--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:40:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0094/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -780.15          -783.52
2       -780.18          -783.54
--------------------------------------
TOTAL     -780.16          -783.53
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.900796    0.092082    0.393341    1.518502    0.866974   1207.82   1354.41    1.000
r(A<->C){all}   0.158537    0.019969    0.000087    0.447762    0.119584    181.27    210.61    1.000
r(A<->G){all}   0.169556    0.020507    0.000093    0.454299    0.135463    137.46    184.41    1.003
r(A<->T){all}   0.169621    0.020365    0.000264    0.449509    0.129257    174.61    199.09    1.000
r(C<->G){all}   0.158299    0.018052    0.000028    0.437392    0.125429    310.72    312.48    1.000
r(C<->T){all}   0.165374    0.021410    0.000090    0.467734    0.125760    223.95    228.15    1.002
r(G<->T){all}   0.178613    0.021987    0.000345    0.475092    0.137597    252.89    259.76    1.001
pi(A){all}      0.165170    0.000233    0.135839    0.195391    0.164860   1267.59   1290.72    1.000
pi(C){all}      0.291569    0.000369    0.255767    0.331009    0.290948   1105.12   1112.16    1.000
pi(G){all}      0.331502    0.000380    0.292673    0.367731    0.331641    824.64   1067.44    1.000
pi(T){all}      0.211759    0.000284    0.179307    0.244730    0.211786   1361.41   1368.71    1.000
alpha{1,2}      0.412239    0.243127    0.000119    1.397807    0.237742   1172.71   1336.86    1.000
alpha{3}        0.468943    0.252648    0.000192    1.508587    0.300312   1114.54   1294.08    1.000
pinvar{all}     0.997143    0.000013    0.990653    0.999999    0.998249   1352.19   1357.29    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-759.726229
Model 2: PositiveSelection	-759.726231
Model 0: one-ratio	-759.726236
Model 7: beta	-759.726167
Model 8: beta&w>1	-759.726167


Model 0 vs 1	1.3999999964653398E-5

Model 2 vs 1	3.999999989900971E-6

Model 8 vs 7	0.0
>C1
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C2
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C3
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C4
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C5
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C6
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=192 

C1              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C2              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C3              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C4              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C5              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C6              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
                **************************************************

C1              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C2              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C3              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C4              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C5              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C6              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
                **************************************************

C1              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C2              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C3              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C4              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C5              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C6              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
                **************************************************

C1              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C2              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C3              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C4              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C5              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C6              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
                ******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  192 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  192 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5760]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5760]--->[5760]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.723 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C2              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C3              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C4              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C5              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
C6              MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
                **************************************************

C1              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C2              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C3              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C4              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C5              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
C6              GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
                **************************************************

C1              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C2              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C3              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C4              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C5              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
C6              SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
                **************************************************

C1              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C2              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C3              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C4              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C5              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
C6              PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
                ******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C2              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C3              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C4              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C5              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
C6              ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
                **************************************************

C1              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C2              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C3              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C4              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C5              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
C6              TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
                **************************************************

C1              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C2              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C3              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C4              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C5              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
C6              TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
                **************************************************

C1              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C2              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C3              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C4              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C5              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
C6              GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
                **************************************************

C1              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C2              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C3              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C4              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C5              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
C6              CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
                **************************************************

C1              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C2              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C3              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C4              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C5              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
C6              GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
                **************************************************

C1              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C2              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C3              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C4              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C5              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
C6              AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
                **************************************************

C1              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C2              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C3              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C4              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C5              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
C6              CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
                **************************************************

C1              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C2              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C3              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C4              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C5              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
C6              TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
                **************************************************

C1              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C2              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C3              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C4              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C5              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
C6              CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
                **************************************************

C1              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C2              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C3              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C4              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C5              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
C6              TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
                **************************************************

C1              GCCTCAGCTCGGGAAGTGCGGTCAAA
C2              GCCTCAGCTCGGGAAGTGCGGTCAAA
C3              GCCTCAGCTCGGGAAGTGCGGTCAAA
C4              GCCTCAGCTCGGGAAGTGCGGTCAAA
C5              GCCTCAGCTCGGGAAGTGCGGTCAAA
C6              GCCTCAGCTCGGGAAGTGCGGTCAAA
                **************************



>C1
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C2
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C3
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C4
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C5
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C6
ATGCCTGAAGATAAGGCGCCTACTGGCGAGTTGGCCGCTATCGCGGCTGT
TCAGTCGGTGTTGGTTGACCGACCCGGTGTGCTGCCCACGGCACGAGGAA
TGTCGCACTTCGGAGAACACAGCATCGGCTGGCTGGCGATATCATTACTT
GGCGCGATCCTGGTGCCGTGCCGCCGTCGGTACTGGCTGGTGGCGGGGGC
CGGCGTGTTTGCTGCACATGTGGCTGCCGTGCTGATCAAACGGATGGTCC
GGCGTATCCGGCCGAACCATCCGGCCGTCACAGTGAATGTCGGTACACCC
AGTCCGCTCAGCTTTCCGTCGGCACATGCCACCTCGACCGCAGCCGCGGC
CATATTGATCGGTCGAGCTAGCAGACTGCCAAAAGGAATAGTTGCCGCGG
TGCTAGTGGCTCCGATGGCGCTGTCGCGGATAGTGCTGGGGGTGCACTAT
CCCAGTGATGTGGCCTTCGGTGTCGTGCTCGGTGCCGCGGTCGCAGGTAC
TACCGCCCGTTTCGATAGCCGGTTATCACGCAGATGGACTGTCCAACACG
GCCTCAGCTCGGGAAGTGCGGTCAAA
>C1
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C2
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C3
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C4
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C5
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
>C6
MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLL
GAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTP
SPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHY
PSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 576 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790321
      Setting output file names to "/data/3res/ML0094/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1452087901
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0541023901
      Seed = 872791126
      Swapseed = 1579790321
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1289.115611 -- -24.965149
         Chain 2 -- -1289.115611 -- -24.965149
         Chain 3 -- -1289.115611 -- -24.965149
         Chain 4 -- -1289.115611 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1289.115611 -- -24.965149
         Chain 2 -- -1289.115537 -- -24.965149
         Chain 3 -- -1289.115415 -- -24.965149
         Chain 4 -- -1289.115537 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1289.116] (-1289.116) (-1289.116) (-1289.116) * [-1289.116] (-1289.116) (-1289.115) (-1289.116) 
        500 -- (-798.191) (-811.652) (-798.116) [-805.781] * (-801.254) (-788.624) (-802.110) [-791.176] -- 0:00:00
       1000 -- (-799.966) (-791.335) (-784.247) [-788.439] * (-798.787) (-794.882) [-783.299] (-795.241) -- 0:00:00
       1500 -- (-800.323) (-789.926) (-785.376) [-795.264] * (-790.587) (-791.972) [-792.400] (-788.242) -- 0:00:00
       2000 -- (-796.857) (-784.532) [-788.251] (-793.545) * [-786.352] (-787.868) (-788.710) (-792.695) -- 0:00:00
       2500 -- (-788.504) [-783.359] (-795.647) (-787.557) * (-796.525) (-786.073) [-788.862] (-790.683) -- 0:00:00
       3000 -- (-797.573) (-796.903) [-789.060] (-789.786) * (-788.902) (-789.233) [-785.316] (-786.909) -- 0:00:00
       3500 -- (-789.956) (-788.772) [-789.000] (-793.285) * (-792.594) (-794.447) [-790.578] (-790.567) -- 0:00:00
       4000 -- (-789.655) (-784.210) (-794.522) [-788.220] * (-788.746) (-788.868) (-799.669) [-787.097] -- 0:04:09
       4500 -- (-792.145) (-789.111) [-788.515] (-788.304) * (-795.339) [-792.839] (-788.204) (-788.777) -- 0:03:41
       5000 -- (-786.597) [-787.978] (-794.188) (-799.389) * (-790.571) [-787.603] (-787.758) (-796.126) -- 0:03:19

      Average standard deviation of split frequencies: 0.057140

       5500 -- (-792.315) (-798.268) [-794.571] (-788.521) * (-791.503) [-792.477] (-789.956) (-791.525) -- 0:03:00
       6000 -- [-789.973] (-786.833) (-794.974) (-793.327) * [-790.244] (-785.950) (-794.602) (-788.924) -- 0:02:45
       6500 -- (-785.418) (-791.338) (-794.205) [-792.301] * (-781.955) [-802.529] (-786.805) (-786.721) -- 0:02:32
       7000 -- [-785.233] (-789.766) (-787.811) (-784.688) * [-789.086] (-793.056) (-780.672) (-792.862) -- 0:02:21
       7500 -- (-794.386) [-789.952] (-789.029) (-782.158) * (-795.608) (-787.669) (-781.294) [-784.498] -- 0:02:12
       8000 -- [-789.362] (-795.256) (-788.381) (-780.860) * (-792.431) (-788.370) [-780.102] (-792.427) -- 0:02:04
       8500 -- [-791.350] (-783.852) (-787.034) (-781.669) * (-785.684) (-791.039) [-779.308] (-791.005) -- 0:01:56
       9000 -- (-786.971) (-780.253) (-792.372) [-779.250] * (-790.837) (-786.178) (-781.194) [-797.208] -- 0:01:50
       9500 -- (-793.577) (-778.962) [-792.006] (-779.823) * [-795.587] (-793.469) (-780.318) (-790.321) -- 0:01:44
      10000 -- (-787.404) [-782.807] (-788.948) (-781.385) * (-789.873) (-790.595) (-784.263) [-789.129] -- 0:01:39

      Average standard deviation of split frequencies: 0.059662

      10500 -- (-784.901) (-785.654) (-794.110) [-781.142] * (-803.451) (-792.824) [-779.794] (-790.946) -- 0:01:34
      11000 -- (-790.030) (-785.195) [-786.241] (-782.056) * (-795.801) (-794.226) [-779.936] (-794.140) -- 0:01:29
      11500 -- [-793.505] (-782.405) (-793.186) (-779.973) * [-779.404] (-794.562) (-787.338) (-790.557) -- 0:01:25
      12000 -- [-785.097] (-780.889) (-797.950) (-779.386) * [-779.110] (-789.652) (-781.363) (-794.103) -- 0:01:22
      12500 -- (-790.263) (-780.132) (-787.752) [-781.294] * (-781.673) [-790.948] (-781.162) (-784.400) -- 0:01:19
      13000 -- (-792.944) [-780.979] (-789.342) (-780.751) * (-784.612) (-787.212) (-782.850) [-789.982] -- 0:01:15
      13500 -- [-789.373] (-781.470) (-785.785) (-781.665) * (-780.244) (-796.092) [-789.349] (-791.864) -- 0:01:13
      14000 -- [-793.721] (-779.472) (-788.330) (-783.378) * (-780.070) (-792.464) [-781.842] (-787.310) -- 0:01:10
      14500 -- (-793.021) (-780.300) (-789.626) [-781.083] * (-779.696) [-786.012] (-781.727) (-790.805) -- 0:01:07
      15000 -- (-798.589) [-785.511] (-799.792) (-780.999) * (-780.922) (-788.898) [-780.860] (-791.533) -- 0:01:05

      Average standard deviation of split frequencies: 0.054506

      15500 -- (-796.610) (-779.119) (-795.865) [-781.946] * (-784.913) (-791.474) (-779.525) [-789.640] -- 0:01:03
      16000 -- (-795.127) (-778.893) [-786.851] (-781.328) * (-783.416) [-792.620] (-780.522) (-795.846) -- 0:01:01
      16500 -- [-781.342] (-780.259) (-791.519) (-783.255) * (-782.523) (-794.710) (-780.981) [-784.675] -- 0:00:59
      17000 -- (-779.462) (-780.134) (-795.500) [-784.306] * (-781.287) (-794.778) (-781.236) [-790.318] -- 0:00:57
      17500 -- (-782.268) [-782.812] (-795.534) (-788.121) * (-779.782) (-788.342) (-780.590) [-786.562] -- 0:00:56
      18000 -- (-781.461) (-781.016) [-784.292] (-782.936) * [-785.376] (-787.634) (-780.005) (-790.887) -- 0:00:54
      18500 -- (-784.606) [-780.449] (-803.253) (-785.089) * [-784.429] (-797.250) (-781.282) (-793.964) -- 0:00:53
      19000 -- (-785.014) [-780.570] (-790.287) (-788.459) * (-782.305) (-789.940) [-781.695] (-789.874) -- 0:00:51
      19500 -- (-783.765) [-779.705] (-781.424) (-784.440) * (-781.796) (-789.879) [-779.479] (-791.671) -- 0:01:40
      20000 -- [-781.324] (-779.480) (-780.940) (-783.211) * (-779.290) (-791.836) [-780.197] (-789.405) -- 0:01:38

      Average standard deviation of split frequencies: 0.041818

      20500 -- (-780.478) (-780.885) (-780.923) [-779.141] * [-780.645] (-805.225) (-783.265) (-784.014) -- 0:01:35
      21000 -- (-784.639) (-781.133) (-779.087) [-781.201] * [-779.216] (-789.722) (-785.393) (-782.600) -- 0:01:33
      21500 -- (-779.298) [-781.478] (-783.658) (-780.100) * [-782.302] (-781.849) (-782.213) (-780.919) -- 0:01:31
      22000 -- (-780.028) (-779.239) [-781.484] (-781.028) * (-780.717) (-781.084) (-782.973) [-781.114] -- 0:01:28
      22500 -- [-783.947] (-782.216) (-778.645) (-778.754) * (-780.131) (-782.149) [-784.241] (-780.956) -- 0:01:26
      23000 -- (-786.210) (-780.143) (-779.374) [-779.412] * [-779.546] (-781.254) (-779.537) (-782.109) -- 0:01:24
      23500 -- (-784.441) (-779.261) (-781.271) [-782.959] * (-781.141) [-780.440] (-786.207) (-781.978) -- 0:01:23
      24000 -- (-780.862) (-780.923) (-782.825) [-781.552] * (-780.347) (-780.957) [-780.085] (-778.717) -- 0:01:21
      24500 -- [-783.370] (-779.432) (-781.983) (-780.254) * (-782.634) [-782.566] (-781.164) (-778.943) -- 0:01:19
      25000 -- (-784.935) [-780.231] (-786.683) (-786.139) * (-781.656) (-782.427) [-779.857] (-781.682) -- 0:01:18

      Average standard deviation of split frequencies: 0.044503

      25500 -- (-781.939) (-782.069) (-782.662) [-785.145] * (-780.566) (-784.532) [-782.465] (-779.440) -- 0:01:16
      26000 -- (-782.663) [-782.412] (-780.620) (-786.509) * (-780.648) (-783.945) [-780.862] (-780.337) -- 0:01:14
      26500 -- (-781.751) (-782.090) (-781.815) [-784.291] * (-779.615) (-780.449) (-781.102) [-779.732] -- 0:01:13
      27000 -- (-779.000) (-779.386) [-780.554] (-781.100) * [-779.087] (-782.261) (-779.865) (-781.055) -- 0:01:12
      27500 -- [-779.027] (-780.425) (-779.121) (-785.859) * [-779.215] (-784.359) (-779.676) (-782.425) -- 0:01:10
      28000 -- [-780.019] (-780.761) (-780.710) (-788.549) * (-780.673) [-779.913] (-781.128) (-782.921) -- 0:01:09
      28500 -- (-779.520) [-781.089] (-779.895) (-782.745) * (-780.159) [-780.533] (-779.022) (-779.823) -- 0:01:08
      29000 -- (-779.520) (-784.821) (-782.001) [-781.450] * (-779.755) (-779.812) (-780.014) [-780.147] -- 0:01:06
      29500 -- [-781.069] (-781.596) (-780.898) (-781.706) * (-779.905) (-780.533) [-781.013] (-781.108) -- 0:01:05
      30000 -- (-781.552) [-780.670] (-782.063) (-779.994) * (-783.415) [-781.923] (-780.054) (-784.122) -- 0:01:04

      Average standard deviation of split frequencies: 0.038025

      30500 -- (-779.626) (-780.025) (-779.971) [-781.322] * [-781.133] (-780.477) (-781.184) (-780.818) -- 0:01:03
      31000 -- (-781.295) [-779.992] (-780.829) (-780.417) * (-782.958) [-779.679] (-783.072) (-779.910) -- 0:01:02
      31500 -- (-781.003) [-783.429] (-780.634) (-780.476) * (-785.405) (-780.975) [-782.865] (-780.511) -- 0:01:01
      32000 -- (-786.499) (-782.402) (-782.224) [-779.257] * [-788.951] (-781.280) (-781.008) (-784.087) -- 0:01:00
      32500 -- [-783.638] (-785.706) (-784.102) (-779.933) * (-786.316) (-780.901) (-781.039) [-782.010] -- 0:00:59
      33000 -- (-783.489) (-782.071) [-782.284] (-781.684) * (-783.666) (-782.701) (-779.423) [-780.864] -- 0:00:58
      33500 -- (-780.636) (-779.801) [-780.865] (-780.925) * (-781.006) (-782.896) (-780.268) [-782.559] -- 0:00:57
      34000 -- [-780.905] (-779.784) (-781.312) (-782.942) * [-783.509] (-781.558) (-779.265) (-781.872) -- 0:00:56
      34500 -- (-779.505) (-779.255) [-784.375] (-782.260) * (-781.857) (-782.663) [-778.705] (-781.068) -- 0:00:55
      35000 -- [-779.386] (-780.804) (-784.228) (-781.308) * (-781.323) (-780.150) (-780.957) [-781.181] -- 0:00:55

      Average standard deviation of split frequencies: 0.051689

      35500 -- (-780.193) (-780.100) [-779.246] (-780.149) * (-782.350) (-779.675) (-780.136) [-782.679] -- 0:00:54
      36000 -- (-779.201) (-783.371) [-779.972] (-785.470) * [-783.568] (-781.879) (-780.174) (-780.506) -- 0:01:20
      36500 -- (-779.634) (-780.328) [-780.120] (-784.622) * (-781.895) (-781.680) [-779.975] (-779.743) -- 0:01:19
      37000 -- (-780.083) [-780.328] (-782.799) (-780.458) * (-780.357) [-781.272] (-779.931) (-781.480) -- 0:01:18
      37500 -- (-782.466) (-779.757) (-783.439) [-778.840] * [-778.718] (-781.356) (-781.753) (-780.608) -- 0:01:17
      38000 -- [-782.400] (-779.769) (-781.545) (-779.711) * [-781.216] (-782.176) (-781.203) (-781.557) -- 0:01:15
      38500 -- (-779.660) [-779.262] (-781.665) (-781.254) * (-780.654) [-781.098] (-780.509) (-781.429) -- 0:01:14
      39000 -- (-782.374) [-781.362] (-782.054) (-779.195) * [-780.447] (-779.120) (-781.566) (-782.389) -- 0:01:13
      39500 -- (-780.744) [-781.755] (-780.776) (-781.051) * (-779.333) (-779.336) (-780.284) [-784.477] -- 0:01:12
      40000 -- (-784.201) (-782.892) [-782.735] (-784.348) * (-779.587) [-780.114] (-781.579) (-785.236) -- 0:01:12

      Average standard deviation of split frequencies: 0.039046

      40500 -- (-779.743) [-779.039] (-780.360) (-780.464) * (-780.636) [-780.101] (-780.648) (-783.805) -- 0:01:11
      41000 -- (-782.506) (-784.216) [-778.878] (-778.974) * (-783.091) (-780.788) (-782.615) [-781.044] -- 0:01:10
      41500 -- [-781.441] (-781.403) (-779.584) (-779.497) * (-787.621) (-779.271) (-780.862) [-780.273] -- 0:01:09
      42000 -- (-780.501) (-782.592) (-779.485) [-779.374] * (-781.738) [-779.122] (-783.717) (-783.183) -- 0:01:08
      42500 -- (-780.117) (-781.593) (-782.033) [-778.626] * [-782.207] (-780.104) (-782.916) (-780.218) -- 0:01:07
      43000 -- (-782.843) (-780.590) (-782.575) [-778.623] * (-780.605) (-781.744) [-780.650] (-780.679) -- 0:01:06
      43500 -- [-780.742] (-782.113) (-782.734) (-779.401) * (-780.733) (-781.531) [-782.053] (-783.554) -- 0:01:05
      44000 -- (-780.032) (-779.646) (-781.769) [-780.872] * (-781.072) (-781.180) [-780.797] (-780.753) -- 0:01:05
      44500 -- (-780.764) (-783.274) (-779.125) [-781.227] * (-783.282) (-781.112) [-779.933] (-782.701) -- 0:01:04
      45000 -- (-779.776) (-780.464) (-780.042) [-781.428] * (-784.850) (-781.484) (-779.818) [-785.266] -- 0:01:03

      Average standard deviation of split frequencies: 0.034160

      45500 -- (-781.073) (-781.824) [-780.346] (-781.961) * [-784.912] (-783.340) (-779.675) (-782.289) -- 0:01:02
      46000 -- (-778.500) (-781.964) (-778.938) [-783.098] * (-781.629) (-779.866) [-779.976] (-783.219) -- 0:01:02
      46500 -- (-780.480) (-781.325) [-778.794] (-782.525) * (-786.016) (-779.799) (-779.349) [-784.690] -- 0:01:01
      47000 -- (-780.724) (-779.103) [-778.822] (-779.898) * (-784.212) (-781.836) (-780.011) [-780.047] -- 0:01:00
      47500 -- (-781.634) [-781.459] (-782.939) (-778.824) * [-784.097] (-781.270) (-780.316) (-785.344) -- 0:01:00
      48000 -- [-786.002] (-779.565) (-779.269) (-781.564) * [-779.394] (-783.341) (-779.775) (-780.781) -- 0:00:59
      48500 -- [-780.898] (-780.361) (-782.301) (-778.924) * (-780.122) (-782.246) (-780.600) [-780.838] -- 0:00:58
      49000 -- (-779.891) [-779.433] (-781.531) (-780.150) * [-779.738] (-782.040) (-779.469) (-779.562) -- 0:00:58
      49500 -- [-780.028] (-780.358) (-780.456) (-780.734) * [-780.234] (-781.717) (-779.674) (-783.402) -- 0:00:57
      50000 -- [-779.227] (-781.033) (-780.571) (-782.417) * (-785.822) (-781.044) (-781.142) [-780.049] -- 0:00:57

      Average standard deviation of split frequencies: 0.028355

      50500 -- (-780.278) (-786.072) [-781.293] (-780.619) * (-782.704) (-780.293) (-779.339) [-779.620] -- 0:00:56
      51000 -- (-780.832) (-781.061) (-780.662) [-778.784] * (-783.032) (-781.448) (-780.285) [-782.971] -- 0:00:55
      51500 -- (-781.314) (-781.941) [-780.237] (-781.243) * (-782.181) (-782.753) (-782.813) [-781.061] -- 0:00:55
      52000 -- (-781.425) (-781.775) [-781.693] (-783.554) * (-780.637) (-781.203) [-780.093] (-779.858) -- 0:01:12
      52500 -- [-780.729] (-782.997) (-779.787) (-779.520) * (-781.919) [-786.004] (-780.138) (-780.845) -- 0:01:12
      53000 -- [-782.390] (-784.515) (-779.931) (-782.446) * (-782.060) [-781.883] (-779.102) (-780.085) -- 0:01:11
      53500 -- (-780.125) [-780.748] (-780.622) (-781.090) * (-781.071) (-781.150) (-782.382) [-780.276] -- 0:01:10
      54000 -- [-780.607] (-781.058) (-781.989) (-781.614) * (-780.183) (-784.026) [-779.008] (-778.925) -- 0:01:10
      54500 -- (-779.823) (-779.686) [-780.642] (-785.407) * (-781.070) (-779.587) [-780.752] (-781.245) -- 0:01:09
      55000 -- [-779.416] (-779.514) (-783.391) (-782.511) * [-781.295] (-779.784) (-778.715) (-780.466) -- 0:01:08

      Average standard deviation of split frequencies: 0.031457

      55500 -- (-783.030) (-780.105) [-780.108] (-781.962) * (-782.212) [-780.912] (-782.137) (-780.614) -- 0:01:08
      56000 -- (-780.504) (-780.168) (-782.031) [-781.955] * (-780.593) [-779.202] (-781.288) (-781.955) -- 0:01:07
      56500 -- (-783.077) [-779.669] (-781.733) (-779.989) * (-780.399) [-781.760] (-779.708) (-783.496) -- 0:01:06
      57000 -- (-781.972) (-780.989) [-779.860] (-780.354) * (-782.995) [-781.671] (-781.270) (-781.049) -- 0:01:06
      57500 -- (-786.724) [-779.157] (-780.637) (-780.725) * (-780.627) [-780.081] (-780.488) (-780.884) -- 0:01:05
      58000 -- (-782.932) (-779.714) (-780.106) [-779.784] * [-780.749] (-779.518) (-780.360) (-779.858) -- 0:01:04
      58500 -- [-784.381] (-782.515) (-780.956) (-781.862) * (-780.041) [-778.788] (-782.732) (-779.418) -- 0:01:04
      59000 -- (-783.290) [-784.037] (-781.932) (-783.016) * (-779.283) (-781.826) (-784.499) [-779.412] -- 0:01:03
      59500 -- [-784.842] (-781.735) (-781.374) (-781.835) * (-779.327) [-781.189] (-786.016) (-780.710) -- 0:01:03
      60000 -- (-781.835) [-780.458] (-781.887) (-779.980) * (-779.815) [-783.026] (-781.114) (-779.587) -- 0:01:02

      Average standard deviation of split frequencies: 0.030342

      60500 -- [-779.536] (-780.448) (-782.401) (-780.668) * (-779.286) [-779.390] (-779.837) (-779.523) -- 0:01:02
      61000 -- (-780.096) (-781.081) [-783.831] (-780.799) * (-780.145) [-779.119] (-783.143) (-781.067) -- 0:01:01
      61500 -- [-778.978] (-783.098) (-781.235) (-779.618) * (-780.394) (-780.745) [-780.353] (-780.913) -- 0:01:01
      62000 -- [-780.462] (-783.515) (-781.487) (-780.470) * (-780.675) (-780.537) (-783.266) [-780.955] -- 0:01:00
      62500 -- (-784.877) (-782.754) (-781.130) [-781.843] * (-780.767) [-780.925] (-780.565) (-780.222) -- 0:01:00
      63000 -- (-786.337) (-781.162) [-780.191] (-781.776) * [-781.474] (-782.797) (-781.765) (-780.024) -- 0:00:59
      63500 -- (-787.279) (-782.922) [-780.945] (-781.214) * [-779.704] (-783.007) (-781.467) (-782.010) -- 0:00:58
      64000 -- [-779.074] (-783.658) (-780.145) (-781.469) * [-780.456] (-779.368) (-782.316) (-780.357) -- 0:00:58
      64500 -- (-782.465) (-785.207) [-780.963] (-785.618) * [-780.882] (-779.881) (-779.791) (-786.643) -- 0:00:58
      65000 -- (-780.993) (-780.160) [-781.646] (-783.646) * (-781.079) [-779.662] (-782.580) (-783.891) -- 0:00:57

      Average standard deviation of split frequencies: 0.029284

      65500 -- (-784.087) [-779.956] (-781.192) (-782.165) * (-785.264) [-781.757] (-783.000) (-784.292) -- 0:00:57
      66000 -- (-780.537) (-781.844) (-782.615) [-779.994] * (-782.074) (-781.535) [-779.374] (-781.519) -- 0:00:56
      66500 -- (-779.571) (-780.349) [-779.825] (-779.210) * (-780.452) [-781.341] (-780.807) (-781.654) -- 0:00:56
      67000 -- (-780.663) (-780.380) [-781.365] (-781.856) * (-780.600) (-780.944) (-780.098) [-780.239] -- 0:01:09
      67500 -- (-779.518) (-780.074) [-784.183] (-779.055) * (-780.677) (-781.476) (-781.595) [-779.515] -- 0:01:09
      68000 -- (-779.634) (-779.895) [-781.566] (-780.165) * (-779.909) (-781.138) [-779.902] (-779.848) -- 0:01:08
      68500 -- (-779.682) [-782.122] (-781.747) (-780.694) * (-781.355) (-780.232) [-779.141] (-780.239) -- 0:01:07
      69000 -- (-780.374) (-779.956) [-779.862] (-780.786) * (-783.782) [-780.304] (-781.804) (-780.538) -- 0:01:07
      69500 -- (-779.375) (-780.812) (-782.216) [-783.467] * (-780.339) (-781.596) [-779.939] (-779.015) -- 0:01:06
      70000 -- (-780.151) [-781.216] (-782.938) (-781.190) * [-782.810] (-779.179) (-781.619) (-780.703) -- 0:01:06

      Average standard deviation of split frequencies: 0.026016

      70500 -- (-781.376) (-781.459) (-781.301) [-780.214] * (-780.864) [-781.846] (-779.906) (-781.053) -- 0:01:05
      71000 -- [-779.478] (-782.823) (-782.138) (-783.564) * (-780.802) [-780.650] (-780.790) (-778.535) -- 0:01:05
      71500 -- (-780.044) (-779.436) [-779.534] (-781.897) * (-782.661) [-780.781] (-779.735) (-779.819) -- 0:01:04
      72000 -- (-779.987) (-779.479) (-780.916) [-778.922] * (-779.817) (-781.388) (-780.532) [-779.745] -- 0:01:04
      72500 -- (-779.596) (-781.006) (-782.192) [-779.948] * (-779.370) [-781.177] (-779.597) (-780.384) -- 0:01:03
      73000 -- (-781.140) (-781.847) (-780.950) [-778.862] * [-782.402] (-779.597) (-779.601) (-779.982) -- 0:01:03
      73500 -- (-783.075) (-781.285) (-782.433) [-779.592] * (-784.141) (-779.500) (-779.701) [-781.831] -- 0:01:03
      74000 -- (-782.865) (-779.824) [-780.028] (-781.444) * (-781.144) (-780.988) [-780.347] (-780.720) -- 0:01:02
      74500 -- (-781.225) (-780.366) [-780.453] (-780.480) * (-780.396) [-781.390] (-782.285) (-780.435) -- 0:01:02
      75000 -- (-783.642) (-782.380) (-780.432) [-780.360] * (-780.112) [-783.557] (-781.875) (-781.285) -- 0:01:01

      Average standard deviation of split frequencies: 0.029463

      75500 -- (-780.157) (-781.454) [-783.135] (-780.251) * (-780.961) (-781.026) (-782.770) [-782.032] -- 0:01:01
      76000 -- (-779.646) [-778.783] (-784.833) (-780.000) * (-779.738) (-781.709) [-779.891] (-779.716) -- 0:01:00
      76500 -- (-780.706) [-781.358] (-782.581) (-780.681) * (-779.615) [-780.753] (-780.378) (-780.756) -- 0:01:00
      77000 -- [-779.970] (-780.877) (-785.435) (-779.366) * (-784.797) (-781.799) (-781.067) [-781.212] -- 0:00:59
      77500 -- [-783.698] (-781.379) (-782.157) (-780.417) * (-781.044) [-785.443] (-781.486) (-782.225) -- 0:00:59
      78000 -- [-783.380] (-781.147) (-782.215) (-779.730) * (-781.250) [-788.747] (-783.315) (-783.613) -- 0:00:59
      78500 -- (-780.990) [-780.888] (-779.677) (-781.098) * (-781.444) (-782.332) [-779.364] (-783.822) -- 0:00:58
      79000 -- (-782.199) (-780.958) (-780.837) [-781.147] * (-780.802) (-779.691) [-779.353] (-780.562) -- 0:00:58
      79500 -- (-782.455) (-780.055) [-781.152] (-782.735) * (-781.212) (-779.520) (-781.534) [-779.860] -- 0:00:57
      80000 -- (-781.849) [-780.460] (-780.719) (-780.217) * (-781.245) [-779.472] (-779.766) (-779.424) -- 0:00:57

      Average standard deviation of split frequencies: 0.030388

      80500 -- (-785.419) (-781.241) [-780.658] (-779.621) * [-782.361] (-779.508) (-779.447) (-779.862) -- 0:00:57
      81000 -- [-780.903] (-782.124) (-779.143) (-780.856) * [-780.384] (-780.034) (-781.212) (-778.878) -- 0:00:56
      81500 -- [-781.699] (-782.160) (-780.086) (-780.730) * [-778.942] (-784.487) (-780.642) (-785.007) -- 0:00:56
      82000 -- (-781.271) (-779.323) (-780.062) [-780.274] * (-779.364) (-782.738) [-780.027] (-780.634) -- 0:01:07
      82500 -- (-779.987) (-778.623) [-779.053] (-781.085) * (-782.387) [-781.178] (-780.738) (-783.819) -- 0:01:06
      83000 -- (-781.764) (-781.094) [-781.390] (-783.105) * [-780.441] (-781.538) (-779.986) (-783.677) -- 0:01:06
      83500 -- (-779.615) (-779.899) (-781.601) [-779.678] * [-779.715] (-779.320) (-782.632) (-780.512) -- 0:01:05
      84000 -- [-784.366] (-781.490) (-782.352) (-782.617) * (-779.973) [-780.089] (-782.484) (-781.127) -- 0:01:05
      84500 -- (-779.761) (-778.879) [-782.805] (-780.662) * (-779.509) (-784.212) [-779.608] (-781.089) -- 0:01:05
      85000 -- [-779.136] (-779.961) (-778.677) (-779.159) * [-783.440] (-780.025) (-780.998) (-783.835) -- 0:01:04

      Average standard deviation of split frequencies: 0.030148

      85500 -- (-779.299) [-782.235] (-779.959) (-779.776) * (-784.927) (-780.507) (-780.296) [-779.055] -- 0:01:04
      86000 -- [-779.386] (-779.671) (-783.582) (-780.433) * (-778.664) (-779.701) (-778.985) [-778.778] -- 0:01:03
      86500 -- (-780.052) (-782.300) (-780.310) [-781.702] * [-778.489] (-780.489) (-780.112) (-779.584) -- 0:01:03
      87000 -- [-780.921] (-779.879) (-779.601) (-780.547) * (-781.325) (-781.630) (-781.044) [-781.206] -- 0:01:02
      87500 -- (-780.875) [-778.707] (-779.838) (-780.690) * (-782.856) (-781.857) (-779.394) [-784.806] -- 0:01:02
      88000 -- (-780.401) (-780.282) (-779.808) [-781.686] * (-780.636) [-779.351] (-779.024) (-785.898) -- 0:01:02
      88500 -- (-780.054) (-782.127) [-778.677] (-780.502) * (-779.977) (-779.533) [-779.670] (-779.769) -- 0:01:01
      89000 -- [-779.256] (-780.424) (-779.165) (-780.773) * [-782.024] (-779.535) (-780.436) (-779.570) -- 0:01:01
      89500 -- (-780.806) (-779.947) (-779.749) [-781.935] * (-781.615) (-783.041) (-779.622) [-781.036] -- 0:01:01
      90000 -- [-780.779] (-778.915) (-779.481) (-783.178) * [-779.274] (-780.230) (-781.600) (-780.832) -- 0:01:00

      Average standard deviation of split frequencies: 0.029069

      90500 -- (-782.866) (-781.113) (-779.234) [-779.706] * (-780.977) (-779.937) [-780.476] (-784.176) -- 0:01:00
      91000 -- (-781.492) (-780.654) (-778.889) [-781.808] * (-780.762) (-779.039) [-779.953] (-783.544) -- 0:00:59
      91500 -- (-780.525) (-780.701) (-781.378) [-778.976] * (-780.225) (-779.555) (-782.882) [-782.268] -- 0:00:59
      92000 -- (-783.436) (-781.163) (-787.445) [-781.995] * (-779.941) (-780.756) [-781.584] (-784.841) -- 0:00:59
      92500 -- [-780.743] (-781.652) (-787.453) (-781.449) * (-784.126) [-779.702] (-780.785) (-779.788) -- 0:00:58
      93000 -- (-780.160) [-781.324] (-782.589) (-782.817) * (-789.102) (-778.817) (-780.034) [-779.673] -- 0:00:58
      93500 -- [-780.177] (-785.577) (-779.321) (-781.449) * (-783.759) (-784.234) (-784.338) [-781.082] -- 0:00:58
      94000 -- (-781.743) [-779.713] (-779.361) (-782.108) * (-783.074) [-780.488] (-786.287) (-779.685) -- 0:00:57
      94500 -- (-780.096) (-779.543) [-779.306] (-779.421) * (-782.350) [-782.253] (-780.269) (-781.225) -- 0:00:57
      95000 -- (-779.650) [-780.272] (-780.746) (-779.729) * [-778.901] (-782.732) (-786.343) (-785.948) -- 0:00:57

      Average standard deviation of split frequencies: 0.022767

      95500 -- (-780.096) (-780.641) [-780.232] (-779.723) * [-779.784] (-784.588) (-785.385) (-787.964) -- 0:00:56
      96000 -- [-780.657] (-782.342) (-780.590) (-784.901) * (-784.253) (-779.069) [-780.506] (-780.961) -- 0:00:56
      96500 -- [-780.603] (-779.902) (-779.391) (-780.757) * (-783.209) (-783.087) [-779.396] (-781.542) -- 0:00:56
      97000 -- (-780.272) [-778.957] (-780.599) (-784.687) * (-782.475) (-784.324) [-782.555] (-780.079) -- 0:00:55
      97500 -- (-780.042) (-778.611) [-780.492] (-787.586) * [-780.569] (-779.270) (-786.312) (-782.031) -- 0:01:04
      98000 -- [-778.688] (-779.961) (-780.796) (-781.441) * (-785.308) (-781.998) [-781.112] (-782.520) -- 0:01:04
      98500 -- [-779.385] (-780.073) (-781.650) (-780.023) * (-786.461) (-780.956) [-780.862] (-783.329) -- 0:01:04
      99000 -- (-779.295) (-779.470) [-782.193] (-781.154) * (-782.231) (-782.513) [-779.689] (-782.207) -- 0:01:03
      99500 -- (-779.112) (-779.567) (-781.001) [-782.103] * (-782.381) (-782.216) [-782.866] (-781.363) -- 0:01:03
      100000 -- (-782.624) [-779.084] (-781.631) (-781.683) * (-780.682) [-779.364] (-781.558) (-779.555) -- 0:01:02

      Average standard deviation of split frequencies: 0.019668

      100500 -- (-780.120) (-785.801) [-779.620] (-783.346) * (-779.008) [-780.375] (-780.590) (-781.972) -- 0:01:02
      101000 -- [-779.457] (-784.042) (-781.994) (-781.231) * (-780.749) (-781.797) [-782.851] (-782.214) -- 0:01:02
      101500 -- (-785.844) (-779.315) (-781.631) [-783.205] * [-781.396] (-779.781) (-781.099) (-779.799) -- 0:01:01
      102000 -- (-781.592) (-780.307) [-779.827] (-781.075) * (-779.148) (-779.761) (-779.771) [-780.118] -- 0:01:01
      102500 -- (-779.060) [-783.962] (-780.045) (-780.526) * (-780.540) (-782.100) (-783.442) [-779.758] -- 0:01:01
      103000 -- (-779.274) (-784.392) [-779.846] (-784.279) * (-787.750) (-781.387) [-783.074] (-779.724) -- 0:01:00
      103500 -- [-781.118] (-780.311) (-781.083) (-781.014) * [-785.445] (-782.052) (-781.799) (-780.241) -- 0:01:00
      104000 -- (-780.148) (-781.267) [-779.705] (-780.432) * (-779.148) [-779.978] (-780.732) (-781.354) -- 0:01:00
      104500 -- (-780.366) [-780.982] (-779.700) (-780.547) * (-779.913) [-784.123] (-780.940) (-782.456) -- 0:00:59
      105000 -- [-779.053] (-778.944) (-780.713) (-788.147) * (-785.102) (-781.793) [-782.384] (-781.646) -- 0:00:59

      Average standard deviation of split frequencies: 0.018678

      105500 -- (-780.061) (-779.952) [-780.650] (-782.718) * (-782.307) (-781.746) [-780.127] (-781.259) -- 0:00:59
      106000 -- (-783.437) (-779.810) [-780.469] (-780.128) * (-780.408) [-781.396] (-780.306) (-782.248) -- 0:00:59
      106500 -- (-779.111) [-780.909] (-780.489) (-782.182) * [-781.758] (-782.950) (-780.182) (-782.097) -- 0:00:58
      107000 -- (-780.781) (-779.318) (-782.588) [-779.167] * (-779.092) (-781.291) (-781.269) [-779.680] -- 0:00:58
      107500 -- (-778.855) (-781.608) [-779.376] (-784.151) * (-779.544) (-782.725) [-780.622] (-780.121) -- 0:00:58
      108000 -- (-782.953) (-779.577) [-779.031] (-778.775) * (-780.348) (-779.056) (-785.808) [-781.248] -- 0:00:57
      108500 -- (-782.052) (-780.528) [-780.173] (-783.391) * (-780.457) (-780.227) (-783.082) [-781.148] -- 0:00:57
      109000 -- [-780.603] (-780.780) (-783.725) (-784.285) * [-782.736] (-779.979) (-783.725) (-779.137) -- 0:00:57
      109500 -- [-780.827] (-781.165) (-779.118) (-781.368) * [-783.727] (-779.953) (-785.254) (-780.015) -- 0:00:56
      110000 -- (-781.541) (-784.662) [-779.158] (-779.660) * (-782.889) (-779.673) (-784.973) [-781.042] -- 0:00:56

      Average standard deviation of split frequencies: 0.020020

      110500 -- (-780.536) [-782.584] (-781.792) (-778.741) * [-781.540] (-780.181) (-779.267) (-781.688) -- 0:00:56
      111000 -- (-784.243) (-781.841) (-779.173) [-780.096] * [-781.009] (-782.699) (-779.604) (-779.620) -- 0:00:56
      111500 -- [-778.794] (-783.627) (-779.258) (-781.393) * (-779.866) (-781.573) (-783.090) [-778.897] -- 0:00:55
      112000 -- [-780.845] (-781.894) (-781.587) (-780.240) * (-781.444) (-784.722) (-789.832) [-780.070] -- 0:00:55
      112500 -- (-783.385) (-781.320) (-779.336) [-781.737] * (-781.135) (-783.023) (-780.952) [-784.194] -- 0:00:55
      113000 -- [-779.705] (-781.165) (-779.576) (-780.738) * (-780.653) (-780.790) (-779.941) [-780.442] -- 0:01:02
      113500 -- (-779.612) (-783.372) [-779.292] (-784.089) * (-783.287) [-779.742] (-780.371) (-782.597) -- 0:01:02
      114000 -- [-780.792] (-781.894) (-780.138) (-780.425) * [-779.938] (-780.849) (-779.435) (-781.645) -- 0:01:02
      114500 -- (-782.249) (-782.115) [-779.312] (-780.841) * (-778.974) (-781.055) [-778.576] (-781.484) -- 0:01:01
      115000 -- (-784.081) [-782.184] (-780.597) (-780.467) * (-781.429) (-782.661) (-779.034) [-778.706] -- 0:01:01

      Average standard deviation of split frequencies: 0.018084

      115500 -- (-791.408) (-785.360) (-781.108) [-780.322] * (-781.515) [-780.701] (-779.273) (-783.249) -- 0:01:01
      116000 -- [-783.032] (-782.968) (-780.882) (-787.942) * (-781.048) (-780.229) [-780.358] (-783.649) -- 0:01:00
      116500 -- (-785.097) [-779.468] (-781.980) (-783.753) * (-780.526) (-779.607) (-781.233) [-779.151] -- 0:01:00
      117000 -- (-782.108) (-783.017) [-778.976] (-785.179) * (-779.303) (-781.612) [-782.390] (-780.841) -- 0:01:00
      117500 -- (-784.515) [-778.642] (-778.640) (-781.801) * [-780.710] (-780.900) (-780.020) (-780.619) -- 0:01:00
      118000 -- [-779.101] (-779.798) (-778.680) (-782.290) * (-782.008) [-778.980] (-781.556) (-781.338) -- 0:00:59
      118500 -- (-781.816) (-779.193) (-779.913) [-779.718] * (-780.041) (-779.656) (-780.024) [-780.209] -- 0:00:59
      119000 -- (-781.054) [-779.925] (-781.473) (-779.367) * (-779.150) (-779.948) (-779.266) [-779.679] -- 0:00:59
      119500 -- [-780.173] (-780.985) (-778.800) (-779.403) * [-783.428] (-779.813) (-780.327) (-781.926) -- 0:00:58
      120000 -- [-780.915] (-781.487) (-780.267) (-781.549) * [-779.762] (-783.839) (-779.561) (-780.960) -- 0:00:58

      Average standard deviation of split frequencies: 0.018094

      120500 -- (-778.680) (-780.115) (-780.434) [-779.921] * [-780.456] (-782.771) (-783.133) (-779.088) -- 0:00:58
      121000 -- (-780.024) (-780.727) [-781.096] (-780.764) * (-781.215) (-782.223) [-779.485] (-779.537) -- 0:00:58
      121500 -- (-780.221) (-782.067) [-779.866] (-780.810) * [-782.693] (-784.411) (-781.562) (-779.055) -- 0:00:57
      122000 -- (-779.851) (-779.397) (-779.982) [-779.897] * (-781.752) [-784.908] (-781.558) (-781.116) -- 0:00:57
      122500 -- (-779.813) (-779.417) [-781.114] (-783.480) * [-780.669] (-782.288) (-783.601) (-779.145) -- 0:00:57
      123000 -- (-779.865) [-781.570] (-779.587) (-785.630) * (-779.747) [-780.177] (-784.840) (-779.613) -- 0:00:57
      123500 -- (-781.106) (-781.182) (-779.249) [-779.830] * [-780.425] (-779.689) (-786.305) (-779.805) -- 0:00:56
      124000 -- (-785.721) (-780.622) (-780.024) [-779.517] * [-782.708] (-779.907) (-780.622) (-779.508) -- 0:00:56
      124500 -- (-779.722) [-779.760] (-780.875) (-780.509) * (-780.573) [-781.149] (-782.986) (-782.402) -- 0:00:56
      125000 -- (-779.586) (-779.793) (-780.667) [-779.445] * (-780.284) (-778.771) (-779.182) [-780.901] -- 0:00:56

      Average standard deviation of split frequencies: 0.017994

      125500 -- (-780.483) (-781.953) [-780.659] (-779.971) * [-779.494] (-780.083) (-779.304) (-779.816) -- 0:00:55
      126000 -- (-780.376) (-787.270) [-780.562] (-780.442) * (-780.594) [-780.181] (-779.242) (-780.064) -- 0:00:55
      126500 -- (-780.504) [-780.537] (-782.555) (-781.021) * (-779.870) (-780.569) (-779.657) [-782.582] -- 0:00:55
      127000 -- (-782.003) [-782.429] (-782.220) (-783.053) * (-779.202) [-780.664] (-780.851) (-781.347) -- 0:00:54
      127500 -- (-781.114) (-780.896) (-778.762) [-780.982] * [-779.949] (-781.729) (-779.203) (-783.354) -- 0:00:54
      128000 -- [-782.407] (-779.920) (-780.448) (-779.693) * (-781.255) (-780.319) [-779.457] (-782.040) -- 0:00:54
      128500 -- (-783.848) (-780.360) [-779.814] (-781.587) * (-785.012) (-781.159) [-782.289] (-781.962) -- 0:00:54
      129000 -- (-779.347) (-780.520) (-779.577) [-785.169] * (-780.364) (-781.293) (-782.352) [-780.507] -- 0:01:00
      129500 -- (-778.913) [-782.430] (-781.484) (-784.398) * [-780.168] (-781.542) (-781.145) (-781.705) -- 0:01:00
      130000 -- (-779.335) [-781.832] (-779.011) (-781.318) * (-783.578) (-781.071) [-780.564] (-781.947) -- 0:01:00

      Average standard deviation of split frequencies: 0.014972

      130500 -- (-783.698) [-780.746] (-779.984) (-781.839) * (-786.514) (-781.643) [-780.114] (-780.220) -- 0:00:59
      131000 -- (-779.808) [-782.409] (-780.703) (-783.608) * (-781.024) [-780.525] (-780.396) (-779.844) -- 0:00:59
      131500 -- (-779.088) (-779.377) [-779.277] (-782.849) * (-781.247) (-784.202) [-779.079] (-779.835) -- 0:00:59
      132000 -- (-781.568) [-780.801] (-779.455) (-780.552) * [-783.628] (-785.629) (-781.398) (-780.071) -- 0:00:59
      132500 -- (-783.471) (-782.223) [-779.142] (-778.977) * (-783.111) (-781.592) [-778.681] (-780.586) -- 0:00:58
      133000 -- [-782.559] (-782.771) (-780.876) (-782.640) * (-781.040) [-779.433] (-779.512) (-780.958) -- 0:00:58
      133500 -- (-781.486) (-785.372) (-782.773) [-782.215] * (-778.964) (-782.436) [-778.822] (-789.107) -- 0:00:58
      134000 -- (-783.285) [-781.713] (-782.064) (-780.440) * (-781.221) [-778.622] (-779.627) (-787.249) -- 0:00:58
      134500 -- (-784.398) (-781.416) (-782.351) [-781.756] * [-781.397] (-779.288) (-781.025) (-784.110) -- 0:00:57
      135000 -- (-782.452) (-781.309) (-781.853) [-781.301] * (-782.096) (-791.236) [-782.216] (-781.884) -- 0:00:57

      Average standard deviation of split frequencies: 0.018243

      135500 -- (-780.602) [-779.854] (-782.987) (-783.125) * [-782.296] (-786.404) (-783.044) (-780.581) -- 0:00:57
      136000 -- [-779.522] (-783.515) (-780.458) (-780.731) * [-780.109] (-781.569) (-779.608) (-779.941) -- 0:00:57
      136500 -- (-780.047) (-781.469) (-781.344) [-778.912] * (-779.621) [-782.882] (-780.223) (-781.059) -- 0:00:56
      137000 -- (-779.620) (-781.200) [-784.592] (-783.378) * (-779.117) (-783.906) (-779.553) [-780.496] -- 0:00:56
      137500 -- (-779.491) [-780.668] (-784.322) (-779.409) * (-778.998) (-783.113) [-781.190] (-779.384) -- 0:00:56
      138000 -- (-780.115) (-781.019) (-782.643) [-779.728] * (-779.520) [-779.168] (-779.797) (-785.356) -- 0:00:56
      138500 -- (-779.941) (-781.242) (-780.855) [-779.881] * [-779.428] (-783.220) (-779.544) (-781.264) -- 0:00:55
      139000 -- (-779.638) (-784.772) [-783.548] (-779.917) * (-779.005) (-781.082) [-780.883] (-782.526) -- 0:00:55
      139500 -- (-785.845) (-784.332) (-782.580) [-781.802] * [-779.010] (-779.031) (-780.282) (-781.784) -- 0:00:55
      140000 -- (-780.690) [-780.882] (-782.305) (-780.206) * (-780.847) (-780.612) [-782.525] (-781.854) -- 0:00:55

      Average standard deviation of split frequencies: 0.016580

      140500 -- [-779.773] (-783.835) (-782.373) (-780.499) * [-779.117] (-782.057) (-779.714) (-781.254) -- 0:00:55
      141000 -- (-786.619) [-782.377] (-781.191) (-780.075) * [-778.851] (-782.230) (-779.379) (-784.368) -- 0:00:54
      141500 -- [-781.217] (-781.568) (-783.750) (-783.139) * (-778.775) (-779.515) [-780.132] (-779.579) -- 0:00:54
      142000 -- (-780.917) [-779.961] (-783.618) (-781.269) * (-779.012) (-781.433) (-779.953) [-778.990] -- 0:00:54
      142500 -- (-783.975) (-781.241) (-780.124) [-782.695] * (-780.306) (-780.718) [-783.536] (-780.145) -- 0:00:54
      143000 -- (-784.206) (-781.596) [-781.192] (-778.636) * [-779.413] (-779.905) (-783.407) (-782.925) -- 0:00:53
      143500 -- (-782.819) (-780.077) [-783.062] (-778.923) * [-781.878] (-782.358) (-787.856) (-780.016) -- 0:00:53
      144000 -- [-780.895] (-781.030) (-782.520) (-782.279) * (-780.344) (-782.545) [-779.278] (-782.190) -- 0:00:53
      144500 -- (-780.327) [-782.715] (-780.016) (-780.374) * [-779.953] (-782.389) (-779.557) (-780.712) -- 0:00:53
      145000 -- (-779.141) (-781.972) (-781.066) [-782.128] * (-779.771) [-784.501] (-780.517) (-780.282) -- 0:00:58

      Average standard deviation of split frequencies: 0.016438

      145500 -- [-780.112] (-782.593) (-782.191) (-780.596) * (-781.048) (-781.718) (-781.930) [-779.124] -- 0:00:58
      146000 -- (-780.702) (-780.287) [-780.963] (-779.353) * [-779.099] (-780.509) (-783.529) (-782.978) -- 0:00:58
      146500 -- [-778.898] (-780.721) (-782.237) (-780.273) * [-779.486] (-781.323) (-783.303) (-780.606) -- 0:00:58
      147000 -- (-779.152) [-781.463] (-783.889) (-780.169) * [-779.869] (-783.409) (-780.576) (-778.725) -- 0:00:58
      147500 -- (-779.638) (-780.583) (-781.861) [-780.317] * (-779.936) [-782.354] (-779.499) (-781.051) -- 0:00:57
      148000 -- (-781.121) [-783.086] (-782.034) (-780.387) * (-781.172) (-780.252) (-779.117) [-779.622] -- 0:00:57
      148500 -- (-783.203) (-779.671) (-783.840) [-780.081] * (-781.163) (-782.573) [-782.612] (-780.961) -- 0:00:57
      149000 -- (-779.597) (-783.011) (-785.093) [-780.136] * (-780.328) (-779.377) [-779.943] (-782.387) -- 0:00:57
      149500 -- [-782.787] (-778.793) (-794.356) (-779.912) * (-780.329) (-779.404) (-784.745) [-780.696] -- 0:00:56
      150000 -- (-781.860) [-779.491] (-783.863) (-782.538) * [-779.374] (-780.818) (-779.334) (-779.977) -- 0:00:56

      Average standard deviation of split frequencies: 0.015048

      150500 -- [-780.885] (-780.354) (-783.078) (-779.390) * [-780.156] (-778.928) (-779.956) (-781.493) -- 0:00:56
      151000 -- [-779.695] (-780.687) (-779.544) (-784.997) * [-779.304] (-781.534) (-780.792) (-779.330) -- 0:00:56
      151500 -- (-780.111) (-780.583) [-779.307] (-783.116) * (-780.503) (-781.379) [-779.870] (-786.539) -- 0:00:56
      152000 -- (-783.588) (-780.634) [-780.859] (-781.045) * (-780.205) (-782.866) [-779.272] (-787.851) -- 0:00:55
      152500 -- (-784.352) (-779.919) [-783.339] (-783.532) * (-780.926) (-784.474) (-779.439) [-783.029] -- 0:00:55
      153000 -- (-784.354) (-784.120) (-780.309) [-781.762] * (-781.143) (-783.239) [-779.233] (-779.912) -- 0:00:55
      153500 -- (-779.744) [-781.634] (-780.356) (-780.316) * [-778.575] (-780.512) (-779.119) (-779.876) -- 0:00:55
      154000 -- [-780.245] (-782.428) (-781.270) (-789.070) * (-778.735) [-782.775] (-782.199) (-778.813) -- 0:00:54
      154500 -- (-778.964) [-779.788] (-782.639) (-791.134) * [-779.421] (-780.813) (-786.027) (-779.545) -- 0:00:54
      155000 -- (-779.607) [-780.264] (-781.330) (-782.135) * (-779.473) (-779.802) [-783.899] (-778.632) -- 0:00:54

      Average standard deviation of split frequencies: 0.014677

      155500 -- (-779.462) (-781.286) (-781.162) [-780.553] * (-779.327) (-781.107) [-781.438] (-779.579) -- 0:00:54
      156000 -- [-780.289] (-781.953) (-779.572) (-782.279) * [-779.946] (-781.473) (-779.166) (-779.008) -- 0:00:54
      156500 -- (-780.306) (-780.984) [-781.378] (-780.539) * (-780.509) (-781.571) (-780.339) [-778.989] -- 0:00:53
      157000 -- [-779.314] (-779.878) (-785.809) (-780.382) * (-782.087) (-779.349) [-780.262] (-779.481) -- 0:00:53
      157500 -- (-780.421) (-779.874) (-778.754) [-780.381] * [-779.711] (-779.668) (-779.592) (-780.275) -- 0:00:53
      158000 -- (-779.558) (-781.980) (-780.009) [-780.440] * [-780.433] (-784.089) (-780.586) (-782.611) -- 0:00:53
      158500 -- (-779.290) [-781.935] (-782.184) (-781.191) * [-780.579] (-782.939) (-780.910) (-781.662) -- 0:00:53
      159000 -- (-779.147) (-781.802) (-779.911) [-781.310] * (-785.058) (-780.569) [-781.588] (-781.662) -- 0:00:52
      159500 -- [-779.439] (-781.699) (-782.085) (-783.655) * (-783.014) (-778.684) [-779.231] (-778.827) -- 0:00:52
      160000 -- [-779.982] (-782.820) (-782.309) (-783.856) * (-782.347) (-781.006) (-780.849) [-780.455] -- 0:00:52

      Average standard deviation of split frequencies: 0.013133

      160500 -- [-779.123] (-780.896) (-780.530) (-780.777) * (-780.477) [-781.406] (-780.257) (-782.391) -- 0:00:52
      161000 -- (-780.344) (-780.439) (-788.390) [-780.289] * (-782.799) (-784.364) (-781.330) [-782.001] -- 0:00:57
      161500 -- [-780.095] (-783.550) (-784.311) (-785.576) * (-779.534) (-785.258) (-780.710) [-780.044] -- 0:00:57
      162000 -- (-779.919) [-780.554] (-782.884) (-782.321) * (-780.985) (-779.413) [-780.267] (-783.031) -- 0:00:56
      162500 -- (-779.272) [-780.735] (-782.072) (-779.984) * (-778.840) (-779.193) (-781.413) [-783.873] -- 0:00:56
      163000 -- (-783.710) [-779.727] (-780.492) (-780.949) * (-781.631) [-780.257] (-781.553) (-781.250) -- 0:00:56
      163500 -- [-787.290] (-780.672) (-780.486) (-780.351) * [-780.513] (-781.037) (-780.383) (-784.340) -- 0:00:56
      164000 -- (-781.026) [-779.525] (-780.652) (-780.845) * [-782.454] (-780.067) (-780.446) (-781.413) -- 0:00:56
      164500 -- [-779.097] (-778.916) (-781.405) (-780.064) * (-784.824) (-779.712) [-779.783] (-783.383) -- 0:00:55
      165000 -- (-781.771) (-778.692) [-779.218] (-780.495) * (-787.945) (-780.812) [-781.033] (-780.771) -- 0:00:55

      Average standard deviation of split frequencies: 0.014973

      165500 -- [-783.923] (-779.544) (-783.671) (-779.946) * [-779.787] (-781.359) (-779.906) (-782.070) -- 0:00:55
      166000 -- (-780.701) [-780.100] (-780.815) (-781.019) * (-779.215) (-779.700) (-780.646) [-780.445] -- 0:00:55
      166500 -- (-781.871) (-780.776) (-782.641) [-780.571] * (-781.990) (-781.013) (-779.552) [-780.778] -- 0:00:55
      167000 -- (-782.370) (-779.640) [-780.523] (-779.731) * (-782.873) (-780.978) [-783.577] (-780.598) -- 0:00:54
      167500 -- (-782.373) [-784.411] (-779.754) (-781.313) * (-779.973) (-781.975) (-783.632) [-781.526] -- 0:00:54
      168000 -- (-780.050) [-780.261] (-780.007) (-779.932) * (-781.883) (-786.217) [-778.825] (-781.486) -- 0:00:54
      168500 -- (-782.691) (-781.452) [-780.035] (-781.066) * (-780.403) (-780.865) [-783.266] (-780.576) -- 0:00:54
      169000 -- [-780.624] (-783.051) (-780.998) (-781.387) * (-781.974) (-780.530) (-780.599) [-780.785] -- 0:00:54
      169500 -- [-779.515] (-781.201) (-784.196) (-781.160) * (-780.737) (-783.686) [-779.629] (-781.793) -- 0:00:53
      170000 -- [-780.187] (-782.665) (-780.301) (-780.325) * [-779.222] (-780.606) (-779.807) (-780.785) -- 0:00:53

      Average standard deviation of split frequencies: 0.014205

      170500 -- (-779.395) [-780.785] (-780.828) (-780.794) * [-780.158] (-783.341) (-780.787) (-781.273) -- 0:00:53
      171000 -- (-779.418) [-779.641] (-779.193) (-779.126) * (-779.264) (-782.615) [-783.845] (-782.001) -- 0:00:53
      171500 -- (-782.940) (-782.725) (-779.473) [-779.688] * (-779.831) [-781.392] (-783.476) (-780.146) -- 0:00:53
      172000 -- [-782.459] (-782.915) (-784.762) (-779.964) * (-779.410) (-780.573) (-779.477) [-781.886] -- 0:00:52
      172500 -- (-779.755) (-783.661) (-783.796) [-778.970] * (-780.347) [-780.784] (-780.795) (-783.706) -- 0:00:52
      173000 -- (-779.554) (-781.798) [-781.292] (-781.044) * (-781.329) (-780.065) [-779.027] (-785.297) -- 0:00:52
      173500 -- (-782.379) [-780.536] (-779.776) (-787.250) * (-779.150) [-781.297] (-784.705) (-779.256) -- 0:00:52
      174000 -- (-780.793) (-780.624) [-781.742] (-778.948) * [-780.600] (-780.951) (-779.305) (-781.033) -- 0:00:52
      174500 -- (-781.900) (-779.460) [-779.540] (-778.790) * [-781.551] (-782.167) (-783.861) (-783.009) -- 0:00:52
      175000 -- (-780.202) [-779.701] (-782.119) (-780.549) * (-779.588) (-780.826) [-779.979] (-788.963) -- 0:00:51

      Average standard deviation of split frequencies: 0.013520

      175500 -- (-779.185) (-780.381) (-782.018) [-780.658] * (-781.207) [-779.562] (-780.739) (-786.438) -- 0:00:51
      176000 -- (-781.135) (-781.207) [-781.652] (-782.991) * (-783.100) (-779.846) [-781.167] (-781.114) -- 0:00:51
      176500 -- (-781.264) [-782.203] (-781.265) (-784.264) * (-783.761) (-779.774) [-781.501] (-784.248) -- 0:00:51
      177000 -- (-780.823) (-779.994) (-781.071) [-785.545] * (-782.095) (-781.098) (-782.163) [-781.372] -- 0:00:55
      177500 -- [-782.738] (-778.778) (-782.491) (-779.789) * (-782.624) (-783.063) [-780.482] (-784.464) -- 0:00:55
      178000 -- [-779.783] (-784.369) (-782.934) (-781.858) * (-779.717) (-781.884) [-780.366] (-786.631) -- 0:00:55
      178500 -- (-779.368) [-782.149] (-780.008) (-781.630) * (-779.160) (-782.407) [-781.414] (-783.382) -- 0:00:55
      179000 -- (-780.530) (-781.559) (-782.214) [-781.246] * (-780.988) (-779.874) (-780.905) [-783.528] -- 0:00:55
      179500 -- [-780.132] (-780.943) (-782.085) (-781.103) * [-779.598] (-780.585) (-778.897) (-781.338) -- 0:00:54
      180000 -- (-780.595) [-780.721] (-779.473) (-782.674) * (-779.904) [-782.345] (-781.823) (-787.780) -- 0:00:54

      Average standard deviation of split frequencies: 0.013568

      180500 -- (-779.863) (-779.660) [-780.105] (-781.157) * (-779.060) (-780.317) [-780.823] (-783.478) -- 0:00:54
      181000 -- (-778.912) [-782.026] (-784.924) (-780.691) * [-779.724] (-779.965) (-781.626) (-779.484) -- 0:00:54
      181500 -- (-779.413) (-785.068) (-782.863) [-779.889] * (-779.787) (-779.766) [-779.239] (-781.125) -- 0:00:54
      182000 -- (-781.353) [-781.591] (-782.765) (-780.253) * (-782.603) [-787.653] (-779.699) (-780.063) -- 0:00:53
      182500 -- [-781.687] (-783.475) (-783.555) (-782.318) * [-783.564] (-781.683) (-781.579) (-780.619) -- 0:00:53
      183000 -- (-785.581) [-781.947] (-782.676) (-781.179) * [-781.451] (-779.749) (-780.950) (-779.700) -- 0:00:53
      183500 -- (-779.180) (-780.096) [-781.801] (-782.732) * [-780.005] (-780.537) (-784.877) (-779.642) -- 0:00:53
      184000 -- (-779.272) (-782.577) [-780.029] (-783.082) * [-780.899] (-782.908) (-782.033) (-780.152) -- 0:00:53
      184500 -- (-780.259) [-779.916] (-780.399) (-782.531) * (-781.605) (-781.759) [-780.232] (-780.314) -- 0:00:53
      185000 -- (-779.682) (-786.337) (-779.869) [-781.199] * (-782.816) (-787.532) [-781.086] (-780.154) -- 0:00:52

      Average standard deviation of split frequencies: 0.014241

      185500 -- (-783.406) (-782.656) (-778.480) [-780.677] * (-782.845) (-781.642) (-781.879) [-778.823] -- 0:00:52
      186000 -- (-782.503) (-788.704) [-780.075] (-782.984) * (-780.017) [-782.110] (-783.956) (-778.932) -- 0:00:52
      186500 -- (-779.726) (-785.362) [-779.855] (-783.006) * [-783.894] (-779.265) (-779.182) (-780.546) -- 0:00:52
      187000 -- [-779.188] (-785.680) (-780.181) (-780.266) * (-782.872) (-787.345) [-779.659] (-784.303) -- 0:00:52
      187500 -- (-779.387) (-780.232) [-786.511] (-781.543) * [-779.823] (-779.083) (-781.488) (-781.508) -- 0:00:52
      188000 -- [-779.354] (-782.005) (-786.041) (-782.274) * (-779.542) (-778.546) (-783.078) [-781.803] -- 0:00:51
      188500 -- (-781.469) (-783.068) (-786.209) [-779.072] * (-784.401) (-779.531) [-780.050] (-780.702) -- 0:00:51
      189000 -- (-782.125) [-782.285] (-782.781) (-782.777) * (-782.371) (-779.278) (-783.752) [-779.325] -- 0:00:51
      189500 -- (-779.781) [-781.906] (-780.930) (-781.250) * [-781.062] (-779.934) (-781.166) (-780.886) -- 0:00:51
      190000 -- (-780.825) (-780.788) (-781.057) [-787.386] * [-779.864] (-782.393) (-779.512) (-780.441) -- 0:00:51

      Average standard deviation of split frequencies: 0.012980

      190500 -- (-779.772) (-781.250) [-781.250] (-787.049) * (-779.161) (-780.599) [-780.606] (-779.654) -- 0:00:50
      191000 -- (-780.055) (-779.844) (-780.438) [-779.610] * (-779.593) (-785.388) (-780.745) [-779.162] -- 0:00:50
      191500 -- (-778.899) (-781.689) [-782.467] (-779.404) * [-779.072] (-782.926) (-780.594) (-779.214) -- 0:00:50
      192000 -- (-782.068) [-781.196] (-780.684) (-780.035) * (-779.228) (-783.078) (-782.368) [-780.712] -- 0:00:50
      192500 -- (-779.184) (-778.882) (-780.992) [-781.241] * (-780.271) [-783.717] (-781.158) (-780.459) -- 0:00:50
      193000 -- (-779.924) [-781.151] (-782.578) (-780.783) * (-784.032) (-782.417) (-780.166) [-779.957] -- 0:00:54
      193500 -- (-780.017) (-779.463) (-780.588) [-779.747] * (-782.350) (-783.176) [-780.521] (-786.533) -- 0:00:54
      194000 -- (-778.992) (-780.726) (-779.619) [-781.707] * (-779.507) (-780.783) (-780.187) [-780.075] -- 0:00:54
      194500 -- (-779.223) (-782.466) (-782.910) [-781.223] * (-780.139) (-783.557) (-780.438) [-780.324] -- 0:00:53
      195000 -- (-780.574) [-781.726] (-784.122) (-781.371) * (-781.048) (-779.594) (-781.041) [-781.013] -- 0:00:53

      Average standard deviation of split frequencies: 0.012026

      195500 -- (-781.584) (-781.008) [-780.293] (-782.067) * (-780.167) (-779.794) (-781.555) [-780.506] -- 0:00:53
      196000 -- (-783.414) (-780.117) [-780.930] (-780.824) * (-778.927) (-782.189) [-782.244] (-782.497) -- 0:00:53
      196500 -- (-783.475) (-779.457) [-780.769] (-783.358) * [-779.458] (-783.648) (-783.417) (-781.686) -- 0:00:53
      197000 -- (-779.348) [-780.067] (-781.463) (-781.163) * (-781.274) (-780.807) [-784.842] (-782.694) -- 0:00:52
      197500 -- (-779.671) (-778.871) [-779.510] (-781.761) * (-781.233) (-786.297) [-780.444] (-782.217) -- 0:00:52
      198000 -- (-779.702) [-781.077] (-779.506) (-782.212) * (-785.155) [-781.967] (-786.615) (-781.319) -- 0:00:52
      198500 -- (-780.081) (-779.066) (-780.492) [-780.506] * (-782.480) [-778.865] (-783.164) (-781.212) -- 0:00:52
      199000 -- [-781.230] (-779.466) (-781.329) (-780.319) * (-780.545) [-778.828] (-781.166) (-783.301) -- 0:00:52
      199500 -- [-779.689] (-781.280) (-781.561) (-779.932) * (-779.763) [-780.841] (-780.543) (-781.089) -- 0:00:52
      200000 -- [-782.034] (-780.726) (-781.180) (-784.169) * (-784.768) (-780.966) [-786.913] (-781.609) -- 0:00:51

      Average standard deviation of split frequencies: 0.011276

      200500 -- (-782.751) [-780.662] (-786.764) (-781.403) * (-786.396) (-780.455) (-780.628) [-779.203] -- 0:00:51
      201000 -- (-779.080) (-781.221) [-783.333] (-781.510) * [-780.394] (-780.579) (-779.942) (-779.550) -- 0:00:51
      201500 -- [-779.005] (-781.135) (-782.294) (-784.993) * (-780.103) (-781.955) [-779.577] (-781.125) -- 0:00:51
      202000 -- [-780.811] (-780.142) (-782.151) (-779.104) * (-780.709) (-780.398) [-778.954] (-779.267) -- 0:00:51
      202500 -- (-779.760) (-780.041) (-785.310) [-779.680] * [-779.606] (-782.384) (-779.500) (-779.078) -- 0:00:51
      203000 -- (-778.878) [-779.540] (-780.969) (-781.556) * [-780.205] (-782.001) (-786.056) (-779.206) -- 0:00:51
      203500 -- [-779.065] (-778.468) (-780.067) (-780.570) * (-783.019) (-781.722) [-780.482] (-779.125) -- 0:00:50
      204000 -- (-782.231) (-779.252) [-780.055] (-782.223) * (-783.069) [-779.806] (-780.984) (-782.261) -- 0:00:50
      204500 -- (-784.074) (-780.115) [-780.479] (-781.585) * (-782.331) (-780.911) (-779.836) [-780.441] -- 0:00:50
      205000 -- (-781.253) (-780.699) (-781.039) [-781.855] * (-779.512) (-780.500) [-781.175] (-781.453) -- 0:00:50

      Average standard deviation of split frequencies: 0.009840

      205500 -- (-779.441) (-779.090) [-779.258] (-782.478) * [-781.387] (-781.161) (-782.960) (-780.491) -- 0:00:50
      206000 -- (-778.747) (-783.255) [-785.169] (-782.637) * (-782.395) [-781.332] (-781.440) (-779.093) -- 0:00:50
      206500 -- (-779.876) (-781.277) (-782.352) [-780.196] * [-781.217] (-782.997) (-779.711) (-781.964) -- 0:00:49
      207000 -- (-780.227) (-781.409) (-779.752) [-779.714] * (-779.872) [-780.039] (-779.169) (-781.411) -- 0:00:49
      207500 -- [-780.342] (-780.337) (-778.768) (-779.415) * (-779.518) [-781.599] (-782.934) (-782.850) -- 0:00:49
      208000 -- (-780.019) (-781.378) [-782.066] (-781.408) * [-785.036] (-783.150) (-780.505) (-781.910) -- 0:00:49
      208500 -- [-780.437] (-780.910) (-781.456) (-782.164) * [-781.101] (-780.524) (-782.395) (-783.915) -- 0:00:49
      209000 -- (-781.476) (-784.729) [-783.111] (-782.730) * (-779.624) (-778.633) [-780.133] (-784.481) -- 0:00:52
      209500 -- (-783.855) (-786.836) [-781.319] (-779.941) * [-780.300] (-779.686) (-780.150) (-780.553) -- 0:00:52
      210000 -- (-781.023) (-782.450) [-780.319] (-779.418) * (-780.708) [-783.584] (-779.593) (-783.638) -- 0:00:52

      Average standard deviation of split frequencies: 0.009398

      210500 -- (-782.302) (-781.855) (-779.827) [-779.319] * [-779.268] (-782.046) (-782.038) (-784.434) -- 0:00:52
      211000 -- (-782.909) (-781.495) (-780.302) [-779.618] * (-783.961) (-779.144) (-781.386) [-779.466] -- 0:00:52
      211500 -- (-780.642) (-781.029) (-781.472) [-780.400] * (-781.326) (-779.681) (-780.346) [-780.635] -- 0:00:52
      212000 -- (-789.689) (-780.252) (-781.180) [-781.552] * [-780.341] (-780.541) (-779.946) (-780.370) -- 0:00:52
      212500 -- (-785.766) (-779.538) [-779.064] (-780.278) * (-784.142) (-778.811) [-780.092] (-781.000) -- 0:00:51
      213000 -- [-783.680] (-779.973) (-780.559) (-780.511) * (-780.360) (-780.132) (-780.520) [-780.501] -- 0:00:51
      213500 -- (-780.841) [-780.395] (-781.628) (-781.077) * [-780.370] (-780.666) (-779.916) (-779.211) -- 0:00:51
      214000 -- (-779.899) [-780.953] (-779.395) (-782.353) * (-780.053) [-782.087] (-779.736) (-779.552) -- 0:00:51
      214500 -- (-779.139) (-783.985) [-779.483] (-785.576) * (-782.518) (-783.065) [-779.063] (-780.122) -- 0:00:51
      215000 -- (-779.315) (-781.433) [-779.081] (-785.098) * [-783.389] (-779.599) (-780.510) (-779.734) -- 0:00:51

      Average standard deviation of split frequencies: 0.010223

      215500 -- (-778.793) [-781.303] (-779.097) (-780.823) * (-781.314) (-783.595) [-779.757] (-784.282) -- 0:00:50
      216000 -- [-782.595] (-781.060) (-779.341) (-779.820) * (-779.336) (-785.447) (-780.791) [-780.772] -- 0:00:50
      216500 -- [-779.854] (-780.137) (-781.273) (-781.436) * [-779.986] (-781.036) (-781.843) (-780.647) -- 0:00:50
      217000 -- [-779.923] (-785.665) (-781.328) (-781.020) * [-778.564] (-780.910) (-780.032) (-782.400) -- 0:00:50
      217500 -- (-780.985) [-782.844] (-779.542) (-781.630) * (-781.184) (-779.915) [-782.098] (-781.517) -- 0:00:50
      218000 -- (-779.378) (-780.365) [-779.393] (-778.536) * (-780.850) (-781.241) (-783.465) [-779.699] -- 0:00:50
      218500 -- (-781.286) (-780.190) [-779.286] (-778.927) * [-779.479] (-783.879) (-779.535) (-780.884) -- 0:00:50
      219000 -- (-782.664) (-781.695) (-779.856) [-781.813] * (-780.375) [-780.383] (-779.493) (-779.699) -- 0:00:49
      219500 -- (-779.807) (-780.325) (-780.032) [-779.340] * (-779.284) (-779.456) [-780.478] (-784.828) -- 0:00:49
      220000 -- (-780.230) (-781.646) [-781.379] (-779.933) * [-778.839] (-780.065) (-779.586) (-779.753) -- 0:00:49

      Average standard deviation of split frequencies: 0.010468

      220500 -- (-779.653) [-780.009] (-780.680) (-778.653) * (-781.451) [-780.635] (-781.141) (-780.865) -- 0:00:49
      221000 -- [-780.733] (-780.863) (-781.425) (-780.617) * [-779.970] (-779.925) (-783.875) (-784.635) -- 0:00:49
      221500 -- (-782.183) (-783.340) [-781.169] (-779.919) * (-781.319) (-780.127) [-781.671] (-782.709) -- 0:00:49
      222000 -- (-783.149) (-780.484) (-783.119) [-782.094] * (-780.189) (-780.243) (-784.125) [-779.687] -- 0:00:49
      222500 -- [-781.956] (-781.295) (-779.394) (-780.305) * (-784.523) (-780.919) (-782.271) [-780.011] -- 0:00:48
      223000 -- (-784.473) [-779.647] (-782.119) (-781.568) * (-784.878) (-780.187) [-781.795] (-780.766) -- 0:00:52
      223500 -- (-781.543) (-780.331) (-778.986) [-780.038] * (-781.848) (-780.073) [-781.804] (-781.133) -- 0:00:52
      224000 -- (-781.245) [-780.775] (-780.053) (-784.633) * (-784.033) (-780.610) (-781.660) [-781.631] -- 0:00:51
      224500 -- (-779.555) [-782.567] (-784.547) (-781.554) * [-785.786] (-779.508) (-781.137) (-779.248) -- 0:00:51
      225000 -- (-780.304) (-782.887) [-780.844] (-784.064) * (-779.460) [-779.681] (-779.291) (-779.816) -- 0:00:51

      Average standard deviation of split frequencies: 0.011785

      225500 -- (-782.156) (-781.033) (-781.128) [-783.542] * (-785.617) (-784.579) (-782.294) [-783.004] -- 0:00:51
      226000 -- (-782.794) [-780.550] (-782.282) (-784.836) * (-780.672) (-784.560) (-784.702) [-779.213] -- 0:00:51
      226500 -- [-780.024] (-780.754) (-786.276) (-781.814) * (-778.975) (-785.758) (-781.037) [-778.977] -- 0:00:51
      227000 -- (-781.537) (-781.991) [-781.018] (-783.732) * (-783.595) (-781.253) (-781.833) [-779.513] -- 0:00:51
      227500 -- [-781.182] (-779.348) (-781.791) (-783.890) * (-781.857) (-783.520) [-780.087] (-779.670) -- 0:00:50
      228000 -- (-782.227) [-779.234] (-782.231) (-780.862) * (-780.295) (-780.112) [-780.329] (-780.075) -- 0:00:50
      228500 -- (-779.271) (-779.419) (-784.157) [-779.699] * (-780.144) (-784.853) (-782.947) [-781.599] -- 0:00:50
      229000 -- [-779.271] (-779.728) (-779.941) (-779.919) * (-780.362) (-783.504) (-779.698) [-780.353] -- 0:00:50
      229500 -- (-781.462) (-779.368) (-782.974) [-780.025] * (-779.039) (-780.425) [-781.209] (-782.030) -- 0:00:50
      230000 -- (-778.947) (-779.421) (-779.921) [-779.947] * (-784.158) (-780.991) (-782.068) [-781.762] -- 0:00:50

      Average standard deviation of split frequencies: 0.011832

      230500 -- (-783.500) (-783.590) (-778.802) [-778.835] * [-780.543] (-780.493) (-781.920) (-779.246) -- 0:00:50
      231000 -- (-780.265) (-784.338) (-780.220) [-780.207] * (-780.534) [-780.343] (-780.379) (-780.627) -- 0:00:49
      231500 -- [-781.319] (-782.777) (-779.889) (-781.525) * (-781.692) (-779.002) (-781.698) [-781.289] -- 0:00:49
      232000 -- (-778.744) (-783.350) (-778.879) [-785.181] * (-781.186) (-780.794) [-780.908] (-781.168) -- 0:00:49
      232500 -- (-779.705) (-780.322) (-779.229) [-778.970] * [-782.055] (-782.463) (-780.903) (-784.123) -- 0:00:49
      233000 -- (-778.453) (-779.170) (-787.092) [-780.917] * [-779.672] (-780.364) (-780.088) (-783.403) -- 0:00:49
      233500 -- (-779.753) (-779.495) (-781.052) [-779.366] * [-782.190] (-780.850) (-779.926) (-782.161) -- 0:00:49
      234000 -- (-782.809) (-781.306) (-780.603) [-781.175] * [-781.896] (-779.405) (-785.116) (-780.575) -- 0:00:49
      234500 -- [-780.062] (-782.874) (-780.823) (-780.090) * (-782.470) (-781.835) [-785.304] (-779.671) -- 0:00:48
      235000 -- [-779.634] (-783.103) (-782.875) (-785.974) * (-780.183) (-780.985) [-779.760] (-782.208) -- 0:00:48

      Average standard deviation of split frequencies: 0.011459

      235500 -- (-779.964) (-784.810) [-780.167] (-781.178) * (-779.899) [-781.262] (-779.850) (-779.617) -- 0:00:48
      236000 -- (-781.118) (-782.385) [-784.350] (-779.446) * (-780.388) (-780.787) [-779.421] (-779.142) -- 0:00:48
      236500 -- (-788.148) (-779.464) (-780.585) [-780.723] * [-783.142] (-780.350) (-781.437) (-784.727) -- 0:00:48
      237000 -- (-783.641) (-780.175) [-783.105] (-780.220) * [-781.084] (-780.638) (-784.687) (-781.621) -- 0:00:48
      237500 -- (-780.910) [-782.723] (-779.274) (-780.835) * (-789.200) (-781.982) [-781.817] (-780.011) -- 0:00:48
      238000 -- [-779.526] (-781.319) (-779.658) (-781.013) * (-782.612) (-785.820) (-783.531) [-780.061] -- 0:00:48
      238500 -- (-779.236) [-780.795] (-780.813) (-781.510) * [-782.665] (-782.042) (-782.683) (-780.325) -- 0:00:51
      239000 -- (-780.486) [-778.914] (-783.113) (-780.425) * (-780.708) (-781.160) [-780.790] (-781.585) -- 0:00:50
      239500 -- [-780.128] (-783.360) (-780.552) (-779.787) * (-779.534) (-780.876) (-780.475) [-780.748] -- 0:00:50
      240000 -- (-782.276) (-781.046) [-784.050] (-779.127) * (-780.990) (-781.401) [-779.845] (-783.029) -- 0:00:50

      Average standard deviation of split frequencies: 0.011031

      240500 -- [-779.980] (-780.227) (-785.584) (-780.273) * [-780.774] (-780.800) (-780.685) (-780.644) -- 0:00:50
      241000 -- (-781.078) (-780.771) (-779.770) [-784.943] * (-779.101) (-782.928) [-779.028] (-780.442) -- 0:00:50
      241500 -- (-779.109) [-780.077] (-782.544) (-783.165) * (-780.956) (-780.475) [-784.078] (-779.609) -- 0:00:50
      242000 -- [-778.855] (-783.851) (-780.218) (-782.464) * (-781.217) (-780.237) (-782.006) [-780.895] -- 0:00:50
      242500 -- [-781.111] (-788.261) (-779.901) (-782.084) * (-781.551) (-783.543) [-781.206] (-780.024) -- 0:00:49
      243000 -- [-780.856] (-780.368) (-780.737) (-782.020) * [-782.561] (-784.143) (-783.557) (-783.799) -- 0:00:49
      243500 -- (-783.974) (-780.193) (-780.508) [-778.883] * (-785.636) (-780.596) (-779.143) [-779.550] -- 0:00:49
      244000 -- (-783.391) (-780.211) (-782.430) [-778.812] * (-780.630) (-783.688) [-779.925] (-782.080) -- 0:00:49
      244500 -- (-782.066) (-780.312) [-782.922] (-780.498) * (-784.888) (-783.818) [-782.466] (-780.876) -- 0:00:49
      245000 -- (-785.116) (-781.426) (-783.124) [-779.756] * (-782.677) (-781.592) (-781.346) [-779.956] -- 0:00:49

      Average standard deviation of split frequencies: 0.010348

      245500 -- (-779.626) (-780.029) (-783.008) [-780.868] * (-782.154) [-785.327] (-781.653) (-781.444) -- 0:00:49
      246000 -- [-779.682] (-780.780) (-782.690) (-780.379) * [-781.647] (-782.679) (-780.356) (-779.596) -- 0:00:49
      246500 -- [-781.202] (-780.422) (-780.802) (-780.111) * (-785.828) (-782.784) [-782.030] (-781.027) -- 0:00:48
      247000 -- [-781.960] (-781.099) (-780.857) (-779.962) * [-780.575] (-782.036) (-780.221) (-785.907) -- 0:00:48
      247500 -- (-779.306) [-779.893] (-780.726) (-778.778) * [-780.970] (-780.319) (-782.716) (-782.166) -- 0:00:48
      248000 -- (-779.224) [-782.228] (-782.572) (-783.490) * [-781.457] (-779.453) (-780.518) (-780.441) -- 0:00:48
      248500 -- (-781.577) (-785.645) (-781.345) [-782.132] * [-779.829] (-779.442) (-779.473) (-781.042) -- 0:00:48
      249000 -- [-780.800] (-782.669) (-779.002) (-781.295) * (-779.640) [-780.000] (-780.596) (-780.777) -- 0:00:48
      249500 -- (-784.686) [-783.052] (-779.181) (-781.412) * (-784.471) [-781.939] (-781.242) (-783.066) -- 0:00:48
      250000 -- (-780.379) (-780.590) [-781.999] (-779.169) * (-784.563) (-779.084) (-780.853) [-779.518] -- 0:00:48

      Average standard deviation of split frequencies: 0.008518

      250500 -- [-781.198] (-778.938) (-782.264) (-782.195) * (-780.989) (-780.019) (-783.387) [-781.220] -- 0:00:47
      251000 -- (-781.916) (-779.649) [-781.378] (-780.680) * [-780.275] (-781.924) (-780.418) (-779.165) -- 0:00:47
      251500 -- (-781.119) [-779.965] (-780.938) (-781.919) * (-778.960) (-783.752) (-782.809) [-779.746] -- 0:00:47
      252000 -- (-780.244) (-780.611) [-782.574] (-786.046) * (-780.816) (-779.806) (-779.956) [-780.317] -- 0:00:47
      252500 -- (-784.076) [-780.405] (-780.538) (-784.526) * (-789.147) [-780.584] (-782.885) (-780.698) -- 0:00:47
      253000 -- (-788.012) (-785.200) (-782.216) [-784.988] * (-779.211) (-782.053) [-780.234] (-781.501) -- 0:00:47
      253500 -- (-781.647) (-782.855) [-779.743] (-781.019) * [-779.102] (-783.478) (-780.687) (-781.449) -- 0:00:47
      254000 -- (-778.876) (-779.177) (-780.858) [-780.754] * (-779.051) (-781.288) (-780.606) [-779.907] -- 0:00:49
      254500 -- (-782.918) [-779.177] (-782.943) (-783.830) * (-778.894) (-780.202) (-781.917) [-779.186] -- 0:00:49
      255000 -- (-781.651) (-781.616) (-779.338) [-782.850] * (-781.631) (-781.005) [-783.050] (-780.934) -- 0:00:49

      Average standard deviation of split frequencies: 0.010182

      255500 -- [-782.082] (-782.584) (-780.513) (-782.380) * (-782.260) [-782.195] (-779.657) (-780.756) -- 0:00:49
      256000 -- [-780.464] (-780.710) (-780.475) (-781.103) * (-780.270) (-780.508) (-779.344) [-782.790] -- 0:00:49
      256500 -- (-781.341) [-781.949] (-780.330) (-779.156) * [-782.417] (-782.450) (-779.481) (-782.871) -- 0:00:49
      257000 -- (-778.826) [-780.342] (-780.095) (-781.105) * (-779.795) (-781.463) [-781.162] (-785.784) -- 0:00:49
      257500 -- [-779.499] (-781.889) (-780.885) (-779.703) * (-781.182) (-780.988) [-778.786] (-785.843) -- 0:00:49
      258000 -- (-779.913) [-780.760] (-780.072) (-780.585) * [-779.370] (-781.075) (-779.442) (-779.731) -- 0:00:48
      258500 -- (-779.335) (-782.479) (-783.340) [-782.451] * (-779.636) [-780.702] (-779.635) (-780.023) -- 0:00:48
      259000 -- (-782.729) (-783.461) (-779.678) [-781.049] * (-782.344) [-782.211] (-779.200) (-781.039) -- 0:00:48
      259500 -- (-782.127) (-779.325) (-783.544) [-781.654] * [-781.954] (-782.995) (-781.980) (-787.156) -- 0:00:48
      260000 -- (-778.882) [-779.395] (-779.279) (-781.079) * (-779.116) (-782.920) (-779.662) [-779.789] -- 0:00:48

      Average standard deviation of split frequencies: 0.010957

      260500 -- (-782.680) [-779.264] (-780.795) (-780.245) * (-782.776) (-782.500) [-783.263] (-779.822) -- 0:00:48
      261000 -- (-787.278) (-783.640) (-784.122) [-781.717] * (-782.605) (-780.046) (-784.254) [-785.023] -- 0:00:48
      261500 -- [-782.014] (-780.737) (-781.036) (-779.192) * (-783.862) (-779.102) (-785.385) [-782.591] -- 0:00:48
      262000 -- (-780.540) (-782.113) [-782.277] (-779.658) * [-780.687] (-779.443) (-781.516) (-782.437) -- 0:00:47
      262500 -- (-787.559) [-782.018] (-779.529) (-779.271) * [-780.364] (-779.662) (-786.887) (-779.159) -- 0:00:47
      263000 -- [-780.842] (-784.011) (-780.719) (-783.236) * (-781.081) [-782.080] (-782.656) (-781.341) -- 0:00:47
      263500 -- (-779.045) (-780.298) [-780.608] (-779.640) * (-781.475) (-780.721) [-781.340] (-779.801) -- 0:00:47
      264000 -- [-779.277] (-782.094) (-781.924) (-779.411) * (-780.908) (-783.015) [-782.210] (-780.100) -- 0:00:47
      264500 -- (-779.138) [-782.706] (-780.236) (-780.108) * (-781.884) (-780.313) (-779.398) [-781.801] -- 0:00:47
      265000 -- (-779.452) [-784.687] (-780.411) (-784.388) * (-781.218) [-779.489] (-786.893) (-784.273) -- 0:00:47

      Average standard deviation of split frequencies: 0.010112

      265500 -- (-778.888) (-783.594) (-781.765) [-779.249] * [-779.658] (-782.159) (-779.429) (-780.164) -- 0:00:47
      266000 -- (-780.243) (-779.404) [-778.980] (-779.434) * (-781.263) (-780.289) [-781.816] (-781.072) -- 0:00:46
      266500 -- (-781.121) (-779.240) (-779.370) [-779.897] * (-783.551) (-782.074) (-780.044) [-780.202] -- 0:00:46
      267000 -- (-782.037) (-781.530) [-779.337] (-787.051) * [-785.496] (-781.536) (-781.264) (-781.252) -- 0:00:46
      267500 -- (-781.768) (-783.181) [-779.851] (-784.040) * (-780.938) [-780.534] (-784.150) (-786.249) -- 0:00:46
      268000 -- [-780.097] (-781.214) (-781.344) (-782.350) * (-783.423) (-781.535) (-786.386) [-780.356] -- 0:00:46
      268500 -- (-780.097) (-782.982) (-782.492) [-780.518] * (-783.218) (-782.656) (-783.555) [-779.670] -- 0:00:46
      269000 -- (-780.510) (-782.060) (-783.463) [-778.976] * (-781.809) (-781.364) (-780.169) [-780.184] -- 0:00:46
      269500 -- (-784.683) (-780.695) (-781.638) [-780.011] * [-780.298] (-780.950) (-782.927) (-779.634) -- 0:00:46
      270000 -- (-779.880) [-780.244] (-781.464) (-785.511) * [-781.220] (-782.732) (-779.545) (-781.637) -- 0:00:48

      Average standard deviation of split frequencies: 0.009323

      270500 -- (-779.245) [-784.411] (-779.038) (-780.992) * [-781.377] (-780.782) (-782.239) (-782.538) -- 0:00:48
      271000 -- (-780.182) [-784.376] (-779.970) (-780.149) * (-779.703) (-781.440) [-779.782] (-781.512) -- 0:00:48
      271500 -- (-780.754) [-779.829] (-780.531) (-781.157) * [-779.478] (-782.291) (-780.467) (-779.154) -- 0:00:48
      272000 -- [-779.361] (-779.365) (-780.161) (-780.271) * (-779.671) (-780.303) [-779.657] (-779.736) -- 0:00:48
      272500 -- (-779.159) (-787.833) [-780.805] (-783.284) * (-780.905) [-780.867] (-784.403) (-783.114) -- 0:00:48
      273000 -- [-779.959] (-792.921) (-780.473) (-781.620) * [-781.031] (-784.098) (-779.333) (-779.833) -- 0:00:47
      273500 -- (-782.569) (-782.823) (-781.805) [-780.630] * [-779.634] (-779.045) (-780.415) (-781.064) -- 0:00:47
      274000 -- (-783.447) [-781.303] (-779.258) (-780.318) * (-780.957) (-788.716) [-779.895] (-782.844) -- 0:00:47
      274500 -- (-780.321) (-782.864) [-779.248] (-782.184) * [-779.480] (-780.823) (-784.539) (-780.793) -- 0:00:47
      275000 -- (-780.031) (-780.069) [-782.554] (-778.756) * [-780.204] (-780.649) (-780.484) (-780.670) -- 0:00:47

      Average standard deviation of split frequencies: 0.010533

      275500 -- (-779.905) (-786.846) (-785.529) [-779.561] * [-781.296] (-781.577) (-779.796) (-781.168) -- 0:00:47
      276000 -- [-780.548] (-782.262) (-784.169) (-780.749) * (-780.061) (-783.017) (-781.867) [-780.312] -- 0:00:47
      276500 -- [-782.254] (-780.093) (-782.662) (-781.826) * (-782.527) (-783.177) (-779.535) [-779.155] -- 0:00:47
      277000 -- (-779.627) (-781.120) [-781.815] (-782.181) * (-781.327) (-790.262) (-779.411) [-779.496] -- 0:00:46
      277500 -- (-780.367) (-782.668) [-782.248] (-780.790) * (-782.632) (-782.423) (-780.612) [-779.084] -- 0:00:46
      278000 -- (-781.245) (-780.498) [-781.626] (-779.658) * (-782.626) (-779.531) [-779.882] (-780.373) -- 0:00:46
      278500 -- (-782.362) [-780.789] (-779.859) (-779.263) * (-781.322) (-780.369) (-781.078) [-780.080] -- 0:00:46
      279000 -- (-784.200) (-782.159) [-779.175] (-780.004) * (-781.811) (-782.419) (-778.720) [-780.159] -- 0:00:46
      279500 -- (-781.613) (-779.724) [-779.981] (-779.571) * [-784.833] (-779.667) (-781.265) (-780.418) -- 0:00:46
      280000 -- (-780.915) (-780.794) [-781.015] (-782.252) * (-782.858) [-779.063] (-781.800) (-782.990) -- 0:00:46

      Average standard deviation of split frequencies: 0.009424

      280500 -- [-780.279] (-780.210) (-779.660) (-779.604) * (-783.102) (-780.844) [-783.939] (-781.450) -- 0:00:46
      281000 -- (-779.571) [-780.647] (-779.834) (-781.436) * (-781.090) (-782.134) [-784.810] (-783.212) -- 0:00:46
      281500 -- (-781.112) [-782.007] (-780.755) (-780.268) * [-778.827] (-779.556) (-783.034) (-786.028) -- 0:00:45
      282000 -- (-781.400) (-781.832) [-782.397] (-780.578) * (-779.005) (-781.899) (-780.065) [-780.463] -- 0:00:45
      282500 -- (-781.450) (-781.354) [-781.261] (-782.963) * [-780.988] (-783.080) (-779.523) (-781.268) -- 0:00:45
      283000 -- (-780.833) (-780.899) (-780.150) [-779.867] * (-782.944) (-781.505) (-779.611) [-780.386] -- 0:00:45
      283500 -- (-780.389) (-780.157) (-781.826) [-780.796] * (-784.899) (-782.430) (-779.133) [-781.664] -- 0:00:45
      284000 -- (-780.280) (-779.318) (-781.167) [-782.074] * [-781.359] (-781.544) (-780.156) (-780.217) -- 0:00:45
      284500 -- (-780.130) [-779.370] (-782.766) (-780.176) * (-780.232) (-780.958) [-781.972] (-781.207) -- 0:00:45
      285000 -- (-779.814) (-778.892) [-782.309] (-779.249) * (-782.599) (-781.481) (-780.659) [-778.649] -- 0:00:45

      Average standard deviation of split frequencies: 0.010073

      285500 -- [-779.094] (-778.682) (-780.794) (-782.376) * [-781.327] (-782.916) (-779.500) (-780.972) -- 0:00:47
      286000 -- (-779.595) (-779.422) (-779.882) [-780.623] * (-780.368) (-779.033) (-781.334) [-779.845] -- 0:00:47
      286500 -- (-781.976) [-779.074] (-779.532) (-786.700) * (-780.598) (-781.946) (-779.563) [-780.705] -- 0:00:47
      287000 -- [-781.903] (-779.380) (-779.816) (-779.583) * (-782.765) (-781.222) (-779.099) [-783.824] -- 0:00:47
      287500 -- (-780.327) (-780.138) [-784.481] (-779.510) * [-780.985] (-780.220) (-782.536) (-780.182) -- 0:00:47
      288000 -- (-784.248) [-781.255] (-786.022) (-779.120) * (-780.008) [-779.077] (-783.643) (-785.078) -- 0:00:46
      288500 -- (-781.218) [-781.421] (-780.553) (-779.808) * (-782.865) (-781.901) [-781.778] (-780.127) -- 0:00:46
      289000 -- (-782.094) (-781.809) [-780.150] (-781.444) * (-779.156) (-781.508) [-779.744] (-779.958) -- 0:00:46
      289500 -- (-780.060) (-780.967) [-779.666] (-780.758) * (-781.833) (-781.521) [-782.013] (-782.891) -- 0:00:46
      290000 -- (-783.979) [-781.167] (-779.955) (-779.830) * (-779.198) (-782.754) [-782.100] (-779.575) -- 0:00:46

      Average standard deviation of split frequencies: 0.009816

      290500 -- [-780.518] (-783.408) (-781.412) (-779.220) * (-780.440) (-779.447) [-781.195] (-780.980) -- 0:00:46
      291000 -- (-779.907) (-779.829) [-779.939] (-781.784) * [-779.211] (-781.962) (-781.820) (-781.297) -- 0:00:46
      291500 -- [-779.492] (-782.864) (-782.407) (-779.915) * (-783.413) (-780.421) (-779.472) [-779.903] -- 0:00:46
      292000 -- [-779.026] (-781.560) (-780.278) (-779.054) * (-780.222) [-779.661] (-780.864) (-779.684) -- 0:00:46
      292500 -- [-785.066] (-781.031) (-784.264) (-780.376) * (-780.730) (-781.721) [-779.658] (-782.967) -- 0:00:45
      293000 -- [-782.487] (-781.764) (-781.131) (-780.759) * (-781.388) [-782.198] (-782.447) (-783.224) -- 0:00:45
      293500 -- (-784.415) (-780.900) [-779.696] (-782.416) * (-780.697) (-780.068) [-780.954] (-781.046) -- 0:00:45
      294000 -- (-786.312) [-781.685] (-782.443) (-779.748) * (-780.270) (-781.279) (-779.274) [-779.678] -- 0:00:45
      294500 -- [-782.378] (-781.754) (-782.085) (-779.459) * (-783.687) [-781.852] (-779.231) (-779.938) -- 0:00:45
      295000 -- (-782.485) (-786.452) [-781.760] (-779.508) * (-783.391) [-781.895] (-783.122) (-779.227) -- 0:00:45

      Average standard deviation of split frequencies: 0.009909

      295500 -- (-784.877) (-781.158) [-781.942] (-780.574) * (-781.851) (-782.232) [-781.308] (-780.605) -- 0:00:45
      296000 -- [-781.198] (-781.858) (-780.004) (-780.831) * (-779.469) (-786.855) [-779.716] (-783.203) -- 0:00:45
      296500 -- (-783.314) [-782.373] (-779.535) (-783.575) * (-781.497) (-782.077) [-779.725] (-780.590) -- 0:00:45
      297000 -- [-782.630] (-780.444) (-780.625) (-781.443) * (-780.234) (-783.063) [-779.725] (-780.231) -- 0:00:44
      297500 -- (-780.358) (-778.759) (-782.830) [-782.517] * (-780.072) (-781.448) [-778.962] (-778.662) -- 0:00:44
      298000 -- (-781.465) [-779.903] (-780.816) (-780.711) * (-779.723) (-781.129) (-779.722) [-780.535] -- 0:00:44
      298500 -- [-780.650] (-780.252) (-778.843) (-781.144) * (-779.043) (-780.471) [-782.375] (-785.529) -- 0:00:44
      299000 -- (-782.180) (-784.823) (-782.522) [-780.413] * (-778.926) [-779.142] (-779.931) (-783.314) -- 0:00:44
      299500 -- (-782.131) [-778.670] (-782.038) (-779.473) * [-779.020] (-779.219) (-781.313) (-781.699) -- 0:00:44
      300000 -- (-780.350) (-778.685) (-779.616) [-781.199] * (-780.912) (-782.686) [-782.022] (-780.113) -- 0:00:44

      Average standard deviation of split frequencies: 0.010053

      300500 -- (-781.498) [-779.284] (-781.128) (-784.424) * [-782.260] (-784.992) (-780.993) (-781.647) -- 0:00:44
      301000 -- (-781.287) (-782.265) [-781.662] (-780.173) * (-783.278) [-780.440] (-781.157) (-779.345) -- 0:00:46
      301500 -- [-780.963] (-778.721) (-780.132) (-780.418) * (-779.527) (-780.550) [-781.665] (-780.225) -- 0:00:46
      302000 -- (-780.511) (-785.331) (-781.062) [-781.189] * (-785.605) [-780.106] (-781.304) (-779.813) -- 0:00:46
      302500 -- (-782.413) (-783.583) (-782.895) [-781.045] * (-779.893) (-780.349) [-778.639] (-780.233) -- 0:00:46
      303000 -- (-779.819) (-788.141) (-782.223) [-779.149] * (-781.206) (-782.957) [-782.555] (-781.452) -- 0:00:46
      303500 -- (-781.509) (-782.480) [-782.631] (-780.658) * (-781.392) (-782.383) (-780.446) [-783.256] -- 0:00:45
      304000 -- (-782.312) (-781.759) (-782.809) [-780.274] * (-784.424) [-780.356] (-780.339) (-779.718) -- 0:00:45
      304500 -- (-780.541) (-781.430) [-784.242] (-779.955) * (-779.477) (-779.996) (-779.357) [-781.202] -- 0:00:45
      305000 -- (-782.113) (-779.903) (-780.411) [-780.541] * [-780.045] (-778.808) (-782.188) (-782.296) -- 0:00:45

      Average standard deviation of split frequencies: 0.011270

      305500 -- (-781.980) (-780.776) (-779.086) [-780.236] * (-780.202) (-784.554) (-783.078) [-781.037] -- 0:00:45
      306000 -- [-783.952] (-781.419) (-779.882) (-782.347) * (-779.892) [-781.200] (-778.740) (-783.334) -- 0:00:45
      306500 -- (-789.090) (-784.300) (-780.828) [-783.071] * (-782.972) (-783.725) [-779.211] (-782.178) -- 0:00:45
      307000 -- (-784.727) [-784.443] (-781.001) (-780.102) * (-783.320) (-785.949) (-781.185) [-782.323] -- 0:00:45
      307500 -- [-779.949] (-783.176) (-787.615) (-783.914) * (-787.460) (-782.001) (-779.404) [-780.527] -- 0:00:45
      308000 -- [-783.575] (-782.165) (-781.920) (-779.852) * [-780.650] (-779.731) (-779.933) (-780.813) -- 0:00:44
      308500 -- (-782.128) (-781.366) (-782.608) [-779.884] * (-779.588) (-779.393) [-779.952] (-781.138) -- 0:00:44
      309000 -- [-779.941] (-782.874) (-783.026) (-780.476) * (-779.738) [-779.581] (-780.042) (-781.712) -- 0:00:44
      309500 -- (-779.207) [-780.410] (-784.686) (-780.365) * [-779.795] (-779.433) (-783.687) (-780.396) -- 0:00:44
      310000 -- [-778.936] (-782.420) (-783.896) (-781.812) * [-781.101] (-779.847) (-781.123) (-780.291) -- 0:00:44

      Average standard deviation of split frequencies: 0.011886

      310500 -- (-779.066) (-781.126) (-780.911) [-781.370] * [-782.460] (-779.616) (-781.104) (-780.777) -- 0:00:44
      311000 -- (-781.773) [-780.501] (-780.572) (-779.497) * (-780.229) (-781.472) (-785.382) [-779.574] -- 0:00:44
      311500 -- [-779.197] (-779.347) (-782.266) (-780.639) * (-782.506) (-781.783) [-782.297] (-779.133) -- 0:00:44
      312000 -- (-781.072) (-780.493) (-782.975) [-780.892] * (-780.033) (-780.009) [-780.288] (-780.883) -- 0:00:44
      312500 -- [-780.490] (-780.459) (-781.710) (-781.657) * (-780.194) [-779.753] (-781.338) (-780.603) -- 0:00:44
      313000 -- (-788.264) [-782.098] (-783.830) (-780.620) * (-782.435) [-779.058] (-781.195) (-781.057) -- 0:00:43
      313500 -- (-781.004) (-781.498) [-780.702] (-783.041) * (-781.321) (-782.466) [-781.967] (-782.753) -- 0:00:43
      314000 -- (-783.235) (-781.727) (-780.527) [-780.920] * (-782.332) [-782.293] (-779.824) (-781.168) -- 0:00:43
      314500 -- [-783.983] (-780.205) (-780.367) (-783.466) * [-778.691] (-779.761) (-779.751) (-784.978) -- 0:00:43
      315000 -- (-780.910) [-783.659] (-779.735) (-781.106) * (-778.906) (-780.381) [-782.978] (-782.101) -- 0:00:43

      Average standard deviation of split frequencies: 0.009779

      315500 -- (-782.981) [-783.980] (-780.517) (-781.078) * (-780.487) (-781.937) (-782.007) [-780.260] -- 0:00:43
      316000 -- (-784.178) (-785.632) [-779.935] (-783.854) * [-780.864] (-781.806) (-786.207) (-779.682) -- 0:00:43
      316500 -- (-783.305) [-781.445] (-780.032) (-781.828) * [-779.386] (-780.591) (-780.404) (-781.553) -- 0:00:45
      317000 -- (-784.172) (-785.742) [-781.507] (-781.948) * [-779.510] (-783.269) (-780.434) (-779.373) -- 0:00:45
      317500 -- (-782.533) [-780.295] (-782.469) (-780.164) * [-779.013] (-785.499) (-782.418) (-779.914) -- 0:00:45
      318000 -- [-780.579] (-785.279) (-782.298) (-779.186) * [-782.419] (-781.387) (-778.862) (-779.824) -- 0:00:45
      318500 -- (-788.158) (-779.377) [-779.573] (-780.301) * (-784.998) (-779.718) (-779.507) [-780.770] -- 0:00:44
      319000 -- (-778.881) [-779.684] (-780.500) (-780.913) * (-781.776) (-782.061) (-780.689) [-780.812] -- 0:00:44
      319500 -- [-782.271] (-781.555) (-780.127) (-782.111) * (-782.704) (-780.529) [-779.509] (-784.547) -- 0:00:44
      320000 -- [-779.122] (-781.746) (-782.267) (-781.052) * (-779.895) (-782.083) (-779.331) [-782.203] -- 0:00:44

      Average standard deviation of split frequencies: 0.009253

      320500 -- [-779.037] (-780.706) (-779.063) (-784.647) * (-781.762) (-782.593) [-778.681] (-779.631) -- 0:00:44
      321000 -- [-778.854] (-785.094) (-782.561) (-782.831) * [-780.267] (-779.304) (-780.098) (-779.916) -- 0:00:44
      321500 -- (-781.699) [-781.990] (-779.392) (-781.833) * [-782.197] (-779.362) (-778.920) (-780.275) -- 0:00:44
      322000 -- [-779.435] (-779.641) (-781.765) (-781.770) * (-779.677) [-783.093] (-780.575) (-782.085) -- 0:00:44
      322500 -- (-779.912) [-781.274] (-781.762) (-788.142) * (-781.908) [-781.350] (-782.696) (-781.667) -- 0:00:44
      323000 -- (-780.210) [-780.884] (-779.973) (-789.134) * (-782.868) [-780.654] (-781.623) (-780.258) -- 0:00:44
      323500 -- (-780.251) [-781.103] (-779.326) (-789.317) * (-782.112) (-782.881) (-781.454) [-780.235] -- 0:00:43
      324000 -- (-784.626) [-782.596] (-779.283) (-781.003) * [-780.501] (-787.776) (-779.757) (-785.998) -- 0:00:43
      324500 -- [-780.665] (-779.753) (-779.275) (-783.224) * (-779.845) (-786.199) (-779.989) [-781.486] -- 0:00:43
      325000 -- (-785.630) [-784.248] (-781.132) (-785.313) * (-782.734) (-780.098) [-781.437] (-781.171) -- 0:00:43

      Average standard deviation of split frequencies: 0.008676

      325500 -- [-779.853] (-781.044) (-780.996) (-780.044) * (-779.442) (-780.660) (-780.811) [-778.738] -- 0:00:43
      326000 -- (-779.622) [-781.913] (-781.566) (-780.820) * (-780.115) (-780.534) (-780.523) [-783.272] -- 0:00:43
      326500 -- [-779.925] (-779.742) (-780.977) (-782.555) * (-779.525) (-784.400) (-781.567) [-781.554] -- 0:00:43
      327000 -- [-780.867] (-779.149) (-783.230) (-783.423) * (-781.694) [-782.078] (-780.220) (-781.080) -- 0:00:43
      327500 -- (-780.441) [-779.905] (-782.934) (-785.652) * [-782.052] (-782.241) (-780.328) (-782.484) -- 0:00:43
      328000 -- (-781.312) (-779.045) (-781.422) [-781.369] * (-783.225) (-779.301) [-780.683] (-784.318) -- 0:00:43
      328500 -- (-781.848) (-783.361) (-779.000) [-780.841] * (-785.409) [-780.201] (-779.793) (-779.834) -- 0:00:42
      329000 -- (-783.734) (-781.898) [-782.941] (-782.575) * (-780.709) [-783.004] (-782.701) (-780.729) -- 0:00:42
      329500 -- (-781.579) (-783.097) [-780.038] (-780.541) * [-783.271] (-785.494) (-779.190) (-780.253) -- 0:00:42
      330000 -- (-783.989) (-784.927) [-779.931] (-780.656) * (-781.220) (-784.314) (-780.103) [-779.391] -- 0:00:42

      Average standard deviation of split frequencies: 0.008302

      330500 -- (-782.018) (-783.336) [-778.639] (-780.405) * (-784.619) (-785.177) (-779.900) [-780.232] -- 0:00:42
      331000 -- (-781.232) [-780.225] (-778.776) (-780.677) * (-780.668) (-782.458) (-781.637) [-779.413] -- 0:00:42
      331500 -- (-782.031) [-781.724] (-778.775) (-779.906) * (-784.302) [-783.140] (-780.918) (-781.270) -- 0:00:44
      332000 -- (-780.087) [-779.168] (-779.030) (-782.735) * [-781.545] (-781.245) (-779.036) (-782.991) -- 0:00:44
      332500 -- (-780.834) (-778.910) (-783.571) [-779.736] * (-781.697) (-780.979) [-779.136] (-783.216) -- 0:00:44
      333000 -- (-780.326) (-783.951) (-780.770) [-780.258] * (-779.611) (-780.150) [-781.373] (-781.437) -- 0:00:44
      333500 -- [-779.293] (-783.837) (-780.641) (-779.754) * [-779.267] (-780.066) (-782.563) (-780.134) -- 0:00:43
      334000 -- (-779.173) (-779.087) [-785.436] (-779.319) * [-784.284] (-780.112) (-786.329) (-780.605) -- 0:00:43
      334500 -- (-778.654) [-783.442] (-781.337) (-781.054) * (-780.086) [-783.346] (-786.156) (-779.438) -- 0:00:43
      335000 -- (-781.874) [-781.563] (-778.903) (-780.501) * (-781.923) (-779.622) [-781.996] (-784.591) -- 0:00:43

      Average standard deviation of split frequencies: 0.010055

      335500 -- [-779.003] (-782.443) (-781.098) (-782.290) * (-781.934) [-778.925] (-780.199) (-786.742) -- 0:00:43
      336000 -- (-781.545) (-779.654) (-779.892) [-779.464] * (-779.303) [-781.886] (-782.159) (-782.721) -- 0:00:43
      336500 -- (-779.712) (-781.443) (-779.897) [-781.092] * (-782.215) (-779.822) [-780.786] (-780.365) -- 0:00:43
      337000 -- (-783.950) [-782.182] (-779.986) (-780.755) * (-782.131) (-779.576) (-779.224) [-779.795] -- 0:00:43
      337500 -- (-781.089) (-781.520) [-779.501] (-781.744) * [-779.415] (-779.476) (-783.330) (-780.395) -- 0:00:43
      338000 -- (-781.845) (-779.975) (-779.130) [-782.288] * (-780.238) [-779.971] (-785.461) (-780.829) -- 0:00:43
      338500 -- (-785.071) (-779.584) [-779.915] (-779.813) * (-781.634) [-780.967] (-786.704) (-781.416) -- 0:00:42
      339000 -- (-783.486) (-780.987) (-785.792) [-781.055] * (-779.159) [-780.167] (-782.523) (-782.170) -- 0:00:42
      339500 -- (-786.239) (-783.600) (-784.690) [-779.825] * (-778.666) [-782.962] (-781.760) (-788.338) -- 0:00:42
      340000 -- (-779.349) (-782.629) [-783.602] (-779.598) * (-780.473) (-779.379) [-780.846] (-786.501) -- 0:00:42

      Average standard deviation of split frequencies: 0.009605

      340500 -- (-783.319) [-782.667] (-779.894) (-780.629) * [-781.055] (-780.534) (-780.297) (-786.389) -- 0:00:42
      341000 -- (-784.113) (-779.044) [-779.206] (-779.983) * (-784.651) (-782.784) [-780.174] (-783.260) -- 0:00:42
      341500 -- (-782.260) [-785.839] (-779.924) (-782.578) * [-780.643] (-782.727) (-780.606) (-784.508) -- 0:00:42
      342000 -- (-782.421) [-778.987] (-779.957) (-785.183) * (-780.540) (-781.188) [-779.307] (-779.225) -- 0:00:42
      342500 -- [-779.743] (-784.390) (-778.914) (-780.174) * [-779.432] (-788.066) (-780.311) (-781.306) -- 0:00:42
      343000 -- (-779.929) [-779.346] (-780.351) (-780.071) * (-779.395) [-782.454] (-780.210) (-780.911) -- 0:00:42
      343500 -- [-781.825] (-780.419) (-782.955) (-782.748) * [-780.171] (-781.336) (-778.932) (-779.790) -- 0:00:42
      344000 -- (-779.917) [-780.816] (-780.109) (-779.784) * (-781.012) [-781.726] (-781.610) (-779.045) -- 0:00:41
      344500 -- (-781.769) (-784.516) (-780.758) [-780.603] * (-781.627) [-780.365] (-784.526) (-781.590) -- 0:00:41
      345000 -- [-779.804] (-783.168) (-781.969) (-784.655) * (-784.380) [-781.831] (-780.242) (-781.004) -- 0:00:41

      Average standard deviation of split frequencies: 0.011104

      345500 -- [-782.867] (-782.281) (-781.947) (-781.080) * (-785.374) (-780.329) (-780.214) [-782.264] -- 0:00:41
      346000 -- [-781.318] (-780.243) (-785.346) (-782.874) * (-780.787) [-779.331] (-781.865) (-783.193) -- 0:00:41
      346500 -- (-783.085) [-779.485] (-782.561) (-781.542) * (-782.067) (-779.983) (-782.121) [-780.614] -- 0:00:41
      347000 -- (-780.883) (-781.929) (-781.999) [-782.152] * [-778.762] (-780.179) (-780.960) (-782.089) -- 0:00:41
      347500 -- (-779.167) [-779.564] (-781.764) (-782.868) * (-780.455) [-780.814] (-778.861) (-783.174) -- 0:00:41
      348000 -- (-780.415) (-779.800) [-781.031] (-786.254) * [-778.672] (-782.320) (-782.545) (-780.779) -- 0:00:43
      348500 -- (-786.960) (-780.451) (-781.283) [-781.860] * [-779.143] (-782.724) (-782.940) (-781.672) -- 0:00:42
      349000 -- (-783.201) (-780.238) (-778.912) [-782.743] * (-778.626) [-785.773] (-785.012) (-781.785) -- 0:00:42
      349500 -- (-782.270) [-781.832] (-779.460) (-780.617) * (-779.875) (-779.373) [-779.348] (-779.995) -- 0:00:42
      350000 -- (-782.641) [-780.125] (-779.624) (-782.238) * (-779.876) (-784.439) (-780.193) [-780.316] -- 0:00:42

      Average standard deviation of split frequencies: 0.010043

      350500 -- (-783.412) (-782.598) (-778.949) [-781.803] * (-781.442) [-786.778] (-779.755) (-781.307) -- 0:00:42
      351000 -- (-780.779) (-782.353) [-779.291] (-781.916) * [-780.832] (-780.888) (-779.585) (-780.671) -- 0:00:42
      351500 -- [-781.144] (-780.076) (-782.799) (-782.012) * [-780.278] (-785.988) (-781.304) (-780.425) -- 0:00:42
      352000 -- (-782.030) (-785.226) (-781.914) [-780.948] * (-783.879) [-783.659] (-779.541) (-782.142) -- 0:00:42
      352500 -- (-779.800) (-781.745) (-781.557) [-778.906] * (-781.871) (-780.857) (-781.631) [-779.263] -- 0:00:42
      353000 -- [-781.375] (-785.943) (-778.491) (-781.341) * (-778.970) (-781.413) [-779.065] (-781.650) -- 0:00:42
      353500 -- (-782.393) [-779.131] (-780.339) (-779.332) * [-782.224] (-783.543) (-779.508) (-779.811) -- 0:00:42
      354000 -- (-778.965) (-781.159) [-780.380] (-782.832) * (-782.148) (-780.210) (-783.360) [-781.954] -- 0:00:41
      354500 -- [-778.897] (-779.460) (-782.561) (-782.036) * (-785.722) (-779.632) [-779.534] (-780.495) -- 0:00:41
      355000 -- (-779.462) (-784.532) [-778.708] (-781.922) * [-780.984] (-779.192) (-782.288) (-780.777) -- 0:00:41

      Average standard deviation of split frequencies: 0.009490

      355500 -- [-779.430] (-780.716) (-780.073) (-779.808) * (-779.692) (-779.088) (-781.449) [-780.144] -- 0:00:41
      356000 -- (-780.603) (-780.138) [-778.726] (-779.693) * [-779.166] (-782.111) (-785.610) (-788.882) -- 0:00:41
      356500 -- (-780.876) [-779.672] (-778.445) (-780.413) * [-778.998] (-783.531) (-781.244) (-783.864) -- 0:00:41
      357000 -- (-784.471) (-779.920) (-779.104) [-781.956] * (-780.728) [-779.178] (-783.629) (-780.713) -- 0:00:41
      357500 -- (-780.019) [-779.133] (-780.223) (-780.417) * [-780.122] (-779.261) (-778.952) (-780.084) -- 0:00:41
      358000 -- (-780.112) (-779.661) (-780.223) [-781.630] * (-779.306) [-779.327] (-779.441) (-781.150) -- 0:00:41
      358500 -- [-779.142] (-779.759) (-782.057) (-782.264) * (-779.143) (-779.961) [-781.751] (-780.789) -- 0:00:41
      359000 -- [-779.253] (-779.144) (-780.374) (-780.319) * (-781.916) [-783.147] (-782.566) (-782.047) -- 0:00:41
      359500 -- (-780.217) [-779.687] (-781.270) (-781.625) * (-783.578) (-782.952) [-780.501] (-781.101) -- 0:00:40
      360000 -- (-781.237) [-780.688] (-783.726) (-780.365) * (-782.286) [-782.460] (-779.845) (-779.738) -- 0:00:40

      Average standard deviation of split frequencies: 0.009440

      360500 -- [-784.658] (-783.210) (-782.294) (-781.668) * (-788.771) (-781.069) (-781.668) [-779.250] -- 0:00:40
      361000 -- (-779.810) (-781.704) (-781.404) [-781.256] * [-780.806] (-780.773) (-781.148) (-780.007) -- 0:00:40
      361500 -- (-779.953) (-786.580) [-780.823] (-780.493) * (-783.578) (-780.689) (-782.181) [-780.030] -- 0:00:40
      362000 -- (-781.997) (-783.987) [-782.227] (-779.627) * (-786.322) (-782.175) [-782.671] (-782.809) -- 0:00:40
      362500 -- [-779.751] (-782.675) (-782.792) (-782.095) * (-783.008) (-780.751) [-785.917] (-784.096) -- 0:00:40
      363000 -- (-781.603) [-781.201] (-779.639) (-779.659) * (-782.836) [-782.340] (-783.614) (-781.247) -- 0:00:40
      363500 -- [-779.583] (-784.387) (-779.072) (-780.795) * (-780.199) (-779.881) (-781.040) [-779.652] -- 0:00:40
      364000 -- (-779.981) (-782.434) (-778.647) [-779.768] * (-779.319) (-780.820) [-783.788] (-783.002) -- 0:00:41
      364500 -- (-782.331) (-781.052) (-780.220) [-781.855] * (-779.634) [-784.715] (-783.707) (-779.791) -- 0:00:41
      365000 -- (-784.746) (-782.428) (-786.548) [-781.565] * (-783.602) [-780.822] (-781.746) (-781.676) -- 0:00:41

      Average standard deviation of split frequencies: 0.009731

      365500 -- (-781.750) (-783.844) (-789.335) [-781.878] * (-779.625) [-780.620] (-781.344) (-782.628) -- 0:00:41
      366000 -- [-781.353] (-783.304) (-787.903) (-782.607) * (-780.101) (-782.437) [-781.560] (-781.345) -- 0:00:41
      366500 -- (-781.871) (-780.550) (-786.746) [-783.388] * (-780.753) (-780.918) (-786.465) [-780.929] -- 0:00:41
      367000 -- (-782.967) (-779.432) [-779.026] (-781.230) * (-779.613) [-779.343] (-783.504) (-780.272) -- 0:00:41
      367500 -- (-781.289) (-788.540) [-780.009] (-779.621) * (-780.896) (-779.403) [-782.120] (-786.264) -- 0:00:41
      368000 -- (-781.336) (-786.223) (-780.143) [-783.733] * (-780.282) (-779.344) [-780.612] (-783.886) -- 0:00:41
      368500 -- [-781.216] (-791.105) (-778.758) (-780.756) * (-781.963) (-779.394) (-779.961) [-784.268] -- 0:00:41
      369000 -- (-782.268) [-780.435] (-781.844) (-778.794) * [-781.595] (-780.489) (-780.116) (-780.554) -- 0:00:41
      369500 -- [-782.115] (-780.829) (-779.847) (-780.970) * (-780.474) (-780.015) (-779.891) [-780.999] -- 0:00:40
      370000 -- (-782.400) (-780.412) [-780.827] (-786.995) * (-781.222) [-781.684] (-781.015) (-783.899) -- 0:00:40

      Average standard deviation of split frequencies: 0.009185

      370500 -- (-780.291) [-781.980] (-785.257) (-783.565) * (-782.986) (-780.883) (-781.391) [-783.321] -- 0:00:40
      371000 -- [-779.795] (-778.885) (-779.488) (-782.968) * (-779.961) (-780.694) (-783.192) [-779.630] -- 0:00:40
      371500 -- (-779.829) (-779.190) [-780.850] (-780.193) * (-782.288) [-781.373] (-783.178) (-781.180) -- 0:00:40
      372000 -- (-780.237) [-778.652] (-780.003) (-779.562) * (-781.421) (-780.977) (-780.429) [-782.748] -- 0:00:40
      372500 -- (-781.200) (-779.336) [-781.471] (-781.999) * [-780.482] (-781.559) (-779.299) (-779.341) -- 0:00:40
      373000 -- (-784.945) (-780.920) [-778.564] (-780.504) * (-782.086) [-780.394] (-781.999) (-780.461) -- 0:00:40
      373500 -- (-780.248) (-782.375) (-778.509) [-779.396] * (-779.194) (-780.628) [-780.243] (-780.673) -- 0:00:40
      374000 -- (-781.076) (-780.823) [-784.081] (-784.164) * (-779.653) (-779.787) [-781.886] (-779.465) -- 0:00:40
      374500 -- [-781.294] (-783.936) (-780.406) (-778.989) * (-781.965) (-780.166) [-780.839] (-780.292) -- 0:00:40
      375000 -- (-782.050) (-782.420) (-781.249) [-781.268] * (-781.467) (-782.551) (-778.750) [-780.265] -- 0:00:40

      Average standard deviation of split frequencies: 0.008846

      375500 -- (-779.752) (-781.083) (-783.293) [-779.163] * (-779.468) (-781.528) [-779.353] (-781.418) -- 0:00:39
      376000 -- (-783.626) [-780.936] (-782.620) (-778.736) * (-782.700) [-779.135] (-778.979) (-781.999) -- 0:00:39
      376500 -- (-783.077) (-781.190) (-780.383) [-780.899] * (-780.111) [-780.399] (-780.025) (-779.835) -- 0:00:39
      377000 -- [-782.667] (-781.210) (-779.486) (-780.563) * [-781.112] (-780.196) (-780.804) (-780.479) -- 0:00:39
      377500 -- (-780.896) [-779.708] (-780.300) (-782.009) * [-780.532] (-779.636) (-781.743) (-780.216) -- 0:00:39
      378000 -- (-781.151) (-780.134) [-779.530] (-779.015) * (-780.418) (-780.367) [-782.565] (-780.908) -- 0:00:39
      378500 -- (-781.416) (-779.647) (-779.683) [-779.277] * (-779.310) (-779.542) (-780.769) [-780.298] -- 0:00:39
      379000 -- (-779.084) [-779.741] (-779.125) (-780.931) * (-779.314) (-779.531) (-785.997) [-781.104] -- 0:00:39
      379500 -- (-780.447) [-781.147] (-783.222) (-781.100) * (-783.583) [-778.695] (-785.905) (-782.494) -- 0:00:40
      380000 -- (-779.603) [-779.659] (-782.638) (-783.434) * (-783.380) (-780.632) [-779.043] (-782.068) -- 0:00:40

      Average standard deviation of split frequencies: 0.008814

      380500 -- (-781.243) (-780.207) (-782.452) [-782.018] * (-785.778) (-780.060) (-779.922) [-784.185] -- 0:00:40
      381000 -- (-780.380) [-780.652] (-785.749) (-781.521) * (-781.741) (-783.190) [-779.255] (-781.489) -- 0:00:40
      381500 -- (-779.753) [-784.906] (-785.014) (-780.806) * (-782.540) (-780.465) [-780.852] (-779.609) -- 0:00:40
      382000 -- [-779.454] (-780.384) (-787.797) (-779.836) * (-783.403) (-782.673) [-781.424] (-785.402) -- 0:00:40
      382500 -- (-780.261) (-784.380) [-781.323] (-782.062) * [-781.746] (-781.290) (-778.473) (-782.940) -- 0:00:40
      383000 -- [-781.309] (-782.132) (-779.213) (-780.234) * (-779.299) [-780.110] (-780.028) (-781.370) -- 0:00:40
      383500 -- (-781.808) (-783.635) [-778.909] (-780.082) * (-779.050) [-780.608] (-779.229) (-780.754) -- 0:00:40
      384000 -- (-781.745) (-784.309) (-780.365) [-781.625] * [-780.722] (-783.300) (-780.711) (-779.800) -- 0:00:40
      384500 -- [-780.431] (-780.408) (-779.189) (-785.521) * (-782.464) [-779.410] (-782.796) (-779.572) -- 0:00:40
      385000 -- (-782.076) (-780.956) (-783.400) [-782.006] * [-779.312] (-780.697) (-779.808) (-781.326) -- 0:00:39

      Average standard deviation of split frequencies: 0.007649

      385500 -- (-781.244) (-783.847) [-780.250] (-780.537) * [-780.953] (-787.902) (-783.842) (-780.343) -- 0:00:39
      386000 -- [-783.245] (-780.062) (-779.708) (-780.158) * (-779.144) [-787.898] (-782.040) (-778.948) -- 0:00:39
      386500 -- (-783.250) (-780.816) (-782.138) [-781.366] * [-778.736] (-781.638) (-779.419) (-779.325) -- 0:00:39
      387000 -- [-780.785] (-781.720) (-782.209) (-780.714) * [-778.824] (-782.460) (-778.616) (-780.295) -- 0:00:39
      387500 -- (-783.917) (-780.851) [-781.140] (-779.219) * (-781.344) (-783.433) (-780.211) [-780.658] -- 0:00:39
      388000 -- (-781.676) (-785.921) (-780.967) [-781.525] * [-779.944] (-783.506) (-778.969) (-779.600) -- 0:00:39
      388500 -- (-782.099) (-778.944) (-780.211) [-781.063] * [-782.003] (-781.687) (-779.528) (-778.759) -- 0:00:39
      389000 -- (-781.221) (-779.069) [-778.955] (-781.113) * (-783.409) [-782.012] (-780.532) (-781.826) -- 0:00:39
      389500 -- (-783.651) [-783.759] (-779.841) (-781.394) * (-782.372) (-781.087) [-779.511] (-781.410) -- 0:00:39
      390000 -- (-781.882) (-779.222) (-779.727) [-784.343] * (-780.712) [-782.306] (-780.236) (-781.589) -- 0:00:39

      Average standard deviation of split frequencies: 0.008447

      390500 -- (-783.633) [-782.163] (-780.724) (-782.455) * [-781.155] (-781.472) (-782.988) (-779.945) -- 0:00:39
      391000 -- (-782.076) (-785.798) [-781.088] (-781.422) * (-781.308) [-779.035] (-781.415) (-781.114) -- 0:00:38
      391500 -- (-781.574) (-784.530) (-785.126) [-782.788] * [-779.296] (-781.697) (-780.955) (-780.875) -- 0:00:38
      392000 -- (-783.015) [-778.923] (-784.205) (-780.519) * [-780.012] (-781.457) (-781.222) (-780.238) -- 0:00:38
      392500 -- [-785.445] (-780.014) (-779.799) (-786.698) * (-783.957) [-778.783] (-780.033) (-778.735) -- 0:00:38
      393000 -- (-780.933) (-779.899) (-785.975) [-782.771] * (-782.134) [-779.818] (-779.349) (-781.103) -- 0:00:38
      393500 -- (-784.150) [-781.153] (-783.393) (-779.623) * (-783.608) [-780.931] (-782.512) (-781.144) -- 0:00:38
      394000 -- (-782.217) (-779.442) [-783.174] (-780.610) * (-779.308) [-782.966] (-785.514) (-781.669) -- 0:00:38
      394500 -- (-780.892) [-779.507] (-779.045) (-780.440) * [-779.717] (-779.821) (-783.109) (-784.469) -- 0:00:38
      395000 -- (-780.111) (-781.618) (-780.352) [-781.109] * [-779.637] (-779.318) (-781.068) (-780.952) -- 0:00:38

      Average standard deviation of split frequencies: 0.007870

      395500 -- [-780.686] (-780.038) (-778.776) (-783.457) * [-780.103] (-781.788) (-781.394) (-779.038) -- 0:00:39
      396000 -- (-779.995) (-781.656) [-779.071] (-781.576) * [-780.429] (-780.253) (-779.491) (-779.796) -- 0:00:39
      396500 -- (-782.033) (-783.697) [-781.743] (-780.412) * (-779.939) (-780.184) [-782.432] (-784.053) -- 0:00:39
      397000 -- (-783.218) (-780.290) (-779.448) [-780.595] * [-779.239] (-780.734) (-781.556) (-786.067) -- 0:00:39
      397500 -- (-780.325) (-780.289) (-781.045) [-781.170] * (-782.329) [-782.173] (-778.969) (-780.825) -- 0:00:39
      398000 -- (-779.284) [-779.670] (-783.477) (-782.379) * (-781.807) (-781.079) (-779.812) [-779.766] -- 0:00:39
      398500 -- (-781.924) (-780.419) (-782.589) [-780.091] * (-779.571) [-781.814] (-780.619) (-783.476) -- 0:00:39
      399000 -- [-779.701] (-779.083) (-782.317) (-779.447) * (-779.317) (-779.026) (-782.944) [-783.569] -- 0:00:39
      399500 -- (-782.274) [-779.576] (-783.325) (-781.375) * (-781.943) (-781.455) [-780.869] (-784.412) -- 0:00:39
      400000 -- (-781.286) (-779.122) [-780.270] (-783.795) * (-780.731) (-781.949) (-782.688) [-786.022] -- 0:00:39

      Average standard deviation of split frequencies: 0.008236

      400500 -- (-779.109) (-779.116) [-781.750] (-780.508) * [-779.548] (-781.370) (-782.127) (-781.116) -- 0:00:38
      401000 -- (-781.347) [-779.018] (-783.649) (-779.648) * [-778.876] (-781.607) (-780.399) (-780.938) -- 0:00:38
      401500 -- (-787.299) (-780.638) [-784.614] (-780.919) * (-779.757) (-780.356) [-783.137] (-781.961) -- 0:00:38
      402000 -- (-779.874) (-779.391) [-782.614] (-780.365) * (-779.435) (-779.562) (-783.746) [-781.272] -- 0:00:38
      402500 -- [-780.246] (-779.474) (-781.639) (-780.571) * (-780.340) [-779.637] (-780.096) (-782.284) -- 0:00:38
      403000 -- (-781.208) [-781.139] (-781.350) (-780.578) * (-784.806) (-781.971) (-781.994) [-779.178] -- 0:00:38
      403500 -- (-783.102) [-779.783] (-782.264) (-781.330) * (-778.985) (-780.356) (-780.247) [-782.024] -- 0:00:38
      404000 -- (-782.947) [-780.129] (-779.091) (-783.677) * (-780.043) (-786.197) (-779.769) [-781.504] -- 0:00:38
      404500 -- (-780.303) (-783.944) [-781.258] (-787.662) * (-783.024) (-779.311) [-779.766] (-781.707) -- 0:00:38
      405000 -- (-780.095) (-783.975) [-779.975] (-785.710) * [-779.912] (-779.690) (-779.947) (-781.861) -- 0:00:38

      Average standard deviation of split frequencies: 0.008515

      405500 -- (-779.397) (-780.778) (-781.885) [-781.780] * (-779.331) (-779.744) [-778.999] (-781.580) -- 0:00:38
      406000 -- (-780.357) (-784.377) [-778.928] (-780.116) * (-780.010) [-780.073] (-782.941) (-780.599) -- 0:00:38
      406500 -- (-779.552) [-781.970] (-782.671) (-780.375) * (-783.858) [-783.067] (-780.300) (-781.705) -- 0:00:37
      407000 -- (-780.807) (-781.352) [-781.827] (-784.423) * (-783.291) (-782.216) [-781.572] (-779.850) -- 0:00:37
      407500 -- [-781.236] (-782.841) (-783.238) (-780.916) * (-784.483) (-782.593) [-780.079] (-780.336) -- 0:00:37
      408000 -- (-787.905) [-781.730] (-787.449) (-781.186) * [-786.597] (-778.914) (-781.372) (-779.098) -- 0:00:37
      408500 -- (-784.617) [-781.328] (-782.909) (-780.949) * (-781.548) [-778.833] (-782.082) (-781.319) -- 0:00:37
      409000 -- (-782.922) (-787.234) [-782.382] (-784.943) * (-783.397) [-779.363] (-782.953) (-780.813) -- 0:00:37
      409500 -- (-784.745) [-784.545] (-782.788) (-780.661) * (-780.871) [-779.951] (-779.194) (-780.641) -- 0:00:37
      410000 -- (-783.225) [-785.449] (-780.016) (-785.009) * (-780.876) (-779.644) [-779.905] (-780.486) -- 0:00:37

      Average standard deviation of split frequencies: 0.007630

      410500 -- (-779.458) [-780.563] (-783.901) (-780.764) * (-779.549) (-780.422) [-779.937] (-782.805) -- 0:00:37
      411000 -- (-779.496) [-778.741] (-779.470) (-779.753) * (-781.740) (-780.014) (-780.056) [-779.426] -- 0:00:37
      411500 -- (-781.680) (-781.314) (-780.115) [-779.579] * (-783.825) (-779.756) (-782.809) [-780.150] -- 0:00:37
      412000 -- (-779.556) (-783.272) (-784.864) [-781.036] * (-780.140) [-779.744] (-779.133) (-780.128) -- 0:00:38
      412500 -- (-785.122) (-782.543) (-780.151) [-780.707] * (-781.475) (-782.002) [-782.128] (-780.935) -- 0:00:38
      413000 -- [-780.753] (-780.700) (-780.444) (-781.553) * (-781.343) [-779.645] (-781.788) (-779.480) -- 0:00:38
      413500 -- (-779.015) [-779.022] (-779.568) (-780.196) * (-781.695) [-778.737] (-779.586) (-782.225) -- 0:00:38
      414000 -- (-780.412) (-780.338) [-779.077] (-782.000) * (-787.316) (-778.737) (-779.834) [-781.033] -- 0:00:38
      414500 -- (-784.561) [-781.311] (-780.287) (-779.736) * (-784.703) (-780.382) (-781.784) [-780.849] -- 0:00:38
      415000 -- [-781.672] (-780.747) (-784.890) (-785.351) * (-780.658) (-783.299) (-780.917) [-779.431] -- 0:00:38

      Average standard deviation of split frequencies: 0.008199

      415500 -- (-781.430) [-780.602] (-782.145) (-784.593) * [-780.294] (-779.953) (-781.447) (-779.892) -- 0:00:37
      416000 -- (-781.121) (-780.797) [-780.234] (-780.286) * (-779.514) (-781.477) (-779.918) [-779.194] -- 0:00:37
      416500 -- (-781.929) (-778.973) [-780.238] (-779.662) * (-780.888) (-778.930) (-781.325) [-779.237] -- 0:00:37
      417000 -- (-780.368) (-778.819) (-780.454) [-779.459] * (-779.962) (-779.578) (-779.114) [-780.926] -- 0:00:37
      417500 -- (-780.367) (-782.669) [-778.969] (-780.444) * (-781.118) (-779.333) [-779.012] (-782.575) -- 0:00:37
      418000 -- (-782.529) (-779.635) (-780.440) [-778.754] * (-779.732) (-780.776) [-780.192] (-779.292) -- 0:00:37
      418500 -- [-779.695] (-779.775) (-781.057) (-779.656) * (-781.062) [-779.513] (-779.140) (-779.383) -- 0:00:37
      419000 -- (-780.574) [-779.805] (-780.400) (-780.072) * (-781.048) (-781.143) (-779.152) [-781.547] -- 0:00:37
      419500 -- (-779.248) (-781.571) [-781.118] (-781.296) * [-782.814] (-781.687) (-780.327) (-783.170) -- 0:00:37
      420000 -- [-783.975] (-781.561) (-781.946) (-780.197) * [-780.016] (-781.314) (-781.353) (-780.602) -- 0:00:37

      Average standard deviation of split frequencies: 0.008194

      420500 -- (-779.619) [-779.774] (-780.149) (-779.002) * [-779.292] (-781.881) (-780.730) (-781.353) -- 0:00:37
      421000 -- (-782.446) (-779.821) (-780.095) [-780.580] * (-781.507) (-781.249) (-781.249) [-781.418] -- 0:00:37
      421500 -- [-779.488] (-780.234) (-780.588) (-783.933) * (-779.753) [-781.503] (-781.241) (-779.812) -- 0:00:37
      422000 -- (-779.996) (-780.992) [-779.207] (-781.851) * (-783.866) [-780.429] (-779.722) (-781.530) -- 0:00:36
      422500 -- [-780.969] (-782.856) (-781.645) (-781.553) * (-782.756) [-779.446] (-780.305) (-780.761) -- 0:00:36
      423000 -- [-781.840] (-783.844) (-782.978) (-780.332) * [-780.598] (-781.626) (-780.190) (-781.565) -- 0:00:36
      423500 -- [-780.362] (-786.643) (-780.888) (-781.908) * (-779.784) (-783.738) [-779.515] (-781.518) -- 0:00:36
      424000 -- [-783.456] (-786.410) (-782.107) (-784.075) * (-781.907) (-780.208) [-781.721] (-785.347) -- 0:00:36
      424500 -- (-780.665) (-785.397) [-780.702] (-785.675) * [-782.290] (-779.372) (-779.322) (-782.244) -- 0:00:36
      425000 -- (-781.156) [-782.905] (-781.929) (-779.680) * (-780.771) [-778.905] (-778.694) (-782.835) -- 0:00:36

      Average standard deviation of split frequencies: 0.008092

      425500 -- [-780.772] (-780.532) (-783.527) (-779.558) * (-778.707) [-780.236] (-779.656) (-780.861) -- 0:00:36
      426000 -- (-779.723) [-780.620] (-780.069) (-778.692) * (-778.989) [-780.526] (-781.426) (-783.011) -- 0:00:36
      426500 -- [-781.674] (-781.566) (-788.219) (-780.075) * (-782.810) (-778.879) [-780.526] (-779.540) -- 0:00:36
      427000 -- (-782.142) (-782.294) [-781.170] (-781.950) * (-785.822) [-780.107] (-779.428) (-780.609) -- 0:00:36
      427500 -- [-779.668] (-779.339) (-785.558) (-779.192) * (-779.388) [-780.992] (-779.217) (-780.791) -- 0:00:36
      428000 -- (-780.801) [-780.863] (-779.962) (-781.625) * (-779.816) (-781.828) (-779.762) [-781.098] -- 0:00:37
      428500 -- (-782.497) (-780.951) [-779.516] (-779.210) * [-780.034] (-779.784) (-781.442) (-778.919) -- 0:00:37
      429000 -- (-783.652) [-782.421] (-779.406) (-780.440) * (-780.947) [-782.900] (-780.890) (-779.203) -- 0:00:37
      429500 -- [-782.176] (-781.773) (-779.979) (-781.610) * (-782.112) (-782.486) [-780.056] (-782.919) -- 0:00:37
      430000 -- (-780.625) (-782.926) [-781.687] (-780.039) * (-780.669) (-780.567) (-784.588) [-781.339] -- 0:00:37

      Average standard deviation of split frequencies: 0.007727

      430500 -- (-782.332) [-782.619] (-780.623) (-784.010) * (-783.366) (-781.311) (-783.764) [-779.569] -- 0:00:37
      431000 -- (-779.503) (-780.953) (-781.220) [-782.186] * (-781.254) [-780.249] (-783.356) (-780.337) -- 0:00:36
      431500 -- (-782.042) (-779.278) [-780.581] (-780.456) * (-779.077) (-779.728) [-779.589] (-781.245) -- 0:00:36
      432000 -- (-781.547) (-778.989) (-786.371) [-779.447] * (-779.767) [-780.720] (-781.413) (-780.933) -- 0:00:36
      432500 -- (-784.235) [-782.079] (-786.032) (-778.515) * (-787.656) (-780.316) [-780.936] (-780.363) -- 0:00:36
      433000 -- (-782.574) (-786.876) (-786.805) [-780.297] * (-782.417) [-780.180] (-781.791) (-781.386) -- 0:00:36
      433500 -- [-780.529] (-782.196) (-783.381) (-778.543) * (-781.684) (-782.494) [-779.974] (-780.014) -- 0:00:36
      434000 -- [-779.815] (-783.689) (-787.801) (-780.159) * (-780.732) [-780.315] (-778.990) (-778.997) -- 0:00:36
      434500 -- (-779.881) (-784.575) (-779.487) [-780.951] * (-784.434) (-782.790) [-779.433] (-780.403) -- 0:00:36
      435000 -- [-779.994] (-779.615) (-780.802) (-782.629) * (-784.811) (-784.059) (-779.463) [-780.952] -- 0:00:36

      Average standard deviation of split frequencies: 0.007950

      435500 -- [-780.728] (-780.215) (-780.852) (-781.630) * [-786.119] (-781.057) (-781.831) (-778.888) -- 0:00:36
      436000 -- (-780.160) (-784.144) (-782.139) [-782.823] * (-781.568) (-783.142) (-784.035) [-780.359] -- 0:00:36
      436500 -- (-780.699) (-782.082) [-781.166] (-780.585) * (-783.507) [-780.752] (-779.542) (-779.844) -- 0:00:36
      437000 -- [-781.723] (-778.760) (-784.354) (-784.113) * (-780.548) [-779.071] (-779.461) (-781.723) -- 0:00:36
      437500 -- [-783.476] (-781.346) (-779.942) (-782.408) * (-781.290) (-780.775) (-778.932) [-779.751] -- 0:00:36
      438000 -- (-782.051) (-782.683) [-780.303] (-782.307) * (-779.080) (-780.981) [-784.380] (-780.310) -- 0:00:35
      438500 -- (-784.330) [-778.653] (-780.864) (-779.677) * (-779.382) (-781.622) [-779.837] (-779.995) -- 0:00:35
      439000 -- (-780.635) (-779.994) [-782.419] (-780.598) * (-783.220) (-779.768) (-780.489) [-782.337] -- 0:00:35
      439500 -- [-781.404] (-779.935) (-779.862) (-780.133) * (-781.042) (-783.247) (-781.953) [-780.361] -- 0:00:35
      440000 -- [-780.160] (-781.237) (-789.135) (-780.081) * [-779.544] (-782.833) (-779.058) (-780.507) -- 0:00:35

      Average standard deviation of split frequencies: 0.007677

      440500 -- (-780.058) (-778.942) (-787.674) [-781.637] * [-781.400] (-781.805) (-782.034) (-781.772) -- 0:00:35
      441000 -- (-781.320) [-780.676] (-780.077) (-781.794) * [-780.919] (-784.612) (-782.504) (-783.521) -- 0:00:35
      441500 -- [-780.334] (-780.195) (-780.902) (-783.186) * (-781.627) (-784.366) (-782.222) [-781.871] -- 0:00:35
      442000 -- [-784.264] (-786.426) (-779.667) (-780.524) * [-780.681] (-787.225) (-781.001) (-782.962) -- 0:00:35
      442500 -- [-780.055] (-781.914) (-781.393) (-779.120) * (-781.575) (-783.164) [-779.816] (-782.008) -- 0:00:35
      443000 -- (-781.331) (-783.373) [-781.177] (-778.704) * (-781.171) (-780.844) (-779.574) [-780.671] -- 0:00:35
      443500 -- [-782.034] (-780.749) (-783.597) (-779.165) * (-778.867) (-784.528) (-779.005) [-779.800] -- 0:00:35
      444000 -- (-781.227) (-779.586) [-781.589] (-784.121) * (-782.475) [-781.267] (-779.621) (-780.008) -- 0:00:36
      444500 -- [-778.941] (-781.024) (-780.606) (-779.874) * (-779.064) (-781.275) [-783.185] (-781.567) -- 0:00:36
      445000 -- [-780.555] (-780.265) (-781.585) (-781.746) * (-779.744) (-780.983) [-781.807] (-785.349) -- 0:00:36

      Average standard deviation of split frequencies: 0.007337

      445500 -- [-780.722] (-780.423) (-779.669) (-782.761) * (-780.071) (-779.607) (-782.788) [-783.144] -- 0:00:36
      446000 -- (-782.036) (-779.838) [-780.011] (-781.087) * (-780.066) (-780.024) (-781.583) [-780.987] -- 0:00:36
      446500 -- (-783.030) (-780.400) [-779.087] (-780.870) * [-780.866] (-782.741) (-779.415) (-782.705) -- 0:00:35
      447000 -- [-780.807] (-781.034) (-785.158) (-779.475) * (-780.782) (-781.273) (-780.484) [-781.254] -- 0:00:35
      447500 -- (-781.274) (-779.941) [-781.611] (-780.033) * (-779.511) [-779.387] (-784.341) (-792.228) -- 0:00:35
      448000 -- [-780.953] (-780.000) (-785.026) (-781.945) * [-785.548] (-780.144) (-781.912) (-784.507) -- 0:00:35
      448500 -- [-781.506] (-779.562) (-783.678) (-782.339) * (-784.442) (-780.660) [-781.355] (-778.873) -- 0:00:35
      449000 -- (-782.547) (-779.720) (-782.007) [-780.261] * (-783.944) (-783.064) [-781.360] (-785.221) -- 0:00:35
      449500 -- (-785.469) (-779.554) [-782.455] (-779.135) * (-783.234) (-781.730) (-779.757) [-779.317] -- 0:00:35
      450000 -- [-781.836] (-779.429) (-778.773) (-779.182) * (-781.711) (-787.055) (-779.837) [-779.916] -- 0:00:35

      Average standard deviation of split frequencies: 0.006276

      450500 -- (-779.584) (-780.174) [-778.669] (-784.449) * (-782.100) (-786.837) (-784.168) [-780.704] -- 0:00:35
      451000 -- (-779.955) [-779.168] (-778.768) (-784.071) * (-780.043) (-786.746) [-780.277] (-786.301) -- 0:00:35
      451500 -- [-779.062] (-783.345) (-780.142) (-780.886) * (-779.852) [-783.868] (-780.573) (-783.158) -- 0:00:35
      452000 -- (-780.466) [-781.012] (-779.664) (-782.477) * [-779.483] (-780.131) (-781.817) (-780.662) -- 0:00:35
      452500 -- (-781.770) (-782.454) [-779.053] (-779.274) * (-782.274) (-779.369) [-779.494] (-781.235) -- 0:00:35
      453000 -- (-781.538) (-780.319) (-779.914) [-780.696] * (-783.717) [-780.149] (-781.029) (-781.000) -- 0:00:35
      453500 -- (-788.181) [-779.106] (-780.863) (-781.263) * (-782.827) (-781.648) [-782.992] (-782.517) -- 0:00:34
      454000 -- [-783.547] (-781.255) (-782.234) (-781.084) * (-779.713) [-779.308] (-779.056) (-781.330) -- 0:00:34
      454500 -- (-778.855) (-781.801) [-779.689] (-786.058) * [-782.219] (-779.799) (-780.133) (-779.560) -- 0:00:34
      455000 -- [-781.242] (-782.545) (-780.470) (-779.979) * (-778.795) (-781.203) (-786.573) [-782.452] -- 0:00:34

      Average standard deviation of split frequencies: 0.007480

      455500 -- [-781.003] (-784.452) (-785.815) (-780.596) * (-781.217) (-783.716) [-781.077] (-779.610) -- 0:00:34
      456000 -- (-781.169) (-783.697) (-781.246) [-781.447] * [-779.346] (-783.446) (-779.799) (-780.985) -- 0:00:34
      456500 -- (-781.454) (-781.182) [-783.811] (-780.805) * (-780.660) (-780.016) [-779.429] (-780.639) -- 0:00:34
      457000 -- (-780.890) (-779.415) [-782.002] (-780.606) * (-780.843) [-785.078] (-779.917) (-782.353) -- 0:00:34
      457500 -- (-782.996) (-778.807) [-779.390] (-788.534) * (-781.132) (-785.826) (-780.078) [-782.356] -- 0:00:34
      458000 -- (-783.693) (-779.408) [-782.131] (-785.680) * (-781.333) [-780.131] (-781.526) (-784.842) -- 0:00:34
      458500 -- (-779.709) (-782.283) [-781.969] (-783.882) * (-779.283) (-783.529) [-781.383] (-788.764) -- 0:00:34
      459000 -- (-779.860) [-779.461] (-783.974) (-779.714) * (-779.187) [-782.854] (-784.870) (-782.697) -- 0:00:34
      459500 -- (-780.576) (-781.271) [-781.057] (-784.471) * [-780.691] (-781.891) (-783.082) (-784.396) -- 0:00:35
      460000 -- (-781.234) (-780.011) [-782.867] (-782.068) * [-781.146] (-779.300) (-784.244) (-781.807) -- 0:00:35

      Average standard deviation of split frequencies: 0.007803

      460500 -- (-781.925) (-780.354) [-780.847] (-784.848) * (-781.332) [-779.055] (-781.869) (-779.919) -- 0:00:35
      461000 -- [-784.639] (-783.094) (-783.481) (-781.970) * (-780.232) [-779.842] (-782.449) (-778.836) -- 0:00:35
      461500 -- (-782.922) [-784.067] (-780.546) (-780.213) * (-782.608) (-781.248) (-780.744) [-779.254] -- 0:00:35
      462000 -- (-782.077) (-779.319) (-778.831) [-779.983] * (-779.500) [-780.631] (-781.137) (-785.232) -- 0:00:34
      462500 -- [-782.220] (-779.576) (-779.962) (-780.378) * (-779.939) (-780.100) [-781.395] (-779.606) -- 0:00:34
      463000 -- (-782.761) [-779.419] (-783.650) (-786.295) * (-783.213) [-781.840] (-779.157) (-783.442) -- 0:00:34
      463500 -- (-782.375) (-782.966) [-781.238] (-782.418) * (-783.217) (-784.177) (-779.603) [-780.827] -- 0:00:34
      464000 -- (-782.986) (-779.704) (-788.778) [-780.190] * (-778.993) [-783.530] (-781.227) (-783.124) -- 0:00:34
      464500 -- (-781.298) [-778.965] (-784.431) (-779.490) * [-782.151] (-781.343) (-779.200) (-783.561) -- 0:00:34
      465000 -- (-781.864) [-779.597] (-781.621) (-780.342) * (-783.327) (-779.877) [-779.005] (-788.770) -- 0:00:34

      Average standard deviation of split frequencies: 0.007141

      465500 -- (-779.659) (-782.608) (-785.346) [-780.328] * (-781.011) (-782.013) (-779.202) [-783.993] -- 0:00:34
      466000 -- [-778.814] (-781.996) (-779.653) (-780.608) * (-781.411) [-782.077] (-779.576) (-780.859) -- 0:00:34
      466500 -- [-780.554] (-780.810) (-780.724) (-782.073) * [-784.567] (-785.680) (-779.433) (-778.978) -- 0:00:34
      467000 -- (-779.260) [-782.410] (-781.374) (-783.067) * (-784.147) (-780.637) (-782.877) [-782.626] -- 0:00:34
      467500 -- (-778.856) (-782.490) (-781.103) [-781.245] * [-781.171] (-779.226) (-781.174) (-780.140) -- 0:00:34
      468000 -- (-780.766) [-779.758] (-781.550) (-780.209) * (-779.320) [-779.175] (-779.817) (-779.304) -- 0:00:34
      468500 -- (-782.376) (-780.564) (-782.300) [-781.609] * (-780.427) [-780.316] (-780.340) (-781.012) -- 0:00:34
      469000 -- [-780.013] (-779.759) (-780.341) (-783.621) * (-780.484) (-782.701) [-781.132] (-782.456) -- 0:00:33
      469500 -- (-779.614) (-779.423) [-779.629] (-783.712) * (-779.631) [-782.308] (-779.956) (-780.907) -- 0:00:33
      470000 -- [-779.286] (-781.652) (-781.347) (-785.255) * (-779.032) [-782.166] (-785.156) (-781.388) -- 0:00:33

      Average standard deviation of split frequencies: 0.007261

      470500 -- (-780.819) [-780.953] (-781.336) (-780.474) * [-780.942] (-780.384) (-780.541) (-778.841) -- 0:00:33
      471000 -- [-781.337] (-780.345) (-782.330) (-782.153) * (-783.588) (-779.062) (-782.063) [-779.766] -- 0:00:33
      471500 -- [-778.534] (-779.130) (-779.463) (-781.960) * (-781.440) [-779.572] (-783.226) (-779.449) -- 0:00:33
      472000 -- (-779.100) [-779.844] (-780.526) (-781.581) * [-781.787] (-783.214) (-781.628) (-781.636) -- 0:00:33
      472500 -- [-784.830] (-782.534) (-780.212) (-780.694) * [-779.347] (-785.951) (-781.289) (-780.609) -- 0:00:33
      473000 -- [-780.895] (-781.773) (-782.350) (-783.070) * (-780.451) (-782.661) (-780.495) [-784.783] -- 0:00:33
      473500 -- (-781.350) (-779.457) (-779.546) [-782.170] * (-780.986) [-780.519] (-781.010) (-780.638) -- 0:00:33
      474000 -- (-780.549) [-779.986] (-780.161) (-779.337) * (-780.678) (-780.977) [-781.474] (-779.345) -- 0:00:33
      474500 -- [-782.620] (-781.522) (-781.642) (-779.289) * [-780.099] (-785.615) (-779.677) (-779.961) -- 0:00:33
      475000 -- (-783.390) [-780.463] (-778.901) (-779.973) * (-782.381) (-779.863) [-783.938] (-781.907) -- 0:00:33

      Average standard deviation of split frequencies: 0.007748

      475500 -- (-784.816) (-782.648) [-779.116] (-781.791) * (-779.104) [-780.933] (-782.227) (-780.649) -- 0:00:34
      476000 -- (-781.771) [-780.885] (-779.566) (-783.348) * (-779.053) (-779.201) (-783.682) [-786.436] -- 0:00:34
      476500 -- (-779.066) (-780.632) (-779.702) [-778.935] * (-783.464) [-779.309] (-779.181) (-787.940) -- 0:00:34
      477000 -- (-784.927) (-781.683) [-782.313] (-782.186) * [-779.897] (-779.834) (-782.300) (-788.256) -- 0:00:33
      477500 -- (-783.637) (-783.414) [-783.166] (-779.843) * (-780.518) [-782.308] (-780.571) (-786.119) -- 0:00:33
      478000 -- (-782.397) (-782.327) [-783.464] (-780.828) * [-779.981] (-781.434) (-779.964) (-780.527) -- 0:00:33
      478500 -- [-779.549] (-781.536) (-781.168) (-780.631) * (-782.734) (-782.505) (-781.683) [-782.049] -- 0:00:33
      479000 -- [-779.994] (-782.030) (-783.916) (-779.053) * [-778.740] (-779.949) (-785.520) (-781.113) -- 0:00:33
      479500 -- [-781.705] (-782.163) (-780.190) (-782.562) * (-778.711) (-781.228) [-781.448] (-780.751) -- 0:00:33
      480000 -- (-781.932) [-779.484] (-782.540) (-780.657) * (-779.148) [-781.978] (-780.541) (-779.172) -- 0:00:33

      Average standard deviation of split frequencies: 0.008030

      480500 -- (-780.610) [-779.483] (-783.474) (-779.934) * [-779.001] (-782.037) (-779.267) (-778.984) -- 0:00:33
      481000 -- (-782.397) (-783.330) [-779.440] (-780.992) * (-784.768) (-780.018) [-780.624] (-778.698) -- 0:00:33
      481500 -- (-781.023) (-784.558) [-779.285] (-780.025) * (-783.966) [-781.305] (-781.140) (-780.585) -- 0:00:33
      482000 -- (-780.055) (-781.577) [-778.758] (-780.002) * (-782.120) (-782.395) (-781.561) [-782.230] -- 0:00:33
      482500 -- (-779.564) (-782.658) (-779.584) [-779.269] * (-780.390) [-780.324] (-779.525) (-782.590) -- 0:00:33
      483000 -- (-781.215) (-782.704) [-779.533] (-781.032) * (-780.419) [-781.175] (-782.377) (-781.643) -- 0:00:33
      483500 -- [-782.980] (-784.032) (-781.096) (-780.889) * (-786.001) [-781.396] (-781.742) (-783.906) -- 0:00:33
      484000 -- [-780.541] (-788.585) (-782.571) (-782.996) * [-779.099] (-780.388) (-782.214) (-780.362) -- 0:00:33
      484500 -- (-785.893) [-781.098] (-783.048) (-783.826) * [-781.090] (-781.654) (-781.585) (-779.756) -- 0:00:32
      485000 -- (-783.200) (-782.085) (-782.452) [-781.707] * [-779.627] (-779.584) (-782.812) (-781.638) -- 0:00:32

      Average standard deviation of split frequencies: 0.008216

      485500 -- (-781.777) (-779.170) [-781.832] (-782.504) * [-781.588] (-780.442) (-781.022) (-778.795) -- 0:00:32
      486000 -- (-780.366) (-781.786) (-780.305) [-782.522] * (-779.661) (-779.685) [-779.102] (-781.393) -- 0:00:32
      486500 -- (-780.442) [-779.627] (-778.938) (-782.727) * [-784.942] (-781.617) (-782.300) (-780.998) -- 0:00:32
      487000 -- (-782.778) (-780.416) [-779.214] (-779.562) * (-783.451) (-781.839) (-782.155) [-780.390] -- 0:00:32
      487500 -- (-779.779) (-782.330) (-780.293) [-779.479] * (-779.404) (-783.134) (-780.309) [-779.097] -- 0:00:32
      488000 -- [-779.745] (-782.341) (-781.562) (-779.705) * (-785.780) [-785.667] (-780.616) (-781.102) -- 0:00:32
      488500 -- (-781.438) (-787.281) (-783.423) [-784.442] * (-783.240) [-781.876] (-780.467) (-781.919) -- 0:00:32
      489000 -- [-780.401] (-779.631) (-782.328) (-782.221) * (-779.599) (-782.557) (-780.847) [-782.368] -- 0:00:32
      489500 -- (-780.837) (-780.004) (-782.498) [-789.043] * (-780.957) (-779.290) [-782.841] (-779.735) -- 0:00:32
      490000 -- (-779.619) (-780.579) [-781.733] (-786.275) * (-780.850) (-779.048) (-782.479) [-780.785] -- 0:00:32

      Average standard deviation of split frequencies: 0.007969

      490500 -- (-782.527) [-780.416] (-781.797) (-782.608) * [-780.122] (-782.580) (-782.299) (-781.870) -- 0:00:32
      491000 -- (-780.836) [-783.287] (-779.633) (-781.088) * (-780.173) (-781.350) [-779.983] (-781.091) -- 0:00:32
      491500 -- (-781.838) (-781.854) [-784.715] (-780.521) * (-779.814) [-779.206] (-780.111) (-782.211) -- 0:00:32
      492000 -- [-785.465] (-780.936) (-778.965) (-780.264) * (-779.976) [-779.864] (-783.044) (-780.506) -- 0:00:33
      492500 -- [-781.340] (-785.180) (-779.262) (-779.901) * [-781.321] (-780.697) (-781.199) (-779.246) -- 0:00:32
      493000 -- [-782.613] (-780.517) (-779.781) (-781.128) * [-780.359] (-780.628) (-782.885) (-779.217) -- 0:00:32
      493500 -- (-780.862) [-780.838] (-781.999) (-782.771) * (-780.451) [-779.740] (-782.904) (-778.938) -- 0:00:32
      494000 -- (-781.515) (-780.457) [-780.191] (-780.539) * (-778.933) (-780.538) (-778.964) [-778.873] -- 0:00:32
      494500 -- [-783.536] (-781.059) (-779.549) (-782.973) * (-779.691) (-781.690) (-780.581) [-781.750] -- 0:00:32
      495000 -- (-783.972) (-779.957) [-785.502] (-780.584) * (-779.727) (-783.177) [-782.035] (-780.704) -- 0:00:32

      Average standard deviation of split frequencies: 0.008554

      495500 -- (-778.869) [-781.202] (-781.464) (-780.797) * (-781.004) [-778.503] (-779.595) (-779.851) -- 0:00:32
      496000 -- (-778.987) (-779.909) (-780.737) [-779.462] * (-781.274) [-780.429] (-781.869) (-781.675) -- 0:00:32
      496500 -- (-780.408) (-780.445) [-780.656] (-778.456) * (-780.683) (-781.546) (-785.433) [-781.075] -- 0:00:32
      497000 -- [-778.581] (-779.478) (-783.426) (-780.612) * (-779.637) [-779.268] (-785.761) (-778.713) -- 0:00:32
      497500 -- [-780.930] (-781.672) (-783.679) (-788.806) * (-780.631) (-787.853) [-782.045] (-781.711) -- 0:00:32
      498000 -- (-780.080) (-781.833) [-781.021] (-781.405) * [-779.973] (-779.493) (-785.338) (-782.275) -- 0:00:32
      498500 -- [-779.507] (-780.259) (-781.731) (-781.044) * (-781.186) [-779.058] (-781.434) (-779.387) -- 0:00:32
      499000 -- (-779.298) (-780.509) [-781.837] (-783.429) * (-780.046) (-779.344) [-780.879] (-778.982) -- 0:00:32
      499500 -- (-782.552) [-780.234] (-779.416) (-779.867) * (-783.073) (-779.279) (-782.756) [-780.853] -- 0:00:32
      500000 -- (-781.439) [-782.738] (-784.030) (-780.908) * (-779.303) (-779.398) [-778.805] (-779.881) -- 0:00:32

      Average standard deviation of split frequencies: 0.008585

      500500 -- (-781.113) [-780.985] (-788.209) (-781.439) * [-780.004] (-780.673) (-779.638) (-779.155) -- 0:00:31
      501000 -- (-778.875) (-778.984) [-783.032] (-781.824) * (-782.224) [-779.284] (-779.049) (-779.011) -- 0:00:31
      501500 -- (-780.812) (-782.879) [-780.363] (-779.932) * [-779.193] (-781.736) (-783.287) (-781.581) -- 0:00:31
      502000 -- [-779.824] (-783.088) (-779.537) (-781.456) * (-779.069) (-781.991) [-779.893] (-782.637) -- 0:00:31
      502500 -- [-779.326] (-782.891) (-784.604) (-781.269) * (-778.910) (-780.530) [-786.339] (-782.486) -- 0:00:31
      503000 -- (-781.788) (-783.937) [-781.615] (-778.927) * (-779.257) [-780.625] (-782.035) (-782.473) -- 0:00:31
      503500 -- (-787.819) (-782.955) [-779.020] (-786.733) * (-781.717) (-780.162) [-780.635] (-780.232) -- 0:00:31
      504000 -- (-788.349) (-782.341) [-780.171] (-782.244) * (-782.526) (-782.870) [-779.094] (-783.795) -- 0:00:31
      504500 -- (-781.745) [-780.044] (-782.631) (-784.925) * [-784.607] (-780.332) (-779.337) (-779.318) -- 0:00:31
      505000 -- (-782.259) [-778.723] (-780.533) (-780.831) * (-779.507) (-779.055) (-783.840) [-780.452] -- 0:00:31

      Average standard deviation of split frequencies: 0.008823

      505500 -- (-781.397) (-780.640) (-782.531) [-780.383] * (-779.426) (-779.312) (-781.894) [-782.591] -- 0:00:31
      506000 -- (-781.700) [-780.228] (-781.312) (-783.231) * (-779.812) (-779.821) (-781.556) [-781.260] -- 0:00:31
      506500 -- (-781.477) [-780.885] (-783.599) (-785.275) * (-780.903) [-778.999] (-780.345) (-782.116) -- 0:00:31
      507000 -- (-786.895) [-782.522] (-781.030) (-779.788) * (-780.350) (-782.316) [-780.532] (-782.725) -- 0:00:31
      507500 -- [-779.733] (-782.587) (-780.405) (-780.843) * [-780.529] (-781.326) (-780.497) (-780.924) -- 0:00:31
      508000 -- (-781.480) (-782.103) (-779.554) [-786.535] * (-782.567) (-787.280) (-781.929) [-780.942] -- 0:00:31
      508500 -- (-781.042) (-783.268) (-778.569) [-783.872] * (-779.297) [-783.322] (-780.098) (-785.354) -- 0:00:31
      509000 -- (-779.738) (-781.515) (-782.976) [-780.440] * (-781.534) (-779.505) [-780.584] (-780.049) -- 0:00:31
      509500 -- (-779.768) [-782.870] (-780.577) (-782.137) * (-781.417) (-780.738) [-780.254] (-781.649) -- 0:00:31
      510000 -- (-780.492) (-782.335) [-781.903] (-779.637) * (-782.892) [-781.492] (-784.325) (-782.196) -- 0:00:31

      Average standard deviation of split frequencies: 0.009000

      510500 -- (-780.803) [-780.388] (-779.061) (-780.225) * (-782.265) (-781.715) [-781.495] (-785.146) -- 0:00:31
      511000 -- (-780.668) (-778.789) [-779.437] (-781.373) * (-788.333) (-779.918) [-780.627] (-784.677) -- 0:00:31
      511500 -- (-783.790) [-781.608] (-779.506) (-779.750) * (-781.859) (-781.881) (-782.641) [-780.329] -- 0:00:31
      512000 -- (-780.706) [-779.873] (-779.488) (-784.945) * (-780.743) (-779.403) [-780.051] (-782.066) -- 0:00:31
      512500 -- (-783.950) (-779.210) [-779.471] (-782.016) * (-778.850) [-781.638] (-781.030) (-778.858) -- 0:00:31
      513000 -- (-778.904) [-778.833] (-782.628) (-778.642) * (-783.218) (-780.572) [-780.501] (-779.143) -- 0:00:31
      513500 -- (-781.987) (-778.806) [-782.511] (-781.417) * (-779.821) (-779.343) (-779.855) [-779.798] -- 0:00:31
      514000 -- (-782.235) [-778.702] (-783.083) (-783.240) * (-781.425) (-780.497) (-782.507) [-780.553] -- 0:00:31
      514500 -- (-781.770) (-780.930) [-781.733] (-779.800) * (-781.794) (-778.701) [-781.489] (-780.666) -- 0:00:31
      515000 -- (-781.064) (-778.999) (-781.928) [-779.681] * (-780.154) (-779.683) (-783.045) [-781.842] -- 0:00:31

      Average standard deviation of split frequencies: 0.008736

      515500 -- (-780.632) (-782.553) (-780.637) [-781.881] * (-779.622) (-781.803) [-781.019] (-780.967) -- 0:00:31
      516000 -- (-780.447) (-785.061) [-783.760] (-779.747) * (-780.539) [-783.718] (-781.843) (-784.387) -- 0:00:30
      516500 -- (-782.133) (-780.237) (-785.585) [-779.634] * [-780.362] (-781.131) (-782.074) (-781.048) -- 0:00:30
      517000 -- (-778.990) (-780.618) (-779.999) [-779.523] * [-783.781] (-779.897) (-781.032) (-781.323) -- 0:00:30
      517500 -- (-781.721) [-780.918] (-780.474) (-781.833) * (-780.769) (-781.210) (-783.799) [-779.677] -- 0:00:30
      518000 -- [-783.906] (-779.274) (-779.027) (-780.317) * (-783.043) [-782.013] (-781.929) (-780.614) -- 0:00:30
      518500 -- (-781.523) (-781.509) (-781.216) [-780.043] * (-779.365) (-779.048) (-779.612) [-781.643] -- 0:00:30
      519000 -- (-781.962) [-779.343] (-784.730) (-781.948) * (-779.691) (-781.240) (-780.489) [-780.635] -- 0:00:30
      519500 -- (-785.812) (-780.767) [-780.599] (-780.036) * (-779.193) (-780.090) [-781.351] (-779.637) -- 0:00:30
      520000 -- (-783.009) [-780.369] (-782.129) (-785.223) * [-778.755] (-780.692) (-784.224) (-783.709) -- 0:00:30

      Average standard deviation of split frequencies: 0.008255

      520500 -- (-784.974) [-780.200] (-781.887) (-779.957) * (-780.145) [-783.904] (-782.332) (-784.722) -- 0:00:30
      521000 -- [-781.135] (-779.718) (-779.701) (-782.820) * [-782.018] (-779.096) (-783.714) (-784.815) -- 0:00:30
      521500 -- (-780.673) (-780.818) [-778.927] (-781.935) * (-782.451) (-781.120) (-781.644) [-782.688] -- 0:00:30
      522000 -- (-779.133) [-779.474] (-782.741) (-780.531) * (-782.171) [-781.257] (-782.633) (-784.973) -- 0:00:30
      522500 -- (-780.295) [-779.407] (-780.149) (-780.211) * [-781.745] (-781.857) (-782.940) (-780.295) -- 0:00:30
      523000 -- (-779.788) (-780.087) [-779.828] (-781.994) * [-780.345] (-780.752) (-783.878) (-779.101) -- 0:00:30
      523500 -- (-780.767) (-782.475) [-779.382] (-790.175) * (-781.085) (-785.432) (-783.509) [-778.968] -- 0:00:30
      524000 -- (-782.608) [-781.282] (-779.560) (-785.356) * (-779.620) [-779.623] (-785.421) (-781.879) -- 0:00:29
      524500 -- [-782.443] (-779.239) (-780.337) (-779.656) * [-778.919] (-779.928) (-783.972) (-779.326) -- 0:00:30
      525000 -- (-779.668) (-780.644) (-783.081) [-780.846] * (-778.948) [-784.471] (-779.884) (-780.714) -- 0:00:30

      Average standard deviation of split frequencies: 0.008488

      525500 -- (-780.809) (-783.343) (-780.476) [-779.452] * (-779.519) (-782.989) [-779.339] (-781.038) -- 0:00:30
      526000 -- (-785.968) [-779.641] (-781.904) (-779.797) * [-780.235] (-780.163) (-780.225) (-780.913) -- 0:00:30
      526500 -- (-780.110) (-779.922) (-779.365) [-783.187] * (-783.497) (-781.207) (-783.909) [-779.953] -- 0:00:30
      527000 -- (-782.752) [-783.623] (-780.375) (-783.214) * (-782.768) [-779.687] (-782.129) (-779.973) -- 0:00:30
      527500 -- (-783.268) (-780.289) (-780.035) [-778.979] * [-782.324] (-781.593) (-779.770) (-780.807) -- 0:00:30
      528000 -- (-781.483) (-780.705) (-781.110) [-779.069] * (-781.919) [-779.748] (-780.812) (-781.114) -- 0:00:30
      528500 -- (-781.722) [-779.383] (-784.677) (-781.112) * (-783.111) (-779.812) [-782.372] (-779.419) -- 0:00:30
      529000 -- [-778.951] (-781.522) (-778.821) (-781.910) * (-780.595) (-779.985) [-781.687] (-781.283) -- 0:00:30
      529500 -- (-781.516) [-789.971] (-780.244) (-780.536) * (-781.455) (-781.765) (-781.592) [-780.694] -- 0:00:30
      530000 -- [-780.882] (-779.885) (-785.012) (-781.946) * (-779.511) [-779.583] (-779.534) (-781.086) -- 0:00:30

      Average standard deviation of split frequencies: 0.008831

      530500 -- (-778.942) (-783.124) (-780.825) [-779.722] * (-781.289) (-780.111) [-779.019] (-781.011) -- 0:00:30
      531000 -- [-779.423] (-784.460) (-782.008) (-781.552) * (-780.710) [-781.342] (-780.469) (-782.119) -- 0:00:30
      531500 -- (-781.932) (-781.591) [-783.045] (-780.573) * (-779.668) (-784.105) [-780.746] (-780.388) -- 0:00:29
      532000 -- (-781.885) [-780.551] (-781.542) (-780.762) * (-780.997) [-783.200] (-783.783) (-780.638) -- 0:00:29
      532500 -- [-783.164] (-781.529) (-781.669) (-779.262) * (-782.432) (-789.546) (-780.038) [-781.301] -- 0:00:29
      533000 -- (-780.262) [-782.937] (-783.114) (-780.618) * [-782.068] (-788.338) (-782.885) (-786.606) -- 0:00:29
      533500 -- (-782.067) (-779.686) [-780.901] (-779.295) * (-780.192) (-784.682) [-780.965] (-782.148) -- 0:00:29
      534000 -- [-780.912] (-782.769) (-780.160) (-780.759) * (-782.415) [-783.279] (-778.809) (-779.127) -- 0:00:29
      534500 -- (-780.656) [-780.576] (-781.331) (-782.713) * (-781.024) (-783.400) [-778.770] (-783.769) -- 0:00:29
      535000 -- (-789.175) (-783.048) (-784.116) [-782.681] * [-780.065] (-782.087) (-783.344) (-779.418) -- 0:00:29

      Average standard deviation of split frequencies: 0.008174

      535500 -- (-780.312) [-781.806] (-784.183) (-781.442) * [-779.029] (-780.564) (-784.496) (-780.738) -- 0:00:29
      536000 -- [-779.019] (-783.888) (-780.310) (-779.191) * [-780.567] (-782.422) (-783.999) (-779.531) -- 0:00:29
      536500 -- [-783.590] (-780.662) (-779.148) (-779.884) * (-779.244) (-784.975) (-784.722) [-779.630] -- 0:00:29
      537000 -- (-784.232) (-781.926) [-779.063] (-782.232) * (-780.309) [-780.124] (-786.527) (-779.642) -- 0:00:29
      537500 -- (-785.183) [-780.328] (-782.108) (-782.164) * [-779.346] (-781.874) (-781.992) (-780.540) -- 0:00:29
      538000 -- (-786.830) [-781.574] (-780.475) (-782.793) * (-779.485) (-781.540) [-780.727] (-781.391) -- 0:00:29
      538500 -- (-785.189) (-780.555) (-781.315) [-781.787] * (-788.437) (-782.047) [-780.923] (-781.319) -- 0:00:29
      539000 -- (-780.805) (-780.008) (-780.693) [-779.044] * (-783.333) (-780.808) [-779.737] (-782.159) -- 0:00:29
      539500 -- (-784.719) (-779.764) (-783.781) [-780.421] * (-788.698) (-780.705) [-779.447] (-784.519) -- 0:00:29
      540000 -- (-780.079) [-786.132] (-781.363) (-780.285) * (-782.534) (-780.152) [-782.194] (-782.689) -- 0:00:28

      Average standard deviation of split frequencies: 0.008392

      540500 -- (-779.602) [-780.186] (-784.714) (-780.887) * (-780.825) (-782.165) (-782.102) [-781.122] -- 0:00:29
      541000 -- (-780.530) [-779.844] (-780.013) (-781.214) * (-781.882) (-778.944) (-780.708) [-779.669] -- 0:00:29
      541500 -- (-781.319) (-781.508) [-779.784] (-783.117) * (-784.544) (-781.086) (-779.506) [-783.030] -- 0:00:29
      542000 -- (-781.181) [-779.922] (-780.951) (-780.102) * (-780.573) (-780.963) [-779.774] (-782.952) -- 0:00:29
      542500 -- (-780.954) (-781.496) (-781.719) [-780.382] * [-779.752] (-781.748) (-785.319) (-781.375) -- 0:00:29
      543000 -- (-780.451) [-780.286] (-778.965) (-779.060) * (-784.327) (-781.086) (-784.135) [-782.059] -- 0:00:29
      543500 -- (-784.258) [-780.438] (-782.159) (-780.947) * (-779.755) [-781.329] (-782.140) (-787.897) -- 0:00:29
      544000 -- (-780.555) [-778.660] (-783.018) (-779.707) * (-779.884) [-783.950] (-795.976) (-780.984) -- 0:00:29
      544500 -- [-779.531] (-779.992) (-782.401) (-780.001) * [-780.606] (-785.628) (-784.506) (-779.731) -- 0:00:29
      545000 -- (-781.922) (-781.435) (-780.021) [-781.317] * (-780.974) (-780.924) [-779.249] (-780.013) -- 0:00:29

      Average standard deviation of split frequencies: 0.008786

      545500 -- (-779.821) (-782.688) (-781.143) [-779.632] * (-782.997) (-781.124) (-782.182) [-779.455] -- 0:00:29
      546000 -- (-780.940) (-782.372) [-780.611] (-783.416) * [-787.832] (-781.674) (-781.500) (-781.261) -- 0:00:29
      546500 -- (-778.892) (-781.318) [-780.369] (-780.149) * (-782.272) [-782.748] (-783.622) (-779.750) -- 0:00:29
      547000 -- [-779.111] (-782.816) (-781.892) (-784.513) * (-780.616) (-780.721) (-780.634) [-779.358] -- 0:00:28
      547500 -- [-780.028] (-781.958) (-781.408) (-780.551) * (-783.069) [-786.812] (-780.527) (-782.305) -- 0:00:28
      548000 -- (-786.196) [-780.940] (-783.962) (-781.023) * (-781.260) [-784.171] (-779.040) (-780.817) -- 0:00:28
      548500 -- (-783.085) (-780.881) (-786.480) [-781.057] * (-783.604) [-780.678] (-783.439) (-779.288) -- 0:00:28
      549000 -- (-780.403) (-780.297) [-782.309] (-780.978) * (-784.361) (-782.261) (-782.309) [-779.200] -- 0:00:28
      549500 -- [-781.032] (-779.687) (-781.784) (-779.939) * (-787.454) (-781.145) (-781.595) [-779.403] -- 0:00:28
      550000 -- [-780.330] (-778.747) (-780.299) (-780.390) * [-779.003] (-781.564) (-780.554) (-782.886) -- 0:00:28

      Average standard deviation of split frequencies: 0.008561

      550500 -- [-779.517] (-782.311) (-782.706) (-781.991) * (-782.428) (-783.891) (-779.064) [-781.010] -- 0:00:28
      551000 -- (-782.498) [-780.723] (-783.803) (-781.906) * [-782.491] (-784.047) (-780.454) (-784.205) -- 0:00:28
      551500 -- (-781.455) (-783.216) (-782.338) [-781.038] * (-779.334) (-785.399) (-782.189) [-779.588] -- 0:00:28
      552000 -- [-781.834] (-779.653) (-780.859) (-780.668) * (-779.340) (-780.454) (-785.212) [-779.136] -- 0:00:28
      552500 -- (-782.670) [-782.337] (-781.318) (-782.056) * (-781.147) (-785.894) [-784.645] (-779.226) -- 0:00:28
      553000 -- (-783.332) (-781.185) [-781.780] (-779.094) * (-782.951) (-782.061) [-782.758] (-781.825) -- 0:00:28
      553500 -- (-780.009) [-780.686] (-780.669) (-779.106) * [-781.858] (-782.920) (-779.707) (-780.140) -- 0:00:28
      554000 -- (-779.174) [-780.122] (-782.125) (-781.142) * [-779.822] (-780.213) (-782.946) (-780.556) -- 0:00:28
      554500 -- [-779.185] (-781.032) (-781.883) (-783.584) * (-780.299) (-782.733) [-779.984] (-781.563) -- 0:00:28
      555000 -- (-779.379) (-780.443) (-780.796) [-780.033] * [-782.438] (-780.678) (-781.002) (-781.746) -- 0:00:28

      Average standard deviation of split frequencies: 0.008678

      555500 -- (-779.401) (-782.568) [-779.862] (-780.501) * [-781.715] (-780.028) (-780.320) (-781.408) -- 0:00:28
      556000 -- (-780.651) (-781.743) [-779.924] (-779.768) * (-786.585) [-781.998] (-781.249) (-780.443) -- 0:00:27
      556500 -- [-778.717] (-781.973) (-780.224) (-782.998) * [-784.272] (-784.924) (-782.493) (-783.074) -- 0:00:27
      557000 -- (-782.685) (-781.067) [-779.899] (-786.161) * (-778.813) (-780.231) [-781.434] (-780.840) -- 0:00:28
      557500 -- (-779.362) (-783.423) [-783.374] (-782.329) * [-783.401] (-784.740) (-784.936) (-779.908) -- 0:00:28
      558000 -- [-780.086] (-782.825) (-781.793) (-789.334) * (-781.817) (-782.296) [-779.904] (-783.937) -- 0:00:28
      558500 -- (-781.561) (-785.144) (-780.406) [-781.975] * (-785.752) [-781.197] (-779.161) (-782.711) -- 0:00:28
      559000 -- [-781.499] (-782.857) (-780.651) (-780.069) * [-781.393] (-779.901) (-778.907) (-784.082) -- 0:00:28
      559500 -- (-781.314) (-788.230) (-778.902) [-782.421] * (-778.918) [-781.342] (-779.609) (-782.002) -- 0:00:28
      560000 -- (-780.405) (-782.536) [-782.331] (-781.579) * (-779.818) (-781.053) (-780.544) [-781.734] -- 0:00:28

      Average standard deviation of split frequencies: 0.009100

      560500 -- (-780.959) (-782.828) (-779.999) [-780.526] * (-779.858) [-781.411] (-782.251) (-781.057) -- 0:00:28
      561000 -- (-780.100) [-781.848] (-781.712) (-783.315) * [-782.137] (-781.725) (-780.300) (-782.629) -- 0:00:28
      561500 -- (-779.489) [-785.325] (-778.455) (-779.420) * [-782.080] (-783.269) (-780.400) (-782.833) -- 0:00:28
      562000 -- (-780.352) [-786.038] (-779.571) (-783.509) * [-780.179] (-781.745) (-780.357) (-784.600) -- 0:00:28
      562500 -- (-783.344) [-780.178] (-783.301) (-781.524) * (-781.731) [-782.825] (-779.461) (-782.838) -- 0:00:28
      563000 -- [-779.933] (-780.991) (-781.776) (-782.884) * (-780.830) (-780.450) [-778.813] (-781.828) -- 0:00:27
      563500 -- (-779.281) [-779.366] (-783.526) (-779.948) * (-783.258) (-784.395) (-780.677) [-781.754] -- 0:00:27
      564000 -- (-780.377) (-780.100) [-779.569] (-780.319) * (-781.784) (-781.325) [-780.282] (-780.064) -- 0:00:27
      564500 -- (-780.950) (-779.025) (-782.212) [-780.345] * (-781.366) (-779.671) [-780.069] (-781.748) -- 0:00:27
      565000 -- (-779.820) [-780.289] (-779.822) (-780.861) * (-784.007) (-782.235) [-780.307] (-779.073) -- 0:00:27

      Average standard deviation of split frequencies: 0.008427

      565500 -- (-781.232) (-780.558) (-779.933) [-783.877] * [-783.067] (-781.046) (-779.799) (-782.470) -- 0:00:27
      566000 -- [-783.515] (-780.348) (-781.706) (-780.826) * (-782.680) [-780.404] (-783.577) (-782.567) -- 0:00:27
      566500 -- (-786.186) [-778.857] (-780.088) (-782.836) * (-781.570) [-780.420] (-779.282) (-784.181) -- 0:00:27
      567000 -- [-780.089] (-778.780) (-782.623) (-781.584) * (-779.390) (-779.331) [-778.976] (-780.021) -- 0:00:27
      567500 -- (-780.145) (-780.441) (-779.627) [-783.991] * (-782.893) [-782.103] (-783.858) (-784.056) -- 0:00:27
      568000 -- (-781.177) (-780.445) (-782.764) [-782.756] * [-781.658] (-779.947) (-781.132) (-780.140) -- 0:00:27
      568500 -- (-780.022) (-779.734) (-782.343) [-784.416] * (-781.149) (-778.949) [-779.392] (-780.736) -- 0:00:27
      569000 -- (-781.853) (-781.240) (-781.450) [-781.323] * (-780.489) [-779.975] (-782.024) (-779.589) -- 0:00:27
      569500 -- [-781.383] (-782.339) (-779.660) (-784.555) * (-781.635) (-779.611) [-778.774] (-780.747) -- 0:00:27
      570000 -- (-785.198) [-781.302] (-780.400) (-780.603) * (-782.069) [-781.032] (-780.281) (-781.229) -- 0:00:27

      Average standard deviation of split frequencies: 0.008406

      570500 -- (-782.618) (-780.832) [-781.679] (-780.105) * (-783.878) (-781.107) [-779.439] (-779.874) -- 0:00:27
      571000 -- (-781.788) (-780.972) [-783.777] (-781.274) * (-786.549) (-780.078) (-779.374) [-780.804] -- 0:00:27
      571500 -- [-779.861] (-782.214) (-779.901) (-780.444) * [-785.046] (-783.783) (-781.493) (-782.193) -- 0:00:26
      572000 -- (-780.380) (-780.277) (-781.397) [-779.988] * [-781.614] (-780.596) (-782.388) (-782.552) -- 0:00:26
      572500 -- [-780.983] (-780.446) (-781.674) (-780.855) * (-784.117) (-783.359) (-783.704) [-781.555] -- 0:00:26
      573000 -- (-783.769) [-780.335] (-780.063) (-781.492) * (-783.729) [-781.026] (-783.851) (-781.329) -- 0:00:26
      573500 -- [-781.368] (-784.862) (-779.935) (-780.326) * [-780.012] (-780.451) (-782.962) (-782.213) -- 0:00:27
      574000 -- (-784.948) [-782.734] (-783.796) (-781.296) * (-780.596) [-780.983] (-779.297) (-783.862) -- 0:00:27
      574500 -- (-787.296) (-783.163) [-781.678] (-782.121) * [-782.393] (-780.639) (-780.522) (-780.344) -- 0:00:27
      575000 -- (-780.604) (-780.142) [-780.751] (-779.665) * [-778.950] (-780.468) (-785.487) (-780.673) -- 0:00:27

      Average standard deviation of split frequencies: 0.008184

      575500 -- (-780.705) (-783.297) [-781.013] (-780.285) * [-778.918] (-781.608) (-780.195) (-780.276) -- 0:00:27
      576000 -- [-779.067] (-789.811) (-781.071) (-781.938) * (-778.765) (-783.485) (-779.534) [-782.268] -- 0:00:27
      576500 -- (-780.586) (-787.352) (-779.774) [-780.206] * (-779.200) (-786.480) (-780.952) [-779.925] -- 0:00:27
      577000 -- (-781.548) [-781.567] (-782.351) (-782.299) * [-780.124] (-782.875) (-783.163) (-780.228) -- 0:00:27
      577500 -- (-780.811) [-782.648] (-780.661) (-780.187) * [-779.160] (-779.369) (-787.274) (-780.578) -- 0:00:27
      578000 -- (-780.185) (-782.107) (-782.776) [-783.449] * [-780.244] (-779.604) (-784.886) (-778.839) -- 0:00:27
      578500 -- (-781.771) (-782.962) [-778.991] (-783.587) * (-782.640) (-781.445) (-782.750) [-782.254] -- 0:00:26
      579000 -- [-784.726] (-779.713) (-780.907) (-779.677) * (-782.004) (-779.762) [-778.516] (-780.795) -- 0:00:26
      579500 -- (-779.753) (-779.797) (-781.290) [-779.301] * [-782.822] (-779.225) (-781.121) (-781.506) -- 0:00:26
      580000 -- (-780.727) (-781.059) (-780.761) [-779.122] * (-779.178) (-780.400) (-780.992) [-780.602] -- 0:00:26

      Average standard deviation of split frequencies: 0.007975

      580500 -- (-781.254) (-779.994) [-779.307] (-780.912) * [-781.080] (-782.198) (-779.471) (-780.091) -- 0:00:26
      581000 -- [-782.459] (-780.035) (-781.088) (-779.358) * (-785.691) [-781.961] (-781.687) (-781.326) -- 0:00:26
      581500 -- (-784.212) (-779.962) (-780.183) [-781.275] * (-785.448) [-781.046] (-781.276) (-780.901) -- 0:00:26
      582000 -- (-784.298) (-781.963) [-780.791] (-781.220) * (-780.481) [-779.213] (-781.148) (-779.059) -- 0:00:26
      582500 -- (-780.495) [-780.703] (-780.798) (-780.041) * (-780.421) (-779.017) (-788.288) [-780.165] -- 0:00:26
      583000 -- [-780.086] (-779.609) (-780.277) (-783.479) * [-778.624] (-778.929) (-785.793) (-781.094) -- 0:00:26
      583500 -- [-779.980] (-781.121) (-779.020) (-780.761) * [-779.620] (-780.338) (-779.786) (-780.386) -- 0:00:26
      584000 -- (-779.952) (-780.665) (-780.807) [-779.783] * (-778.705) [-782.436] (-782.958) (-779.595) -- 0:00:26
      584500 -- [-780.702] (-780.740) (-786.801) (-782.121) * (-779.650) [-779.656] (-781.731) (-781.562) -- 0:00:26
      585000 -- (-780.178) (-781.160) [-779.802] (-783.350) * [-781.047] (-779.960) (-785.592) (-780.645) -- 0:00:26

      Average standard deviation of split frequencies: 0.008281

      585500 -- [-780.869] (-786.338) (-779.092) (-782.182) * (-781.567) (-779.449) [-780.741] (-780.056) -- 0:00:26
      586000 -- (-779.384) (-780.372) [-779.935] (-779.883) * (-781.958) [-779.694] (-780.376) (-779.499) -- 0:00:26
      586500 -- [-779.174] (-782.227) (-778.749) (-780.687) * (-779.747) [-779.623] (-781.700) (-780.252) -- 0:00:26
      587000 -- [-778.836] (-781.601) (-779.923) (-780.054) * (-781.220) (-783.298) (-779.574) [-779.553] -- 0:00:26
      587500 -- (-779.949) (-780.171) [-781.164] (-779.356) * (-780.733) [-780.093] (-785.626) (-780.224) -- 0:00:25
      588000 -- (-781.486) [-779.506] (-784.205) (-781.420) * (-780.362) (-779.610) [-780.469] (-784.209) -- 0:00:25
      588500 -- (-779.455) (-782.515) (-785.185) [-778.876] * (-780.399) [-779.618] (-782.678) (-784.756) -- 0:00:25
      589000 -- (-781.155) (-781.613) [-780.659] (-782.954) * (-779.850) [-779.114] (-783.359) (-782.829) -- 0:00:25
      589500 -- [-779.204] (-782.142) (-780.273) (-780.481) * [-778.869] (-779.899) (-782.277) (-785.553) -- 0:00:26
      590000 -- (-784.974) [-780.442] (-781.981) (-780.098) * (-779.968) (-784.128) [-780.330] (-782.842) -- 0:00:26

      Average standard deviation of split frequencies: 0.008873

      590500 -- (-780.636) [-781.722] (-781.827) (-779.197) * (-783.251) [-781.418] (-783.718) (-782.069) -- 0:00:26
      591000 -- (-780.403) [-779.549] (-785.471) (-778.594) * (-780.779) (-779.729) [-786.271] (-781.950) -- 0:00:26
      591500 -- (-784.049) (-781.921) [-786.406] (-778.550) * (-780.222) [-779.235] (-784.659) (-783.208) -- 0:00:26
      592000 -- (-779.565) (-780.047) [-779.890] (-781.153) * (-779.124) (-781.061) (-781.176) [-783.495] -- 0:00:26
      592500 -- [-779.715] (-779.936) (-780.887) (-780.739) * (-784.562) [-780.278] (-780.755) (-782.496) -- 0:00:26
      593000 -- (-780.245) (-782.589) (-782.516) [-780.067] * (-780.445) [-780.106] (-782.038) (-782.990) -- 0:00:26
      593500 -- [-779.364] (-782.852) (-781.391) (-781.021) * (-779.903) (-780.866) (-779.757) [-783.588] -- 0:00:26
      594000 -- [-779.692] (-780.267) (-780.232) (-783.908) * (-783.664) [-782.952] (-784.963) (-781.621) -- 0:00:25
      594500 -- [-779.698] (-780.449) (-779.931) (-780.907) * [-783.080] (-779.880) (-784.356) (-780.246) -- 0:00:25
      595000 -- (-780.071) (-780.210) (-779.760) [-781.584] * (-783.356) [-780.028] (-781.541) (-780.059) -- 0:00:25

      Average standard deviation of split frequencies: 0.008453

      595500 -- [-780.069] (-784.303) (-781.961) (-779.541) * (-786.435) [-781.075] (-781.443) (-783.109) -- 0:00:25
      596000 -- (-779.852) (-781.129) (-780.636) [-779.252] * (-786.674) (-782.548) (-782.704) [-783.375] -- 0:00:25
      596500 -- (-780.800) [-780.873] (-780.464) (-782.031) * (-784.470) [-781.100] (-779.688) (-782.909) -- 0:00:25
      597000 -- (-783.567) (-784.128) (-781.558) [-778.934] * (-784.610) (-780.584) (-781.413) [-779.726] -- 0:00:25
      597500 -- (-780.298) (-780.734) [-782.017] (-781.284) * (-780.976) (-779.375) [-779.780] (-779.735) -- 0:00:25
      598000 -- [-778.956] (-780.402) (-780.554) (-787.742) * (-780.582) [-779.773] (-781.145) (-780.497) -- 0:00:25
      598500 -- [-779.451] (-779.928) (-781.878) (-782.237) * [-779.952] (-783.741) (-784.797) (-782.514) -- 0:00:25
      599000 -- (-781.448) (-784.454) (-787.292) [-780.955] * (-781.672) (-780.928) (-778.948) [-781.847] -- 0:00:25
      599500 -- (-783.820) (-779.247) [-780.857] (-780.404) * (-782.774) (-782.935) [-781.148] (-779.086) -- 0:00:25
      600000 -- (-782.982) [-778.958] (-782.612) (-779.620) * [-783.813] (-781.147) (-780.517) (-781.053) -- 0:00:25

      Average standard deviation of split frequencies: 0.007799

      600500 -- (-783.800) [-781.930] (-782.956) (-779.456) * [-780.065] (-780.425) (-784.886) (-782.971) -- 0:00:25
      601000 -- [-781.032] (-782.869) (-781.341) (-782.217) * (-784.558) [-782.633] (-781.685) (-783.844) -- 0:00:25
      601500 -- (-783.558) (-784.141) [-781.372] (-781.558) * (-782.027) (-779.370) (-780.115) [-779.703] -- 0:00:25
      602000 -- [-781.850] (-779.791) (-778.664) (-779.965) * (-779.824) (-779.982) [-778.857] (-779.580) -- 0:00:25
      602500 -- [-782.251] (-782.427) (-781.780) (-780.116) * [-781.523] (-781.272) (-779.777) (-780.409) -- 0:00:25
      603000 -- (-780.814) [-785.037] (-782.346) (-779.562) * (-780.903) (-783.116) (-780.014) [-780.117] -- 0:00:25
      603500 -- (-781.310) (-780.559) (-780.767) [-779.390] * (-786.693) (-781.246) [-780.999] (-780.429) -- 0:00:24
      604000 -- (-782.377) [-778.950] (-783.519) (-782.811) * (-782.684) (-780.680) [-782.695] (-782.972) -- 0:00:24
      604500 -- (-786.532) [-778.709] (-779.731) (-781.349) * (-778.896) [-779.749] (-782.065) (-779.943) -- 0:00:24
      605000 -- (-784.698) [-779.432] (-781.532) (-779.078) * (-779.947) [-779.250] (-781.429) (-781.246) -- 0:00:24

      Average standard deviation of split frequencies: 0.007536

      605500 -- (-780.416) [-780.210] (-782.601) (-781.183) * (-783.249) (-780.464) (-786.394) [-780.997] -- 0:00:25
      606000 -- (-781.156) (-779.981) (-782.904) [-783.861] * (-782.396) [-781.587] (-784.692) (-781.766) -- 0:00:25
      606500 -- [-780.485] (-779.879) (-779.440) (-784.105) * (-783.955) [-780.360] (-780.352) (-779.610) -- 0:00:25
      607000 -- (-779.073) (-780.303) [-779.569] (-782.705) * (-780.526) (-780.243) [-780.763] (-783.912) -- 0:00:25
      607500 -- [-779.675] (-780.948) (-781.362) (-786.481) * (-779.458) (-784.316) (-781.387) [-780.655] -- 0:00:25
      608000 -- (-779.234) (-782.718) (-781.626) [-781.632] * (-779.266) [-778.859] (-780.056) (-779.154) -- 0:00:25
      608500 -- [-781.904] (-781.056) (-781.620) (-781.209) * (-780.473) (-781.953) [-779.976] (-780.201) -- 0:00:25
      609000 -- [-779.246] (-785.557) (-779.718) (-778.682) * [-780.048] (-784.233) (-780.099) (-781.698) -- 0:00:25
      609500 -- (-780.516) (-785.774) [-780.104] (-778.637) * (-782.959) (-780.116) (-779.738) [-779.690] -- 0:00:24
      610000 -- (-781.025) (-788.619) [-779.865] (-780.893) * [-780.056] (-780.297) (-779.622) (-780.353) -- 0:00:24

      Average standard deviation of split frequencies: 0.007816

      610500 -- [-780.833] (-782.217) (-780.918) (-779.765) * (-779.036) (-780.912) [-784.002] (-781.711) -- 0:00:24
      611000 -- [-779.738] (-783.055) (-781.548) (-782.776) * (-781.022) (-781.480) [-786.478] (-778.919) -- 0:00:24
      611500 -- (-780.003) (-785.196) [-782.416] (-780.014) * (-783.574) [-780.087] (-782.813) (-781.858) -- 0:00:24
      612000 -- [-779.270] (-781.316) (-784.863) (-780.344) * (-778.855) (-780.019) (-779.417) [-782.947] -- 0:00:24
      612500 -- (-779.511) [-780.412] (-785.643) (-779.631) * (-780.909) (-780.950) [-778.871] (-781.478) -- 0:00:24
      613000 -- [-780.658] (-781.674) (-780.478) (-780.711) * [-780.674] (-781.693) (-779.453) (-780.890) -- 0:00:24
      613500 -- (-783.300) (-780.308) (-781.948) [-783.393] * [-781.928] (-781.392) (-780.201) (-783.076) -- 0:00:24
      614000 -- (-781.058) (-781.026) [-782.633] (-780.152) * [-783.125] (-783.060) (-779.767) (-782.256) -- 0:00:24
      614500 -- [-780.050] (-780.386) (-780.775) (-781.519) * (-783.070) [-781.354] (-780.009) (-781.227) -- 0:00:24
      615000 -- [-778.959] (-782.346) (-780.073) (-780.794) * (-780.709) [-780.306] (-782.765) (-781.281) -- 0:00:24

      Average standard deviation of split frequencies: 0.007142

      615500 -- (-780.954) [-785.677] (-779.516) (-779.340) * (-778.900) [-779.297] (-783.074) (-782.579) -- 0:00:24
      616000 -- [-780.677] (-782.511) (-779.595) (-781.317) * (-782.526) [-781.359] (-781.564) (-785.193) -- 0:00:24
      616500 -- (-779.569) (-780.778) (-783.304) [-781.478] * (-781.831) [-781.783] (-781.936) (-782.847) -- 0:00:24
      617000 -- (-784.026) (-784.155) (-780.994) [-780.600] * (-783.490) (-782.106) [-781.527] (-780.299) -- 0:00:24
      617500 -- [-780.074] (-783.033) (-781.762) (-780.571) * [-781.074] (-781.213) (-782.487) (-780.794) -- 0:00:24
      618000 -- [-781.795] (-783.873) (-779.114) (-779.724) * (-782.870) (-782.956) [-779.941] (-781.496) -- 0:00:24
      618500 -- (-779.763) (-786.209) [-778.731] (-782.156) * (-780.905) [-779.825] (-781.240) (-781.469) -- 0:00:24
      619000 -- (-780.159) (-784.526) (-781.332) [-778.963] * [-781.303] (-781.921) (-782.802) (-782.873) -- 0:00:24
      619500 -- (-779.756) (-791.060) [-780.275] (-778.919) * (-780.936) (-780.661) (-781.514) [-782.145] -- 0:00:23
      620000 -- (-780.327) (-791.947) (-781.281) [-784.697] * (-778.828) (-779.975) (-786.067) [-779.274] -- 0:00:23

      Average standard deviation of split frequencies: 0.007190

      620500 -- (-779.920) (-785.511) [-781.739] (-784.607) * (-782.908) (-781.858) (-781.620) [-780.028] -- 0:00:23
      621000 -- (-783.014) [-780.745] (-780.921) (-781.106) * [-781.958] (-780.926) (-778.862) (-779.582) -- 0:00:23
      621500 -- (-784.860) [-780.954] (-779.904) (-781.265) * (-783.039) (-783.134) [-780.554] (-785.282) -- 0:00:24
      622000 -- [-780.372] (-784.283) (-779.573) (-779.807) * (-782.853) [-781.724] (-781.299) (-780.441) -- 0:00:24
      622500 -- (-780.683) (-781.517) (-780.135) [-780.493] * (-783.562) [-780.796] (-779.480) (-779.629) -- 0:00:24
      623000 -- (-782.534) (-781.271) (-782.352) [-781.123] * [-780.698] (-779.567) (-780.941) (-782.642) -- 0:00:24
      623500 -- (-779.970) (-780.690) (-784.541) [-779.869] * (-780.010) [-782.211] (-782.364) (-782.366) -- 0:00:24
      624000 -- (-785.898) (-781.107) (-784.610) [-780.491] * (-780.197) [-779.499] (-780.602) (-783.552) -- 0:00:24
      624500 -- (-782.995) (-780.840) (-784.697) [-782.801] * (-781.794) (-780.945) [-781.575] (-782.979) -- 0:00:24
      625000 -- (-784.608) [-780.889] (-784.446) (-782.595) * (-781.846) [-781.114] (-780.336) (-784.003) -- 0:00:24

      Average standard deviation of split frequencies: 0.007179

      625500 -- (-784.165) [-780.931] (-779.270) (-780.044) * (-779.567) (-780.040) [-781.960] (-782.000) -- 0:00:23
      626000 -- [-786.022] (-779.773) (-780.230) (-779.335) * [-778.883] (-782.073) (-784.646) (-779.772) -- 0:00:23
      626500 -- (-784.296) (-780.256) [-780.000] (-780.291) * (-781.011) (-779.814) (-786.072) [-779.793] -- 0:00:23
      627000 -- (-781.168) (-783.839) (-781.700) [-778.990] * (-782.725) [-780.287] (-784.222) (-780.374) -- 0:00:23
      627500 -- (-780.558) (-779.496) [-785.892] (-778.990) * (-780.013) [-779.096] (-780.225) (-782.491) -- 0:00:23
      628000 -- (-778.906) [-781.679] (-780.349) (-782.034) * [-779.616] (-779.361) (-781.023) (-784.693) -- 0:00:23
      628500 -- (-779.570) (-783.737) (-781.393) [-783.408] * (-782.374) (-780.729) (-780.989) [-779.848] -- 0:00:23
      629000 -- (-780.174) (-781.383) [-781.545] (-780.066) * (-780.551) [-779.784] (-780.946) (-785.886) -- 0:00:23
      629500 -- (-780.603) (-781.462) (-779.496) [-778.811] * (-783.398) (-785.569) [-779.317] (-782.401) -- 0:00:23
      630000 -- (-782.157) (-780.921) [-782.544] (-783.968) * (-780.795) (-782.383) (-779.476) [-783.136] -- 0:00:23

      Average standard deviation of split frequencies: 0.006927

      630500 -- [-780.406] (-783.553) (-780.384) (-782.320) * [-778.679] (-782.508) (-784.991) (-782.078) -- 0:00:23
      631000 -- (-783.360) (-781.383) [-780.464] (-782.856) * (-782.231) (-779.686) (-782.343) [-781.245] -- 0:00:23
      631500 -- [-781.427] (-780.046) (-780.739) (-782.682) * [-781.357] (-780.363) (-780.040) (-781.179) -- 0:00:23
      632000 -- (-779.242) (-780.159) (-781.238) [-781.630] * (-785.341) [-784.095] (-781.216) (-783.183) -- 0:00:23
      632500 -- [-779.507] (-782.168) (-781.216) (-779.973) * (-781.181) [-781.354] (-782.036) (-781.442) -- 0:00:23
      633000 -- (-779.922) [-780.686] (-785.254) (-781.727) * (-785.782) (-781.385) (-784.900) [-781.686] -- 0:00:23
      633500 -- [-779.464] (-781.437) (-781.178) (-787.064) * [-780.410] (-783.080) (-783.636) (-781.854) -- 0:00:23
      634000 -- (-781.157) (-781.451) [-782.120] (-779.533) * (-780.832) (-778.988) [-779.761] (-778.951) -- 0:00:23
      634500 -- (-782.778) [-779.614] (-782.375) (-780.238) * [-783.300] (-780.678) (-779.949) (-781.858) -- 0:00:23
      635000 -- (-779.191) [-781.765] (-780.365) (-783.131) * (-781.924) [-778.994] (-779.689) (-780.311) -- 0:00:22

      Average standard deviation of split frequencies: 0.006770

      635500 -- (-779.365) [-781.385] (-781.000) (-783.628) * (-781.530) [-783.704] (-783.747) (-779.786) -- 0:00:22
      636000 -- (-781.242) [-782.035] (-780.590) (-782.627) * [-782.743] (-787.920) (-783.031) (-779.805) -- 0:00:22
      636500 -- (-779.397) (-784.417) (-781.323) [-780.349] * (-781.766) (-782.640) (-786.800) [-780.212] -- 0:00:22
      637000 -- (-779.204) (-779.901) [-781.864] (-784.685) * [-783.796] (-785.943) (-783.209) (-780.250) -- 0:00:22
      637500 -- [-779.184] (-781.838) (-779.715) (-779.813) * (-788.585) (-789.666) (-783.153) [-779.696] -- 0:00:22
      638000 -- (-779.518) (-782.772) (-782.829) [-778.988] * (-781.013) (-786.440) (-787.208) [-780.664] -- 0:00:23
      638500 -- (-778.936) (-781.472) [-780.918] (-784.162) * (-780.997) (-787.989) (-781.295) [-779.356] -- 0:00:23
      639000 -- [-780.246] (-780.818) (-783.983) (-779.555) * [-780.600] (-785.529) (-779.793) (-780.998) -- 0:00:23
      639500 -- [-778.609] (-780.703) (-782.443) (-779.230) * (-781.033) (-780.806) (-779.996) [-778.935] -- 0:00:23
      640000 -- [-780.059] (-778.668) (-783.863) (-784.061) * (-780.044) [-781.740] (-783.955) (-781.944) -- 0:00:23

      Average standard deviation of split frequencies: 0.007496

      640500 -- [-779.857] (-779.544) (-784.657) (-782.445) * (-780.930) (-779.102) [-779.589] (-782.028) -- 0:00:23
      641000 -- [-780.054] (-779.866) (-784.062) (-780.854) * (-782.139) (-779.717) [-780.346] (-782.925) -- 0:00:22
      641500 -- (-780.313) (-779.957) [-782.189] (-783.181) * [-779.628] (-780.633) (-778.780) (-780.653) -- 0:00:22
      642000 -- (-782.073) (-779.236) [-781.027] (-779.483) * (-782.837) (-780.668) (-780.559) [-780.703] -- 0:00:22
      642500 -- (-781.432) [-778.939] (-780.603) (-783.339) * (-779.090) (-779.585) [-781.212] (-779.716) -- 0:00:22
      643000 -- (-781.801) (-779.593) (-779.898) [-781.333] * (-779.295) (-780.435) (-780.772) [-781.453] -- 0:00:22
      643500 -- (-787.052) [-778.606] (-781.958) (-786.499) * [-780.930] (-784.291) (-779.395) (-783.290) -- 0:00:22
      644000 -- (-784.023) (-780.915) (-784.771) [-778.646] * (-781.984) (-780.778) [-779.635] (-783.693) -- 0:00:22
      644500 -- (-780.045) (-780.355) [-779.425] (-781.101) * (-782.633) [-781.585] (-779.374) (-782.054) -- 0:00:22
      645000 -- (-783.170) (-779.605) (-779.556) [-785.116] * [-779.584] (-781.175) (-780.922) (-782.233) -- 0:00:22

      Average standard deviation of split frequencies: 0.007160

      645500 -- (-782.031) [-781.822] (-780.241) (-787.817) * (-781.654) [-782.488] (-783.084) (-781.772) -- 0:00:22
      646000 -- (-780.824) [-780.668] (-780.061) (-784.452) * (-779.584) [-781.431] (-778.831) (-780.989) -- 0:00:22
      646500 -- (-784.095) (-783.389) [-779.520] (-782.884) * [-779.515] (-780.390) (-780.951) (-780.733) -- 0:00:22
      647000 -- (-782.579) (-780.630) [-779.697] (-787.589) * (-779.066) [-781.214] (-781.223) (-779.833) -- 0:00:22
      647500 -- (-781.445) (-780.053) [-778.890] (-782.708) * (-782.881) [-780.953] (-782.631) (-780.021) -- 0:00:22
      648000 -- (-784.074) (-781.634) (-779.199) [-782.581] * (-780.454) (-779.699) (-782.335) [-780.515] -- 0:00:22
      648500 -- (-783.673) (-782.675) [-779.587] (-779.785) * (-781.431) (-779.233) [-780.210] (-783.096) -- 0:00:22
      649000 -- (-780.229) [-784.920] (-781.842) (-779.459) * (-783.360) (-779.304) (-780.691) [-784.155] -- 0:00:22
      649500 -- (-780.548) (-780.930) [-779.125] (-780.232) * (-780.281) (-780.958) [-779.158] (-782.521) -- 0:00:22
      650000 -- [-782.128] (-781.407) (-780.513) (-779.362) * (-780.704) (-779.946) (-780.049) [-782.445] -- 0:00:22

      Average standard deviation of split frequencies: 0.007607

      650500 -- (-779.273) (-779.419) (-783.298) [-778.806] * (-783.343) [-781.439] (-779.653) (-788.499) -- 0:00:22
      651000 -- [-780.485] (-780.483) (-782.087) (-779.365) * (-779.668) [-783.316] (-783.032) (-778.663) -- 0:00:21
      651500 -- (-780.976) (-778.890) (-781.265) [-779.399] * [-781.682] (-784.275) (-780.952) (-780.811) -- 0:00:21
      652000 -- (-781.677) (-782.060) (-784.170) [-780.508] * [-781.456] (-779.189) (-781.063) (-782.603) -- 0:00:21
      652500 -- (-780.687) [-779.977] (-787.103) (-779.780) * (-780.014) (-781.175) [-780.584] (-782.072) -- 0:00:21
      653000 -- (-780.955) (-782.111) [-780.457] (-779.931) * (-783.107) (-782.384) (-780.525) [-782.109] -- 0:00:21
      653500 -- (-780.163) (-778.835) (-781.564) [-779.582] * [-781.067] (-781.552) (-779.102) (-782.031) -- 0:00:21
      654000 -- (-785.617) (-779.433) (-781.418) [-779.269] * (-779.519) [-779.060] (-783.120) (-781.029) -- 0:00:22
      654500 -- [-778.777] (-782.881) (-784.737) (-781.167) * (-779.774) [-781.961] (-782.213) (-779.856) -- 0:00:22
      655000 -- [-779.405] (-779.268) (-779.453) (-781.401) * [-781.181] (-783.036) (-779.427) (-782.017) -- 0:00:22

      Average standard deviation of split frequencies: 0.007635

      655500 -- [-778.822] (-780.423) (-780.350) (-780.859) * [-779.650] (-781.109) (-783.808) (-781.903) -- 0:00:22
      656000 -- [-781.210] (-783.689) (-779.607) (-781.173) * (-782.657) (-779.874) (-781.926) [-780.517] -- 0:00:22
      656500 -- [-783.560] (-780.770) (-780.705) (-781.831) * (-780.546) (-783.320) (-784.695) [-783.380] -- 0:00:21
      657000 -- (-783.688) (-781.896) [-782.077] (-779.114) * (-781.842) (-781.410) (-782.264) [-781.643] -- 0:00:21
      657500 -- (-783.760) [-782.663] (-779.904) (-785.350) * (-781.046) [-779.899] (-782.752) (-780.487) -- 0:00:21
      658000 -- [-779.269] (-780.234) (-780.492) (-780.502) * (-781.903) (-779.363) [-779.984] (-783.700) -- 0:00:21
      658500 -- (-780.253) (-781.204) (-779.875) [-779.522] * (-784.067) (-779.925) (-779.746) [-778.988] -- 0:00:21
      659000 -- [-780.886] (-781.595) (-782.767) (-786.650) * (-782.141) [-780.734] (-781.198) (-779.347) -- 0:00:21
      659500 -- (-780.369) (-781.294) [-779.365] (-782.741) * (-783.608) [-780.362] (-782.279) (-780.689) -- 0:00:21
      660000 -- (-779.666) [-780.308] (-782.019) (-783.664) * (-783.783) (-784.224) [-782.305] (-780.262) -- 0:00:21

      Average standard deviation of split frequencies: 0.008072

      660500 -- (-779.568) (-783.804) (-780.827) [-780.216] * (-783.893) (-780.828) (-780.101) [-779.532] -- 0:00:21
      661000 -- (-779.264) [-779.009] (-781.565) (-779.087) * (-779.864) (-781.711) [-780.850] (-782.347) -- 0:00:21
      661500 -- [-780.402] (-780.986) (-778.794) (-781.916) * (-780.066) (-784.199) (-779.940) [-783.650] -- 0:00:21
      662000 -- (-779.846) (-783.058) (-780.371) [-780.648] * (-779.505) [-781.007] (-780.627) (-780.303) -- 0:00:21
      662500 -- (-780.300) (-781.988) (-780.656) [-786.099] * (-779.202) [-779.660] (-781.322) (-780.508) -- 0:00:21
      663000 -- (-779.529) (-780.185) [-779.719] (-780.132) * [-780.323] (-780.781) (-781.275) (-780.231) -- 0:00:21
      663500 -- (-780.101) (-779.723) [-779.701] (-780.335) * (-781.024) [-781.715] (-780.271) (-778.899) -- 0:00:21
      664000 -- (-781.513) [-780.156] (-779.027) (-784.231) * [-782.552] (-779.899) (-779.476) (-781.645) -- 0:00:21
      664500 -- (-779.166) (-780.764) [-784.903] (-784.266) * [-782.674] (-780.255) (-779.456) (-780.687) -- 0:00:21
      665000 -- (-779.232) (-780.581) (-784.976) [-780.348] * (-782.066) (-778.602) (-781.478) [-779.765] -- 0:00:21

      Average standard deviation of split frequencies: 0.007874

      665500 -- [-780.594] (-780.434) (-783.652) (-780.129) * (-780.833) (-782.254) (-782.799) [-778.833] -- 0:00:21
      666000 -- [-785.605] (-782.438) (-779.332) (-781.724) * (-780.418) (-779.885) [-783.820] (-779.965) -- 0:00:21
      666500 -- (-780.512) [-780.532] (-778.846) (-780.057) * (-780.352) (-781.593) (-780.621) [-779.670] -- 0:00:21
      667000 -- (-779.714) [-779.410] (-780.715) (-783.217) * (-781.705) (-780.345) [-782.582] (-781.057) -- 0:00:20
      667500 -- [-779.854] (-779.410) (-782.236) (-786.167) * (-783.927) (-783.690) [-781.415] (-779.662) -- 0:00:20
      668000 -- (-782.981) (-780.340) (-779.352) [-785.700] * (-781.021) (-784.067) (-781.257) [-780.104] -- 0:00:20
      668500 -- (-782.160) (-780.171) (-779.685) [-780.359] * (-781.262) (-781.128) [-779.738] (-784.918) -- 0:00:20
      669000 -- (-781.070) (-781.387) (-779.376) [-781.637] * [-781.096] (-778.984) (-779.667) (-781.764) -- 0:00:20
      669500 -- [-779.844] (-780.099) (-779.124) (-781.644) * (-779.515) (-780.154) [-781.953] (-780.689) -- 0:00:20
      670000 -- (-783.246) (-779.419) [-779.626] (-779.513) * (-779.171) (-783.408) [-780.875] (-780.894) -- 0:00:20

      Average standard deviation of split frequencies: 0.007951

      670500 -- (-779.970) (-781.117) [-781.710] (-780.480) * (-779.298) (-780.531) (-784.680) [-780.029] -- 0:00:21
      671000 -- (-778.900) (-783.554) [-782.425] (-783.578) * (-782.883) [-780.979] (-782.821) (-780.559) -- 0:00:21
      671500 -- (-779.949) [-781.060] (-779.884) (-784.871) * (-779.366) (-780.999) (-781.332) [-781.129] -- 0:00:21
      672000 -- (-780.067) (-783.154) [-781.161] (-782.048) * (-779.128) [-781.041] (-785.971) (-783.128) -- 0:00:20
      672500 -- (-781.369) (-779.913) [-780.880] (-779.597) * [-780.072] (-781.188) (-780.788) (-783.810) -- 0:00:20
      673000 -- (-785.513) (-780.097) [-781.322] (-778.662) * (-780.070) [-782.728] (-784.046) (-786.087) -- 0:00:20
      673500 -- (-787.859) [-780.917] (-780.684) (-781.493) * (-779.064) (-786.241) (-782.333) [-782.692] -- 0:00:20
      674000 -- [-781.994] (-782.236) (-780.750) (-779.955) * (-783.187) (-781.797) [-782.015] (-781.799) -- 0:00:20
      674500 -- (-781.896) (-781.275) [-779.042] (-780.601) * (-779.582) (-781.564) [-780.922] (-779.741) -- 0:00:20
      675000 -- (-779.090) (-779.345) [-781.137] (-780.601) * (-779.814) (-782.153) (-779.206) [-778.774] -- 0:00:20

      Average standard deviation of split frequencies: 0.008194

      675500 -- (-779.848) (-780.397) (-781.527) [-781.141] * (-782.719) (-785.041) [-780.664] (-781.777) -- 0:00:20
      676000 -- [-783.415] (-785.279) (-782.452) (-782.085) * (-780.972) (-784.929) (-784.464) [-783.886] -- 0:00:20
      676500 -- (-781.912) (-781.167) (-783.361) [-781.882] * (-782.326) [-781.487] (-785.573) (-781.125) -- 0:00:20
      677000 -- [-782.641] (-784.283) (-779.823) (-780.839) * [-781.971] (-780.092) (-782.977) (-780.736) -- 0:00:20
      677500 -- [-779.919] (-779.930) (-781.258) (-781.662) * (-780.868) (-781.478) [-782.701] (-780.259) -- 0:00:20
      678000 -- (-779.653) [-778.900] (-781.843) (-780.971) * (-779.477) (-785