.773) (-782.337) [-780.978] (-780.529) -- 0:00:06
889500 -- [-781.493] (-779.931) (-780.709) (-781.256) * (-785.646) (-780.974) [-779.367] (-780.304) -- 0:00:06
890000 -- [-783.278] (-780.203) (-781.071) (-780.259) * (-784.244) [-778.903] (-779.940) (-782.375) -- 0:00:06
Average standard deviation of split frequencies: 0.008115
890500 -- (-782.761) (-783.372) [-782.079] (-784.372) * (-783.564) (-780.787) (-780.394) [-781.351] -- 0:00:06
891000 -- [-779.858] (-783.580) (-783.849) (-780.605) * (-785.326) (-780.097) (-781.287) [-781.213] -- 0:00:06
891500 -- [-780.402] (-782.528) (-782.843) (-780.158) * (-781.022) (-780.508) [-781.677] (-780.332) -- 0:00:06
892000 -- [-780.695] (-780.616) (-782.221) (-781.628) * (-787.189) (-780.551) [-783.857] (-779.299) -- 0:00:06
892500 -- [-782.243] (-781.189) (-780.581) (-780.130) * (-780.623) (-779.553) (-781.630) [-781.304] -- 0:00:06
893000 -- (-785.774) [-780.579] (-779.609) (-785.070) * [-780.365] (-778.843) (-779.902) (-779.533) -- 0:00:06
893500 -- (-786.970) (-782.287) [-782.067] (-784.648) * [-779.651] (-779.833) (-784.254) (-782.910) -- 0:00:06
894000 -- (-784.892) (-780.279) [-780.080] (-779.194) * [-782.934] (-779.043) (-784.946) (-783.740) -- 0:00:06
894500 -- (-782.913) [-779.473] (-780.397) (-779.714) * (-782.293) (-780.509) (-782.593) [-781.231] -- 0:00:06
895000 -- (-779.414) (-780.336) [-780.377] (-779.743) * (-781.559) (-780.428) (-784.993) [-781.439] -- 0:00:06
Average standard deviation of split frequencies: 0.008451
895500 -- [-781.919] (-780.875) (-781.917) (-780.852) * [-779.660] (-781.067) (-779.215) (-779.381) -- 0:00:06
896000 -- [-782.300] (-783.546) (-779.699) (-780.319) * (-780.061) (-783.238) [-779.519] (-786.132) -- 0:00:06
896500 -- [-781.423] (-782.456) (-782.643) (-781.197) * [-779.224] (-785.841) (-782.776) (-782.606) -- 0:00:06
897000 -- (-782.691) (-779.165) (-780.400) [-780.702] * (-779.554) (-780.604) [-779.658] (-782.854) -- 0:00:06
897500 -- (-782.142) (-779.821) [-780.093] (-781.827) * (-779.883) (-784.060) [-780.170] (-783.038) -- 0:00:06
898000 -- (-781.686) (-780.365) [-779.653] (-785.908) * [-780.930] (-779.555) (-781.683) (-780.864) -- 0:00:06
898500 -- [-781.716] (-781.343) (-780.114) (-780.974) * [-782.162] (-779.304) (-779.532) (-780.792) -- 0:00:06
899000 -- (-781.017) [-780.496] (-779.208) (-780.864) * (-779.108) (-782.247) (-782.344) [-782.791] -- 0:00:06
899500 -- [-779.201] (-780.293) (-783.332) (-781.439) * (-780.066) (-786.321) (-779.880) [-779.307] -- 0:00:06
900000 -- (-781.031) [-779.511] (-783.151) (-779.928) * [-779.746] (-781.073) (-780.105) (-779.851) -- 0:00:06
Average standard deviation of split frequencies: 0.008734
900500 -- [-782.473] (-780.969) (-783.200) (-781.554) * (-779.933) (-780.278) [-781.090] (-780.690) -- 0:00:06
901000 -- (-782.406) (-780.672) (-780.139) [-779.421] * [-783.145] (-780.354) (-780.024) (-778.764) -- 0:00:06
901500 -- (-780.426) (-781.095) [-780.988] (-786.969) * (-785.581) (-781.311) (-780.483) [-778.887] -- 0:00:06
902000 -- (-779.787) (-783.425) (-779.324) [-779.660] * (-782.012) (-779.484) (-783.544) [-779.126] -- 0:00:06
902500 -- (-781.474) (-782.032) (-781.655) [-782.528] * (-780.194) (-785.067) [-783.157] (-781.570) -- 0:00:06
903000 -- (-779.817) (-780.041) (-780.095) [-780.489] * [-780.018] (-780.033) (-780.979) (-783.213) -- 0:00:06
903500 -- (-781.571) (-779.222) (-781.154) [-781.100] * (-781.773) [-779.719] (-782.131) (-780.958) -- 0:00:06
904000 -- (-782.052) (-784.829) (-782.888) [-779.889] * (-780.712) (-781.429) (-781.280) [-781.176] -- 0:00:06
904500 -- (-781.235) (-781.519) (-781.632) [-780.758] * (-780.542) [-779.400] (-780.844) (-788.246) -- 0:00:06
905000 -- (-782.872) [-782.968] (-780.535) (-782.637) * (-780.117) [-782.960] (-785.568) (-785.290) -- 0:00:05
Average standard deviation of split frequencies: 0.008748
905500 -- [-782.576] (-780.216) (-779.250) (-784.171) * (-779.429) (-780.646) (-788.200) [-781.231] -- 0:00:05
906000 -- (-783.696) (-784.715) [-779.522] (-783.755) * [-782.353] (-779.193) (-784.422) (-781.971) -- 0:00:05
906500 -- (-782.209) [-779.589] (-779.925) (-785.268) * (-780.873) (-782.989) [-781.998] (-781.854) -- 0:00:05
907000 -- (-781.238) (-780.928) (-783.602) [-782.579] * [-781.644] (-786.631) (-780.358) (-785.401) -- 0:00:05
907500 -- (-789.815) (-781.094) (-783.574) [-779.325] * (-780.997) (-785.270) [-782.049] (-780.699) -- 0:00:05
908000 -- (-781.667) [-780.336] (-781.392) (-782.112) * (-779.844) (-783.507) (-783.500) [-779.261] -- 0:00:05
908500 -- (-781.000) [-781.591] (-780.559) (-781.873) * [-778.475] (-785.928) (-781.057) (-780.294) -- 0:00:05
909000 -- (-781.765) (-781.984) [-778.670] (-779.553) * [-779.726] (-782.443) (-782.001) (-782.568) -- 0:00:05
909500 -- [-780.005] (-784.476) (-780.406) (-783.430) * (-783.366) (-781.780) (-783.717) [-784.678] -- 0:00:05
910000 -- (-779.670) (-784.460) (-790.534) [-782.618] * [-779.187] (-782.977) (-780.022) (-780.128) -- 0:00:05
Average standard deviation of split frequencies: 0.008509
910500 -- (-782.338) (-783.921) [-779.290] (-782.096) * (-779.130) [-782.856] (-781.893) (-785.424) -- 0:00:05
911000 -- [-781.434] (-779.582) (-783.572) (-780.671) * (-781.260) (-781.918) (-780.783) [-784.714] -- 0:00:05
911500 -- (-780.666) (-783.801) (-783.770) [-780.993] * (-779.782) (-781.117) [-778.942] (-783.666) -- 0:00:05
912000 -- (-780.691) [-780.388] (-780.253) (-780.754) * [-780.571] (-779.921) (-783.403) (-781.073) -- 0:00:05
912500 -- (-781.342) (-780.779) [-780.249] (-780.604) * (-779.484) (-781.603) [-780.824] (-780.459) -- 0:00:05
913000 -- [-779.654] (-779.064) (-780.610) (-781.823) * (-779.471) [-782.053] (-782.155) (-781.938) -- 0:00:05
913500 -- [-779.627] (-782.351) (-778.928) (-779.289) * (-785.073) [-780.852] (-781.207) (-780.339) -- 0:00:05
914000 -- (-779.458) [-782.169] (-778.896) (-780.830) * (-782.042) (-780.317) [-781.081] (-785.586) -- 0:00:05
914500 -- (-779.223) (-779.322) [-779.146] (-780.522) * (-780.136) (-781.798) [-780.326] (-786.137) -- 0:00:05
915000 -- (-779.491) (-782.435) [-781.101] (-785.217) * [-782.122] (-780.300) (-780.494) (-779.457) -- 0:00:05
Average standard deviation of split frequencies: 0.008200
915500 -- [-779.219] (-780.962) (-781.446) (-784.644) * (-779.605) (-779.677) [-779.686] (-779.799) -- 0:00:05
916000 -- (-779.908) (-780.208) (-782.363) [-781.898] * (-779.733) (-780.802) (-780.093) [-781.186] -- 0:00:05
916500 -- (-784.943) [-781.882] (-778.970) (-779.048) * (-780.914) [-780.639] (-780.282) (-782.234) -- 0:00:05
917000 -- (-783.686) (-782.810) [-780.279] (-781.815) * (-780.051) (-779.591) [-781.122] (-782.357) -- 0:00:05
917500 -- [-781.535] (-780.081) (-780.400) (-779.683) * (-780.773) (-781.238) [-780.380] (-782.407) -- 0:00:05
918000 -- (-781.025) (-780.041) (-780.455) [-780.770] * (-779.140) (-783.653) (-779.655) [-780.440] -- 0:00:05
918500 -- (-780.546) (-778.944) [-779.621] (-781.796) * [-782.664] (-783.080) (-781.368) (-779.428) -- 0:00:05
919000 -- [-780.283] (-779.384) (-780.413) (-781.658) * [-789.206] (-780.512) (-781.236) (-782.533) -- 0:00:05
919500 -- (-781.474) [-780.073] (-781.740) (-780.574) * [-782.217] (-782.002) (-779.692) (-779.734) -- 0:00:05
920000 -- [-780.833] (-780.652) (-780.698) (-781.080) * (-781.076) (-783.445) (-782.102) [-779.527] -- 0:00:05
Average standard deviation of split frequencies: 0.008295
920500 -- (-781.090) (-784.555) [-783.060] (-779.792) * (-780.034) (-784.431) (-781.968) [-779.031] -- 0:00:05
921000 -- (-780.158) (-782.076) (-781.620) [-782.436] * (-779.385) (-780.847) [-781.297] (-781.615) -- 0:00:04
921500 -- (-783.185) (-781.467) (-782.014) [-780.488] * (-783.131) [-778.640] (-783.467) (-780.758) -- 0:00:04
922000 -- (-780.877) (-782.155) [-781.577] (-779.491) * (-784.664) (-780.660) (-780.240) [-780.592] -- 0:00:04
922500 -- (-780.965) (-783.047) [-780.127] (-781.263) * (-784.773) [-782.549] (-780.348) (-780.992) -- 0:00:04
923000 -- [-782.989] (-780.561) (-780.674) (-781.219) * (-781.565) (-783.294) (-781.173) [-781.204] -- 0:00:04
923500 -- [-782.031] (-779.690) (-779.231) (-781.795) * [-782.392] (-782.954) (-779.598) (-779.960) -- 0:00:04
924000 -- (-781.124) [-779.394] (-780.959) (-779.929) * (-785.703) (-779.772) [-780.791] (-779.282) -- 0:00:04
924500 -- [-783.634] (-780.683) (-781.580) (-779.778) * (-780.612) (-780.908) [-781.410] (-785.415) -- 0:00:04
925000 -- [-781.323] (-780.268) (-781.092) (-781.400) * (-781.377) [-781.792] (-781.883) (-782.717) -- 0:00:04
Average standard deviation of split frequencies: 0.008009
925500 -- (-781.337) (-782.479) [-779.183] (-784.983) * (-783.326) (-781.521) (-780.268) [-781.598] -- 0:00:04
926000 -- (-779.850) (-787.033) (-781.041) [-782.519] * (-782.736) [-783.835] (-782.271) (-782.364) -- 0:00:04
926500 -- (-779.137) (-779.677) [-782.302] (-782.735) * (-780.879) (-778.920) (-783.445) [-783.398] -- 0:00:04
927000 -- (-781.097) (-781.075) [-780.696] (-780.596) * (-782.488) (-778.885) [-779.518] (-784.326) -- 0:00:04
927500 -- (-780.141) [-779.249] (-780.955) (-781.896) * (-780.688) (-780.094) (-779.579) [-784.407] -- 0:00:04
928000 -- (-783.023) (-778.753) (-779.738) [-782.394] * (-779.834) [-780.955] (-780.693) (-783.273) -- 0:00:04
928500 -- (-779.781) (-780.018) (-779.772) [-781.282] * (-780.147) (-778.998) [-781.466] (-782.278) -- 0:00:04
929000 -- (-781.298) [-782.114] (-782.480) (-786.137) * (-780.129) (-778.899) (-781.126) [-782.234] -- 0:00:04
929500 -- (-778.813) (-781.863) [-780.764] (-780.737) * [-781.234] (-780.321) (-779.685) (-780.327) -- 0:00:04
930000 -- (-779.862) (-789.466) (-781.259) [-781.389] * (-782.508) [-782.699] (-780.121) (-780.952) -- 0:00:04
Average standard deviation of split frequencies: 0.007902
930500 -- [-780.260] (-782.458) (-780.573) (-780.083) * [-781.334] (-781.457) (-778.969) (-779.429) -- 0:00:04
931000 -- (-782.498) (-781.809) (-779.716) [-782.926] * (-781.230) [-779.030] (-780.170) (-779.176) -- 0:00:04
931500 -- (-784.233) (-786.023) [-779.525] (-783.643) * (-781.794) (-779.613) (-778.944) [-779.718] -- 0:00:04
932000 -- (-783.703) (-782.794) [-779.422] (-780.519) * (-779.360) (-781.895) (-780.355) [-779.268] -- 0:00:04
932500 -- (-779.903) (-785.286) [-779.795] (-779.337) * [-780.385] (-782.238) (-780.690) (-782.076) -- 0:00:04
933000 -- (-784.391) [-783.675] (-784.968) (-780.789) * (-779.722) (-780.615) [-778.922] (-779.739) -- 0:00:04
933500 -- (-782.591) (-782.575) (-782.821) [-779.331] * (-781.815) (-780.707) [-781.120] (-787.412) -- 0:00:04
934000 -- [-781.036] (-779.735) (-781.048) (-780.792) * (-779.605) [-780.859] (-781.880) (-782.621) -- 0:00:04
934500 -- (-779.095) (-779.699) [-782.697] (-781.920) * (-784.561) (-779.479) (-782.006) [-781.602] -- 0:00:04
935000 -- (-780.951) [-779.877] (-780.231) (-781.071) * (-783.175) (-784.100) [-782.898] (-780.178) -- 0:00:04
Average standard deviation of split frequencies: 0.007756
935500 -- [-781.406] (-779.859) (-779.096) (-781.838) * (-779.745) [-783.719] (-781.052) (-784.094) -- 0:00:04
936000 -- [-780.986] (-780.543) (-780.352) (-781.036) * (-779.490) (-780.493) (-780.135) [-781.499] -- 0:00:04
936500 -- (-779.925) (-781.347) [-783.249] (-780.043) * [-780.106] (-782.769) (-779.018) (-781.790) -- 0:00:04
937000 -- [-778.889] (-781.197) (-780.010) (-780.414) * (-781.816) (-782.028) (-779.289) [-783.497] -- 0:00:03
937500 -- (-779.121) (-784.724) (-781.266) [-779.769] * (-781.509) (-779.452) [-781.147] (-783.925) -- 0:00:03
938000 -- (-780.830) (-782.279) [-780.411] (-784.090) * (-781.621) [-779.440] (-779.905) (-780.215) -- 0:00:03
938500 -- (-779.573) (-780.581) [-779.267] (-780.361) * (-784.627) (-780.611) (-779.384) [-781.925] -- 0:00:03
939000 -- [-781.802] (-779.118) (-779.129) (-782.064) * (-787.323) (-779.725) (-779.788) [-780.843] -- 0:00:03
939500 -- (-779.884) [-781.682] (-781.125) (-781.779) * (-779.704) [-779.630] (-781.391) (-780.384) -- 0:00:03
940000 -- (-780.232) (-780.161) [-779.984] (-779.687) * (-780.019) (-780.236) [-781.513] (-784.748) -- 0:00:03
Average standard deviation of split frequencies: 0.007718
940500 -- [-778.984] (-781.939) (-780.016) (-782.388) * [-779.753] (-779.924) (-781.500) (-783.757) -- 0:00:03
941000 -- (-784.445) (-780.396) [-780.384] (-779.361) * (-783.474) [-780.875] (-781.929) (-783.709) -- 0:00:03
941500 -- (-781.898) (-779.940) (-781.147) [-780.080] * [-784.043] (-782.009) (-779.984) (-779.686) -- 0:00:03
942000 -- (-780.189) [-783.595] (-779.797) (-779.956) * (-782.164) (-786.769) (-782.088) [-781.074] -- 0:00:03
942500 -- [-779.849] (-781.841) (-782.075) (-782.634) * (-781.268) (-780.805) (-782.065) [-782.081] -- 0:00:03
943000 -- (-780.110) (-781.451) (-780.523) [-780.291] * [-781.754] (-780.889) (-779.057) (-779.623) -- 0:00:03
943500 -- (-780.003) (-780.100) [-781.100] (-785.615) * (-781.836) (-780.281) [-779.085] (-782.936) -- 0:00:03
944000 -- (-780.230) (-783.890) [-780.721] (-783.195) * (-782.290) (-784.998) (-781.245) [-779.912] -- 0:00:03
944500 -- (-779.255) (-782.254) [-779.651] (-781.553) * [-780.257] (-781.216) (-779.912) (-781.084) -- 0:00:03
945000 -- (-782.127) (-779.098) (-780.123) [-779.336] * (-781.190) (-784.045) (-784.154) [-781.055] -- 0:00:03
Average standard deviation of split frequencies: 0.007242
945500 -- (-780.666) [-781.229] (-780.406) (-779.000) * (-781.992) [-780.176] (-781.379) (-780.692) -- 0:00:03
946000 -- (-780.738) (-779.599) (-782.638) [-778.686] * (-779.246) (-781.683) [-779.785] (-782.467) -- 0:00:03
946500 -- (-781.450) (-780.499) (-780.992) [-779.023] * [-781.703] (-780.633) (-779.069) (-782.182) -- 0:00:03
947000 -- [-778.675] (-778.998) (-783.008) (-778.937) * [-780.872] (-781.808) (-779.062) (-780.286) -- 0:00:03
947500 -- (-780.050) (-780.735) [-778.921] (-781.374) * (-781.373) (-783.589) (-780.519) [-779.628] -- 0:00:03
948000 -- (-779.708) [-779.621] (-779.823) (-780.356) * (-781.815) (-781.935) [-779.214] (-781.423) -- 0:00:03
948500 -- (-779.558) (-781.519) (-781.822) [-781.202] * (-781.916) (-782.260) (-779.215) [-779.734] -- 0:00:03
949000 -- (-779.151) [-783.542] (-781.752) (-781.203) * [-779.933] (-780.369) (-782.881) (-779.502) -- 0:00:03
949500 -- (-779.077) (-779.846) [-780.095] (-778.514) * (-779.886) (-781.033) [-782.694] (-781.137) -- 0:00:03
950000 -- [-780.161] (-779.438) (-779.409) (-780.192) * (-779.427) [-779.673] (-783.149) (-784.944) -- 0:00:03
Average standard deviation of split frequencies: 0.007273
950500 -- [-781.453] (-780.901) (-783.725) (-779.301) * (-781.837) [-786.883] (-784.459) (-780.534) -- 0:00:03
951000 -- (-783.240) (-782.432) (-779.939) [-781.081] * (-780.879) [-779.306] (-783.978) (-781.733) -- 0:00:03
951500 -- [-782.273] (-779.941) (-779.939) (-781.114) * [-779.332] (-779.856) (-782.401) (-778.792) -- 0:00:03
952000 -- (-780.587) (-781.804) [-781.763] (-780.060) * (-779.195) (-779.852) [-779.577] (-781.183) -- 0:00:03
952500 -- (-779.409) (-781.456) (-779.450) [-779.726] * (-779.409) [-780.176] (-780.060) (-779.461) -- 0:00:02
953000 -- (-779.812) (-781.432) (-785.083) [-780.385] * (-779.810) (-780.068) [-781.011] (-779.234) -- 0:00:02
953500 -- (-780.333) (-785.164) [-782.604] (-779.672) * (-781.386) (-780.079) [-780.421] (-781.774) -- 0:00:02
954000 -- (-780.646) (-781.127) (-779.701) [-779.588] * (-781.266) (-781.453) (-779.460) [-781.633] -- 0:00:02
954500 -- (-779.059) (-779.909) (-778.561) [-780.798] * (-782.457) (-784.028) (-780.933) [-782.634] -- 0:00:02
955000 -- (-781.948) (-780.508) (-779.370) [-781.512] * [-785.095] (-781.186) (-780.655) (-782.490) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
955500 -- (-779.128) (-780.351) (-782.174) [-782.757] * (-784.512) (-779.291) (-782.054) [-781.444] -- 0:00:02
956000 -- (-780.334) (-779.480) [-784.824] (-781.338) * (-780.673) [-781.324] (-780.624) (-782.122) -- 0:00:02
956500 -- (-781.643) [-782.829] (-782.646) (-783.961) * (-782.159) (-781.014) [-782.996] (-781.652) -- 0:00:02
957000 -- (-784.973) [-779.335] (-781.943) (-779.357) * (-781.512) (-785.524) [-781.159] (-785.741) -- 0:00:02
957500 -- (-783.338) [-779.368] (-783.712) (-781.060) * (-782.253) [-780.997] (-780.941) (-783.125) -- 0:00:02
958000 -- (-779.571) (-780.878) [-780.271] (-783.278) * (-781.366) [-779.451] (-779.271) (-781.776) -- 0:00:02
958500 -- (-782.238) (-780.602) [-779.893] (-781.829) * (-779.475) (-784.207) [-778.838] (-781.766) -- 0:00:02
959000 -- (-780.846) (-780.221) [-781.139] (-784.640) * [-778.766] (-779.748) (-781.635) (-780.804) -- 0:00:02
959500 -- (-778.932) [-781.476] (-780.795) (-781.712) * [-779.595] (-781.402) (-782.380) (-780.937) -- 0:00:02
960000 -- (-779.254) (-782.099) [-779.255] (-779.651) * (-781.067) (-779.875) (-779.446) [-782.563] -- 0:00:02
Average standard deviation of split frequencies: 0.006935
960500 -- (-781.626) (-782.759) (-781.485) [-783.529] * (-779.182) (-780.637) (-780.481) [-779.846] -- 0:00:02
961000 -- [-779.793] (-782.610) (-779.251) (-782.249) * (-778.987) [-779.857] (-779.793) (-781.675) -- 0:00:02
961500 -- [-780.252] (-781.259) (-784.211) (-780.765) * (-781.248) (-781.906) (-781.551) [-781.586] -- 0:00:02
962000 -- (-781.385) (-782.872) (-781.164) [-780.640] * [-781.111] (-780.170) (-783.625) (-781.729) -- 0:00:02
962500 -- (-779.779) (-779.598) (-782.127) [-781.923] * (-779.174) (-780.641) (-783.003) [-780.297] -- 0:00:02
963000 -- [-782.632] (-779.491) (-780.974) (-781.110) * [-778.845] (-780.612) (-785.279) (-783.045) -- 0:00:02
963500 -- [-779.831] (-781.249) (-781.181) (-781.142) * (-784.557) (-779.765) [-780.920] (-780.121) -- 0:00:02
964000 -- (-783.147) (-785.788) [-780.086] (-782.470) * (-781.259) [-781.601] (-780.422) (-781.008) -- 0:00:02
964500 -- (-785.118) [-785.195] (-781.321) (-781.596) * [-779.664] (-783.942) (-783.996) (-782.507) -- 0:00:02
965000 -- (-783.835) (-783.886) [-782.012] (-779.613) * [-779.624] (-784.638) (-780.385) (-784.371) -- 0:00:02
Average standard deviation of split frequencies: 0.007125
965500 -- (-785.200) (-779.667) (-786.793) [-782.987] * (-780.819) [-779.297] (-779.349) (-785.871) -- 0:00:02
966000 -- (-780.160) [-779.259] (-779.616) (-781.923) * (-781.056) [-779.787] (-781.374) (-781.764) -- 0:00:02
966500 -- (-778.880) (-779.686) [-780.069] (-786.876) * [-779.016] (-780.427) (-781.335) (-783.011) -- 0:00:02
967000 -- (-778.898) (-779.636) [-784.067] (-786.607) * (-778.989) [-779.714] (-782.625) (-784.308) -- 0:00:02
967500 -- (-784.114) (-782.703) [-782.506] (-782.205) * (-779.645) (-780.381) (-783.007) [-781.841] -- 0:00:02
968000 -- (-783.209) (-783.478) [-781.387] (-779.885) * (-780.860) (-781.913) (-783.711) [-779.928] -- 0:00:02
968500 -- (-783.409) (-782.042) (-780.780) [-780.827] * [-784.195] (-780.499) (-779.415) (-781.425) -- 0:00:01
969000 -- [-782.170] (-780.135) (-786.766) (-781.707) * [-783.597] (-780.052) (-782.354) (-780.271) -- 0:00:01
969500 -- (-782.846) [-779.653] (-780.163) (-779.437) * (-780.471) [-780.758] (-781.896) (-782.035) -- 0:00:01
970000 -- (-779.833) [-780.779] (-779.397) (-785.858) * (-781.453) (-781.747) [-782.598] (-781.298) -- 0:00:01
Average standard deviation of split frequencies: 0.006864
970500 -- (-783.847) (-782.178) (-778.844) [-780.170] * (-784.245) (-779.547) (-783.878) [-781.656] -- 0:00:01
971000 -- (-779.556) [-780.332] (-781.190) (-780.728) * (-781.382) (-779.078) [-780.421] (-781.378) -- 0:00:01
971500 -- (-781.766) [-779.436] (-782.873) (-781.918) * (-783.396) (-780.733) (-779.755) [-779.193] -- 0:00:01
972000 -- (-782.190) (-781.453) (-779.899) [-779.924] * (-779.521) (-783.170) (-781.107) [-778.923] -- 0:00:01
972500 -- (-782.380) [-780.978] (-781.149) (-782.631) * (-780.705) [-780.510] (-779.590) (-780.531) -- 0:00:01
973000 -- (-780.368) (-782.433) [-782.273] (-781.216) * (-780.059) (-781.112) [-780.466] (-782.138) -- 0:00:01
973500 -- (-780.666) [-781.438] (-781.976) (-779.112) * (-781.393) [-781.938] (-778.731) (-780.980) -- 0:00:01
974000 -- [-781.549] (-784.844) (-782.430) (-783.214) * [-781.235] (-781.041) (-779.884) (-782.710) -- 0:00:01
974500 -- (-781.362) (-780.405) (-781.517) [-782.254] * (-780.792) [-781.138] (-781.036) (-780.684) -- 0:00:01
975000 -- [-781.751] (-781.411) (-781.058) (-783.527) * (-780.874) (-781.960) [-780.631] (-782.279) -- 0:00:01
Average standard deviation of split frequencies: 0.007213
975500 -- [-779.514] (-783.209) (-782.122) (-779.573) * (-779.217) (-785.192) [-780.384] (-779.937) -- 0:00:01
976000 -- (-781.477) (-781.903) (-780.990) [-784.239] * (-779.789) (-779.756) [-779.190] (-779.277) -- 0:00:01
976500 -- (-782.410) (-780.926) [-779.244] (-783.087) * (-786.024) [-780.950] (-781.548) (-780.318) -- 0:00:01
977000 -- (-779.844) [-779.324] (-779.510) (-784.459) * (-780.543) (-779.372) [-779.721] (-781.146) -- 0:00:01
977500 -- [-781.812] (-779.005) (-779.486) (-783.916) * (-780.187) (-783.176) (-783.640) [-783.474] -- 0:00:01
978000 -- [-780.903] (-785.170) (-782.740) (-781.448) * [-782.210] (-780.617) (-779.549) (-781.115) -- 0:00:01
978500 -- (-781.060) [-780.785] (-780.791) (-781.570) * [-783.498] (-780.497) (-781.913) (-781.953) -- 0:00:01
979000 -- [-780.958] (-779.662) (-779.480) (-784.679) * [-778.877] (-780.092) (-782.538) (-778.776) -- 0:00:01
979500 -- (-780.245) [-779.438] (-782.326) (-778.965) * (-778.889) [-779.608] (-781.766) (-779.042) -- 0:00:01
980000 -- (-779.130) (-786.958) [-781.089] (-779.043) * (-781.557) (-779.957) [-781.493] (-779.037) -- 0:00:01
Average standard deviation of split frequencies: 0.007691
980500 -- (-779.432) [-779.605] (-779.575) (-779.929) * (-781.524) (-780.333) (-780.363) [-780.713] -- 0:00:01
981000 -- (-782.239) (-780.685) (-780.422) [-778.539] * (-781.819) [-780.917] (-779.048) (-780.727) -- 0:00:01
981500 -- (-783.123) [-782.298] (-782.097) (-778.845) * (-786.330) (-781.464) [-780.484] (-782.301) -- 0:00:01
982000 -- (-782.979) (-783.018) (-781.355) [-782.687] * (-779.062) (-781.759) (-779.520) [-780.812] -- 0:00:01
982500 -- (-782.515) (-782.730) (-780.425) [-780.912] * (-779.109) (-779.528) (-779.050) [-782.082] -- 0:00:01
983000 -- (-782.390) [-781.271] (-783.182) (-782.139) * [-780.725] (-781.599) (-780.899) (-781.420) -- 0:00:01
983500 -- [-779.699] (-782.626) (-782.678) (-782.024) * (-778.957) [-779.142] (-778.693) (-780.040) -- 0:00:01
984000 -- (-783.995) [-781.377] (-783.377) (-781.175) * (-779.425) [-779.470] (-780.158) (-780.706) -- 0:00:01
984500 -- (-783.950) [-780.044] (-783.691) (-780.935) * (-779.283) (-779.739) [-785.749] (-779.787) -- 0:00:00
985000 -- (-782.490) (-783.123) (-780.654) [-779.608] * [-780.223] (-779.464) (-780.733) (-781.636) -- 0:00:00
Average standard deviation of split frequencies: 0.007618
985500 -- [-780.105] (-779.833) (-780.928) (-779.688) * [-784.454] (-782.462) (-781.581) (-779.411) -- 0:00:00
986000 -- (-781.266) (-780.079) [-780.823] (-781.689) * (-781.552) [-779.861] (-782.158) (-780.252) -- 0:00:00
986500 -- (-780.088) (-780.357) [-781.903] (-782.734) * (-781.947) [-779.866] (-782.094) (-780.135) -- 0:00:00
987000 -- [-779.973] (-780.229) (-785.655) (-780.251) * [-779.230] (-780.969) (-780.390) (-779.798) -- 0:00:00
987500 -- (-782.035) (-783.059) (-779.417) [-781.054] * (-778.944) (-780.202) (-781.679) [-779.003] -- 0:00:00
988000 -- [-779.260] (-781.909) (-783.343) (-781.044) * (-781.274) (-780.853) [-780.786] (-783.843) -- 0:00:00
988500 -- (-779.012) (-780.479) [-778.702] (-781.060) * [-782.395] (-781.629) (-779.816) (-781.753) -- 0:00:00
989000 -- [-779.252] (-779.622) (-779.068) (-784.078) * (-779.938) (-782.263) [-778.719] (-779.564) -- 0:00:00
989500 -- (-784.312) [-779.437] (-779.468) (-782.063) * [-780.185] (-782.313) (-779.310) (-780.354) -- 0:00:00
990000 -- (-780.200) (-781.902) [-778.936] (-779.326) * (-779.300) (-781.237) [-779.175] (-780.281) -- 0:00:00
Average standard deviation of split frequencies: 0.007899
990500 -- (-782.378) (-779.747) [-779.437] (-780.122) * [-780.789] (-781.357) (-780.350) (-781.666) -- 0:00:00
991000 -- (-782.458) [-780.460] (-780.327) (-780.208) * (-782.182) [-780.373] (-780.308) (-782.207) -- 0:00:00
991500 -- (-779.951) (-780.914) [-780.437] (-779.814) * [-781.626] (-780.553) (-779.991) (-784.719) -- 0:00:00
992000 -- (-781.300) (-778.766) [-780.825] (-780.159) * (-783.894) (-780.218) [-780.103] (-779.818) -- 0:00:00
992500 -- (-780.580) [-779.701] (-779.042) (-780.696) * (-783.316) (-781.204) [-779.418] (-781.999) -- 0:00:00
993000 -- (-782.659) (-781.598) (-779.807) [-778.835] * (-782.298) (-780.213) [-781.134] (-783.093) -- 0:00:00
993500 -- (-782.629) (-783.438) (-779.511) [-779.500] * (-779.009) [-779.891] (-782.067) (-781.228) -- 0:00:00
994000 -- (-782.520) (-779.536) (-780.170) [-779.056] * (-779.723) (-780.990) (-783.730) [-780.980] -- 0:00:00
994500 -- [-779.594] (-779.364) (-779.959) (-785.312) * (-779.867) [-782.820] (-791.260) (-779.733) -- 0:00:00
995000 -- [-779.872] (-779.999) (-783.610) (-788.887) * [-782.268] (-781.672) (-780.486) (-780.344) -- 0:00:00
Average standard deviation of split frequencies: 0.007699
995500 -- (-780.432) (-780.596) [-780.743] (-784.102) * (-784.935) (-781.947) [-779.104] (-781.297) -- 0:00:00
996000 -- (-783.262) (-781.578) (-779.910) [-783.327] * (-783.891) (-780.960) (-782.239) [-780.364] -- 0:00:00
996500 -- (-781.378) (-781.773) (-783.219) [-780.233] * (-779.706) [-781.459] (-780.718) (-780.320) -- 0:00:00
997000 -- (-782.197) (-778.741) (-783.500) [-780.619] * [-779.741] (-782.420) (-781.019) (-779.859) -- 0:00:00
997500 -- (-783.344) [-778.851] (-779.799) (-781.754) * (-782.404) [-780.030] (-780.170) (-781.398) -- 0:00:00
998000 -- (-781.857) [-785.380] (-778.884) (-781.348) * (-785.396) (-778.907) [-779.665] (-779.468) -- 0:00:00
998500 -- (-785.036) (-782.736) (-778.957) [-784.767] * (-784.485) (-779.517) (-782.467) [-778.725] -- 0:00:00
999000 -- (-782.841) [-779.947] (-780.999) (-778.624) * (-779.197) (-779.545) (-780.198) [-780.717] -- 0:00:00
999500 -- [-779.970] (-778.516) (-781.990) (-779.612) * (-780.516) (-781.982) (-781.858) [-782.296] -- 0:00:00
1000000 -- [-781.313] (-779.084) (-779.219) (-781.134) * [-779.140] (-780.723) (-778.867) (-783.135) -- 0:00:00
Average standard deviation of split frequencies: 0.007349
Analysis completed in 1 mins 3 seconds
Analysis used 61.80 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -778.42
Likelihood of best state for "cold" chain of run 2 was -778.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 60 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.7 % ( 21 %) Dirichlet(Pi{all})
31.1 % ( 26 %) Slider(Pi{all})
78.7 % ( 60 %) Multiplier(Alpha{1,2})
78.7 % ( 53 %) Multiplier(Alpha{3})
21.5 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 18 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 66 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
29.3 % ( 29 %) Dirichlet(Pi{all})
31.8 % ( 32 %) Slider(Pi{all})
79.0 % ( 61 %) Multiplier(Alpha{1,2})
77.9 % ( 53 %) Multiplier(Alpha{3})
21.8 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 80 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.5 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166970 0.83 0.67
3 | 166279 167149 0.84
4 | 166256 167036 166310
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 167742 0.82 0.67
3 | 166416 166871 0.84
4 | 166589 166265 166117
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -780.27
| 1 21 1 12 1 1|
| * 1 2|
| 2 2 1 1 1 1 1 |
| * 2 2 2 1 2 1 2 1 2 21 |
| 22 2 21 2 1 1 *1 2 |
| * 2 1 2 1 2 2 2 2 1 1 2 2 |
|2 1 1 1 2 2 2 22 211 2 2 |
| 1 1 1 1 2 12 2 1 22 1 1 1 |
|1 1 2 11 2 1 1 1 2 1 1 |
| 2 1 1 1 2 1 * 2 2 1 |
| 2 2 1 2 |
| 2 1 |
| 2 2 2 |
| |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -781.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -780.15 -783.52
2 -780.18 -783.54
--------------------------------------
TOTAL -780.16 -783.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900796 0.092082 0.393341 1.518502 0.866974 1207.82 1354.41 1.000
r(A<->C){all} 0.158537 0.019969 0.000087 0.447762 0.119584 181.27 210.61 1.000
r(A<->G){all} 0.169556 0.020507 0.000093 0.454299 0.135463 137.46 184.41 1.003
r(A<->T){all} 0.169621 0.020365 0.000264 0.449509 0.129257 174.61 199.09 1.000
r(C<->G){all} 0.158299 0.018052 0.000028 0.437392 0.125429 310.72 312.48 1.000
r(C<->T){all} 0.165374 0.021410 0.000090 0.467734 0.125760 223.95 228.15 1.002
r(G<->T){all} 0.178613 0.021987 0.000345 0.475092 0.137597 252.89 259.76 1.001
pi(A){all} 0.165170 0.000233 0.135839 0.195391 0.164860 1267.59 1290.72 1.000
pi(C){all} 0.291569 0.000369 0.255767 0.331009 0.290948 1105.12 1112.16 1.000
pi(G){all} 0.331502 0.000380 0.292673 0.367731 0.331641 824.64 1067.44 1.000
pi(T){all} 0.211759 0.000284 0.179307 0.244730 0.211786 1361.41 1368.71 1.000
alpha{1,2} 0.412239 0.243127 0.000119 1.397807 0.237742 1172.71 1336.86 1.000
alpha{3} 0.468943 0.252648 0.000192 1.508587 0.300312 1114.54 1294.08 1.000
pinvar{all} 0.997143 0.000013 0.990653 0.999999 0.998249 1352.19 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .**...
9 -- ....**
10 -- ..*..*
11 -- .**.**
12 -- .*.***
13 -- .*..*.
14 -- .****.
15 -- .***.*
16 -- ...*.*
17 -- ..****
18 -- ..**..
19 -- .*...*
20 -- .*.*..
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.007066 0.149234 0.159227 2
8 458 0.152565 0.001884 0.151233 0.153897 2
9 441 0.146902 0.004240 0.143904 0.149900 2
10 439 0.146236 0.004240 0.143238 0.149234 2
11 437 0.145570 0.002355 0.143904 0.147235 2
12 435 0.144903 0.007066 0.139907 0.149900 2
13 434 0.144570 0.006595 0.139907 0.149234 2
14 433 0.144237 0.013662 0.134577 0.153897 2
15 433 0.144237 0.011777 0.135909 0.152565 2
16 429 0.142905 0.015546 0.131912 0.153897 2
17 415 0.138241 0.014604 0.127915 0.148568 2
18 414 0.137908 0.007537 0.132578 0.143238 2
19 413 0.137575 0.008009 0.131912 0.143238 2
20 409 0.136243 0.002355 0.134577 0.137908 2
21 397 0.132245 0.003298 0.129913 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098846 0.010187 0.000002 0.311935 0.068233 1.000 2
length{all}[2] 0.101118 0.010967 0.000087 0.309098 0.069044 1.000 2
length{all}[3] 0.096692 0.008993 0.000032 0.281402 0.068277 1.000 2
length{all}[4] 0.101765 0.010825 0.000061 0.306461 0.071162 1.000 2
length{all}[5] 0.099939 0.010306 0.000006 0.309534 0.067291 1.000 2
length{all}[6] 0.099475 0.009695 0.000006 0.298468 0.070351 1.000 2
length{all}[7] 0.097676 0.009251 0.000042 0.280259 0.067830 0.998 2
length{all}[8] 0.102183 0.008882 0.000143 0.284724 0.079536 0.999 2
length{all}[9] 0.103867 0.012509 0.000045 0.305843 0.071372 0.999 2
length{all}[10] 0.099168 0.009378 0.000045 0.271090 0.071431 1.001 2
length{all}[11] 0.098571 0.008202 0.000154 0.266543 0.072626 0.998 2
length{all}[12] 0.092751 0.007702 0.000066 0.267710 0.067170 0.998 2
length{all}[13] 0.104400 0.011887 0.000237 0.319633 0.073463 0.998 2
length{all}[14] 0.098821 0.009837 0.000052 0.293645 0.066965 0.998 2
length{all}[15] 0.100628 0.009440 0.000641 0.287960 0.070936 0.998 2
length{all}[16] 0.098946 0.010885 0.000062 0.316885 0.063883 0.999 2
length{all}[17] 0.101995 0.010898 0.000052 0.302892 0.070758 0.998 2
length{all}[18] 0.106569 0.011309 0.000100 0.320985 0.069808 1.001 2
length{all}[19] 0.103156 0.009661 0.000115 0.314146 0.077329 0.998 2
length{all}[20] 0.097675 0.008954 0.000585 0.296165 0.070496 0.999 2
length{all}[21] 0.103159 0.010845 0.000021 0.330858 0.067296 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007349
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|-------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 576
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 192 / 192 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 192 / 192 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059157 0.062239 0.031619 0.099431 0.050359 0.050161 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -826.543635
Iterating by ming2
Initial: fx= 826.543635
x= 0.05916 0.06224 0.03162 0.09943 0.05036 0.05016 0.30000 1.30000
1 h-m-p 0.0000 0.0002 461.5186 +++ 790.879351 m 0.0002 14 | 1/8
2 h-m-p 0.0015 0.0076 40.4077 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 423.3395 ++ 773.240619 m 0.0001 45 | 2/8
4 h-m-p 0.0015 0.0133 24.8466 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 379.6944 ++ 773.089381 m 0.0000 76 | 3/8
6 h-m-p 0.0000 0.0194 18.1005 ---------.. | 3/8
7 h-m-p 0.0000 0.0000 328.4833 ++ 768.046081 m 0.0000 105 | 4/8
8 h-m-p 0.0009 0.0248 14.2932 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 268.2819 ++ 766.867637 m 0.0000 136 | 5/8
10 h-m-p 0.0003 0.0361 9.8580 ----------.. | 5/8
11 h-m-p 0.0000 0.0002 189.1564 +++ 759.726236 m 0.0002 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 759.726236 m 8.0000 178 | 6/8
13 h-m-p 0.4132 8.0000 0.0001 +++ 759.726236 m 8.0000 192 | 6/8
14 h-m-p 0.0029 1.4283 1.0421 -------C 759.726236 0 0.0000 212 | 6/8
15 h-m-p 0.2222 8.0000 0.0000 -------------C 759.726236 0 0.0000 236 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 --C 759.726236 0 0.0003 251
Out..
lnL = -759.726236
252 lfun, 252 eigenQcodon, 1512 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077439 0.046590 0.046796 0.099718 0.071216 0.017368 0.300017 0.558976 0.379657
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.913671
np = 9
lnL0 = -826.573830
Iterating by ming2
Initial: fx= 826.573830
x= 0.07744 0.04659 0.04680 0.09972 0.07122 0.01737 0.30002 0.55898 0.37966
1 h-m-p 0.0000 0.0001 447.2159 ++ 807.616592 m 0.0001 14 | 1/9
2 h-m-p 0.0002 0.0008 201.1089 ++ 780.348228 m 0.0008 26 | 2/9
3 h-m-p 0.0000 0.0000 6685.4524 ++ 780.201994 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1421.4222 ++ 766.070784 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 847309.4160 ++ 763.752004 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 6271.0818 ++ 763.571206 m 0.0000 74 | 6/9
7 h-m-p 0.0009 0.4322 3.5828 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 187.5309 ++ 759.726229 m 0.0001 107 | 7/9
9 h-m-p 0.8456 8.0000 0.0000 ++ 759.726229 m 8.0000 119 | 7/9
10 h-m-p 0.1235 8.0000 0.0004 ++++ 759.726229 m 8.0000 135 | 7/9
11 h-m-p 0.0012 0.1003 2.8025 ----------Y 759.726229 0 0.0000 159 | 7/9
12 h-m-p 0.0222 8.0000 0.0000 C 759.726229 0 0.0222 171 | 7/9
13 h-m-p 0.0208 8.0000 0.0000 C 759.726229 0 0.0172 185
Out..
lnL = -759.726229
186 lfun, 558 eigenQcodon, 2232 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031593 0.048960 0.065521 0.105277 0.104598 0.092455 0.279461 0.839099 0.360312 0.107392 1.389608
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.061011
np = 11
lnL0 = -839.471671
Iterating by ming2
Initial: fx= 839.471671
x= 0.03159 0.04896 0.06552 0.10528 0.10460 0.09246 0.27946 0.83910 0.36031 0.10739 1.38961
1 h-m-p 0.0000 0.0002 407.9435 +++ 807.377692 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0006 186.7787 ++ 791.595552 m 0.0006 31 | 2/11
3 h-m-p 0.0000 0.0000 2720.8046 ++ 789.301185 m 0.0000 45 | 3/11
4 h-m-p 0.0002 0.0117 30.7503 +++ 786.128263 m 0.0117 60 | 4/11
5 h-m-p 0.0000 0.0000 84.2717 ++ 785.570762 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0039 139.7993 +++++ 777.200659 m 0.0039 91 | 6/11
7 h-m-p 0.0027 0.0135 10.8485 ++ 759.726231 m 0.0135 105 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 759.726231 m 8.0000 119 | 7/11
9 h-m-p 0.5632 8.0000 0.0002 ++ 759.726231 m 8.0000 137 | 7/11
10 h-m-p 0.0071 0.3456 0.2117 -------Y 759.726231 0 0.0000 162 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 759.726231 m 8.0000 183 | 7/11
12 h-m-p 0.0037 1.8312 0.0606 -----C 759.726231 0 0.0000 206 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 N 759.726231 0 0.0020 224 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11
16 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -759.726231
312 lfun, 1248 eigenQcodon, 5616 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -759.735081 S = -759.724006 -0.004238
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:03
did 20 / 55 patterns 0:03
did 30 / 55 patterns 0:03
did 40 / 55 patterns 0:03
did 50 / 55 patterns 0:03
did 55 / 55 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032958 0.089072 0.100623 0.035329 0.084857 0.088429 0.056491 0.229721 1.831188
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.666065
np = 9
lnL0 = -838.393082
Iterating by ming2
Initial: fx= 838.393082
x= 0.03296 0.08907 0.10062 0.03533 0.08486 0.08843 0.05649 0.22972 1.83119
1 h-m-p 0.0000 0.0002 431.6457 +++ 803.766112 m 0.0002 24 | 1/9
2 h-m-p 0.0002 0.0009 45.3043 ++ 802.693173 m 0.0009 45 | 2/9
3 h-m-p 0.0003 0.0014 76.8992 ++ 765.700552 m 0.0014 65 | 3/9
4 h-m-p 0.0000 0.0002 32.8349 ---------.. | 3/9
5 h-m-p 0.0000 0.0000 326.2911 ++ 762.962523 m 0.0000 109 | 4/9
6 h-m-p 0.0020 0.0099 2.3901 ------------.. | 4/9
7 h-m-p 0.0000 0.0000 267.0789 ++ 762.635249 m 0.0000 154 | 5/9
8 h-m-p 0.0004 0.0145 2.3442 ----------.. | 5/9
9 h-m-p 0.0000 0.0001 188.1382 ++ 759.726227 m 0.0001 195 | 6/9
10 h-m-p 0.0622 8.0000 0.0000 ++++ 759.726227 m 8.0000 213 | 6/9
11 h-m-p 0.0160 8.0000 0.2725 +++++ 759.726199 m 8.0000 231 | 6/9
12 h-m-p 0.1146 0.5728 2.2678 ++ 759.726187 m 0.5728 246 | 7/9
13 h-m-p 0.5030 8.0000 2.5759 +
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
+ 759.726171 m 8.0000 261
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.011162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51567) = 1.046461e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51580) = 1.011098e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.51554) = 1.011226e-160 2000 rounds
| 7/9
14 h-m-p 1.6000 8.0000 0.9138
QuantileBeta(0.15, 0.00500, 2.55864) = 9.904718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68753) = 9.331518e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
+ 759.726170 m 8.0000 275
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.154811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73050) = 9.474402e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73063) = 9.154265e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73036) = 9.155356e-161 2000 rounds
| 7/9
15 h-m-p 0.6371 8.0000 11.4751
QuantileBeta(0.15, 0.00500, 2.94532) = 8.362417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58980) = 6.636037e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
+ 759.726168 m 8.0000 289
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.172628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42812) = 4.318293e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42832) = 4.172463e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.42793) = 4.172792e-161 2000 rounds
| 7/9
16 h-m-p 1.6000 8.0000 7.1125
QuantileBeta(0.15, 0.00500, 5.76253) = 3.908415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.76576) = 3.284316e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
+ 759.726167 m 8.0000 303
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.118297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10017) = 3.227156e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10040) = 3.118190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.09994) = 3.118404e-161 2000 rounds
| 7/9
17 h-m-p 1.1481 8.0000 49.5591
QuantileBeta(0.15, 0.00500, 8.77222) = 2.489050e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.78836) = 1.550226e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
+ 759.726167 m 8.0000 317
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.128897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75082) = 1.168306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75124) = 1.128871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.75041) = 1.128922e-161 2000 rounds
| 7/9
18 h-m-p 1.6000 8.0000 47.9794
QuantileBeta(0.15, 0.00500, 21.00668) = 1.004753e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 27.77424) = 7.554987e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
+ 759.726167 m 8.0000 331
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03010) = 7.221553e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.03065) = 6.977823e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.02954) = 6.978087e-162 2000 rounds
| 7/9
19 h-m-p 0.0492 0.2458 158.7986
QuantileBeta(0.15, 0.00500, 30.25948) = 6.924178e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.94764) = 6.767709e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
+ 759.726167 m 0.2458 345
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.717112e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17703) = 6.951605e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17760) = 6.716987e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.17646) = 6.717237e-162 2000 rounds
| 8/9
20 h-m-p 0.4877 8.0000 2.3518
QuantileBeta(0.15, 0.00500, 30.03010) = 6.977955e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.03366) = 6.748646e-162 2000 rounds
N 759.726167 0 0.1219 359
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89030) = 7.017182e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.89086) = 6.780350e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.88973) = 6.780604e-162 2000 rounds
| 8/9
21 h-m-p 1.6000 8.0000 0.0960
QuantileBeta(0.15, 0.00500, 31.04383) = 6.746399e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.90079) = 6.778137e-162 2000 rounds
Y 759.726167 0 0.4000 372
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 7.008332e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92925) = 6.771799e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92811) = 6.772052e-162 2000 rounds
| 8/9
22 h-m-p 0.4996 8.0000 0.0768
QuantileBeta(0.15, 0.00500, 30.89030) = 6.780477e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.91908) = 6.774062e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92628) = 6.772459e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92808) = 6.772059e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92853) = 6.771959e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92864) = 6.771934e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92867) = 6.771928e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
-
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
N 759.726167 0 0.0000 397
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 7.008332e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92925) = 6.771799e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92811) = 6.772052e-162 2000 rounds
| 8/9
23 h-m-p 1.0000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
C 759.726167 0 0.2500 410
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
Out..
lnL = -759.726167
411 lfun, 4521 eigenQcodon, 24660 P(t)
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.92868) = 6.771926e-162 2000 rounds
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042581 0.033615 0.066057 0.088896 0.011976 0.108571 999.000000 0.900000 0.209066 1.196544 1.299511
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.035411
np = 11
lnL0 = -820.817235
Iterating by ming2
Initial: fx= 820.817235
x= 0.04258 0.03361 0.06606 0.08890 0.01198 0.10857 951.42857 0.90000 0.20907 1.19654 1.29951
1 h-m-p 0.0000 0.0001 399.1591 ++ 809.404628 m 0.0001 27 | 1/11
2 h-m-p 0.0002 0.0009 162.6359 ++ 789.837603 m 0.0009 52 | 2/11
3 h-m-p 0.0000 0.0000 1229.8620 ++ 783.102516 m 0.0000 76 | 3/11
4 h-m-p 0.0004 0.0019 86.0096 ++ 776.811451 m 0.0019 99
QuantileBeta(0.15, 0.00494, 1.21151) = 1.800360e-162 2000 rounds
| 4/11
5 h-m-p 0.0001 0.0003 726.9140 ++ 761.551939 m 0.0003 121 | 5/11
6 h-m-p 0.0002 0.0011 24.7930 ++ 761.437266 m 0.0011 142 | 6/11
7 h-m-p 0.0021 0.0391 12.3758 ------------.. | 6/11
8 h-m-p 0.0000 0.0000 188.3499 ++ 759.726239 m 0.0000 191 | 7/11
9 h-m-p 0.1574 8.0000 0.0000 +++ 759.726239 m 8.0000 211 | 7/11
10 h-m-p 0.0140 6.9770 0.6314 ---------C 759.726239 0 0.0000 238 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 759.726239 m 8.0000 259 | 7/11
12 h-m-p 0.0024 1.1811 3.7668 ------------.. | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 759.726239 m 8.0000 308 | 7/11
14 h-m-p 0.0026 1.3108 0.4366 ----------N 759.726239 0 0.0000 336 | 7/11
15 h-m-p 0.0000 0.0001 3542.8996 ++ 759.726167 m 0.0001 354 | 8/11
16 h-m-p 1.6000 8.0000 0.0000 ++ 759.726167 m 8.0000 372 | 8/11
17 h-m-p 0.1999 8.0000 0.0006 ---C 759.726167 0 0.0008 392
Out..
lnL = -759.726167
393 lfun, 4716 eigenQcodon, 25938 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -759.755801 S = -759.726626 -0.012861
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:16
did 20 / 55 patterns 0:16
did 30 / 55 patterns 0:17
did 40 / 55 patterns 0:17
did 50 / 55 patterns 0:17
did 55 / 55 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192
NC_011896_1_WP_010907517_1_95_MLBR_RS00460 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
NC_002677_1_NP_301192_1_64_ML0094 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
**************************************************
NC_011896_1_WP_010907517_1_95_MLBR_RS00460 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
NC_002677_1_NP_301192_1_64_ML0094 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
**************************************************
NC_011896_1_WP_010907517_1_95_MLBR_RS00460 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
NC_002677_1_NP_301192_1_64_ML0094 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
**************************************************
NC_011896_1_WP_010907517_1_95_MLBR_RS00460 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
NC_002677_1_NP_301192_1_64_ML0094 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
******************************************
>NC_011896_1_WP_010907517_1_95_MLBR_RS00460 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA >NC_002677_1_NP_301192_1_64_ML0094 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA >NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA >NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA >NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA >NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG GCCTCAGCTCGGGAAGTGCGGTCAAA
>NC_011896_1_WP_010907517_1_95_MLBR_RS00460 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK >NC_002677_1_NP_301192_1_64_ML0094 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK >NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK >NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK >NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK >NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
#NEXUS
[ID: 0541023901]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907517_1_95_MLBR_RS00460
NC_002677_1_NP_301192_1_64_ML0094
NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935
NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115
NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485
NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907517_1_95_MLBR_RS00460,
2 NC_002677_1_NP_301192_1_64_ML0094,
3 NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935,
4 NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115,
5 NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485,
6 NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06823341,2:0.06904443,3:0.06827739,4:0.07116226,5:0.06729106,6:0.07035065);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06823341,2:0.06904443,3:0.06827739,4:0.07116226,5:0.06729106,6:0.07035065);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -780.15 -783.52
2 -780.18 -783.54
--------------------------------------
TOTAL -780.16 -783.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900796 0.092082 0.393341 1.518502 0.866974 1207.82 1354.41 1.000
r(A<->C){all} 0.158537 0.019969 0.000087 0.447762 0.119584 181.27 210.61 1.000
r(A<->G){all} 0.169556 0.020507 0.000093 0.454299 0.135463 137.46 184.41 1.003
r(A<->T){all} 0.169621 0.020365 0.000264 0.449509 0.129257 174.61 199.09 1.000
r(C<->G){all} 0.158299 0.018052 0.000028 0.437392 0.125429 310.72 312.48 1.000
r(C<->T){all} 0.165374 0.021410 0.000090 0.467734 0.125760 223.95 228.15 1.002
r(G<->T){all} 0.178613 0.021987 0.000345 0.475092 0.137597 252.89 259.76 1.001
pi(A){all} 0.165170 0.000233 0.135839 0.195391 0.164860 1267.59 1290.72 1.000
pi(C){all} 0.291569 0.000369 0.255767 0.331009 0.290948 1105.12 1112.16 1.000
pi(G){all} 0.331502 0.000380 0.292673 0.367731 0.331641 824.64 1067.44 1.000
pi(T){all} 0.211759 0.000284 0.179307 0.244730 0.211786 1361.41 1368.71 1.000
alpha{1,2} 0.412239 0.243127 0.000119 1.397807 0.237742 1172.71 1336.86 1.000
alpha{3} 0.468943 0.252648 0.000192 1.508587 0.300312 1114.54 1294.08 1.000
pinvar{all} 0.997143 0.000013 0.990653 0.999999 0.998249 1352.19 1357.29 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0094/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 192
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 3 3 3 3 3 3
CTC 3 3 3 3 3 3 | CCC 4 4 4 4 4 4 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 3 3 3 3 3 3
CTG 8 8 8 8 8 8 | CCG 6 6 6 6 6 6 | CAG 1 1 1 1 1 1 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 5 5 5 5 5 5
ATA 4 4 4 4 4 4 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 2 2 2 2 2 2
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 6 6 6 6 6 6 | Asp GAT 3 3 3 3 3 3 | Gly GGT 6 6 6 6 6 6
GTC 7 7 7 7 7 7 | GCC 11 11 11 11 11 11 | GAC 1 1 1 1 1 1 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 5 5 5 5 5 5 | Glu GAA 2 2 2 2 2 2 | GGA 4 4 4 4 4 4
GTG 14 14 14 14 14 14 | GCG 10 10 10 10 10 10 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907517_1_95_MLBR_RS00460
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
#2: NC_002677_1_NP_301192_1_64_ML0094
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
#3: NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
#4: NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
#5: NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
#6: NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 36 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 18
CTC 18 | CCC 24 | CAC 24 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 6 | CGA 18
CTG 48 | CCG 36 | CAG 6 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 18
ATC 36 | ACC 18 | AAC 6 | AGC 30
ATA 24 | ACA 12 | Lys K AAA 18 | Arg R AGA 12
Met M ATG 24 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 36 | Asp D GAT 18 | Gly G GGT 36
GTC 42 | GCC 66 | GAC 6 | GGC 30
GTA 0 | GCA 30 | Glu E GAA 12 | GGA 24
GTG 84 | GCG 60 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12500 C:0.25521 A:0.20312 G:0.41667
position 2: T:0.31771 C:0.32292 A:0.12500 G:0.23438
position 3: T:0.19271 C:0.29688 A:0.16667 G:0.34375
Average T:0.21181 C:0.29167 A:0.16493 G:0.33160
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -759.726236 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300017 1.299511
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907517_1_95_MLBR_RS00460: 0.000004, NC_002677_1_NP_301192_1_64_ML0094: 0.000004, NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935: 0.000004, NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115: 0.000004, NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485: 0.000004, NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30002
omega (dN/dS) = 1.29951
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
7..2 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
7..3 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
7..4 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
7..5 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
7..6 0.000 391.4 184.6 1.2995 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -759.726229 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.279461 0.615845 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907517_1_95_MLBR_RS00460: 0.000004, NC_002677_1_NP_301192_1_64_ML0094: 0.000004, NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935: 0.000004, NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115: 0.000004, NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485: 0.000004, NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27946
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61584 0.38416
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
7..2 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
7..3 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
7..4 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
7..5 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
7..6 0.000 391.4 184.6 0.3842 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -759.726231 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.056491 0.635484 0.184598 0.000001 1.980138
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907517_1_95_MLBR_RS00460: 0.000004, NC_002677_1_NP_301192_1_64_ML0094: 0.000004, NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935: 0.000004, NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115: 0.000004, NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485: 0.000004, NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.05649
MLEs of dN/dS (w) for site classes (K=3)
p: 0.63548 0.18460 0.17992
w: 0.00000 1.00000 1.98014
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
7..2 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
7..3 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
7..4 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
7..5 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
7..6 0.000 392.4 183.6 0.5409 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907517_1_95_MLBR_RS00460)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907517_1_95_MLBR_RS00460)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -759.726167 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 0.005000 30.928680
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907517_1_95_MLBR_RS00460: 0.000004, NC_002677_1_NP_301192_1_64_ML0094: 0.000004, NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935: 0.000004, NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115: 0.000004, NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485: 0.000004, NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M7 (beta):
p = 0.00500 q = 30.92868
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -759.726167 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.428508 0.999990 0.005000 1.244587 1.432123
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907517_1_95_MLBR_RS00460: 0.000004, NC_002677_1_NP_301192_1_64_ML0094: 0.000004, NZ_LVXE01000014_1_WP_010907517_1_485_A3216_RS05935: 0.000004, NZ_LYPH01000018_1_WP_010907517_1_661_A8144_RS03115: 0.000004, NZ_CP029543_1_WP_010907517_1_94_DIJ64_RS00485: 0.000004, NZ_AP014567_1_WP_010907517_1_97_JK2ML_RS00500: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42851
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.24459
(p1 = 0.00001) w = 1.43212
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.43212
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 383.1 192.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907517_1_95_MLBR_RS00460)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:17
Model 1: NearlyNeutral -759.726229 Model 2: PositiveSelection -759.726231 Model 0: one-ratio -759.726236 Model 7: beta -759.726167 Model 8: beta&w>1 -759.726167 Model 0 vs 1 1.3999999964653398E-5 Model 2 vs 1 3.999999989900971E-6 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
