--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:43:36 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0115/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -731.10 -735.40
2 -731.17 -735.87
--------------------------------------
TOTAL -731.13 -735.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.870990 0.089372 0.347670 1.461903 0.844034 1252.11 1351.44 1.000
r(A<->C){all} 0.157256 0.018994 0.000078 0.439896 0.116745 251.91 318.59 1.000
r(A<->G){all} 0.160243 0.019437 0.000035 0.438150 0.120644 154.34 216.28 1.007
r(A<->T){all} 0.141613 0.016733 0.000041 0.405341 0.101782 163.10 194.55 1.000
r(C<->G){all} 0.183228 0.023474 0.000093 0.494800 0.139948 167.74 206.11 1.001
r(C<->T){all} 0.139749 0.015465 0.000001 0.397261 0.103614 161.80 188.61 1.004
r(G<->T){all} 0.217912 0.024328 0.000158 0.526889 0.185560 244.71 250.08 1.000
pi(A){all} 0.239050 0.000340 0.202029 0.275504 0.238671 1111.73 1198.92 1.000
pi(C){all} 0.311589 0.000391 0.272694 0.350206 0.311045 1343.26 1361.59 1.000
pi(G){all} 0.307341 0.000404 0.267475 0.346043 0.306628 1244.65 1249.45 1.000
pi(T){all} 0.142019 0.000224 0.113364 0.170568 0.141741 1083.90 1217.92 1.000
alpha{1,2} 0.217740 0.058340 0.003730 0.532483 0.158979 1244.40 1305.49 1.000
alpha{3} 0.392032 0.206914 0.000108 1.300563 0.236662 1230.69 1296.38 1.000
pinvar{all} 0.992728 0.000030 0.981441 0.999756 0.994138 981.53 1200.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -678.238861
Model 2: PositiveSelection -678.057859
Model 0: one-ratio -678.05785
Model 7: beta -678.238862
Model 8: beta&w>1 -678.05786
Model 0 vs 1 0.3620220000000245
Model 2 vs 1 0.36200400000006994
Model 8 vs 7 0.36200400000006994
>C1
LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
RHSALPPGMGKPGQAGGQGTGQYLoooo
>C2
LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
RHSALPPGMGKPGQAGGQGTGQYLoooo
>C3
LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
RHSALPPGMGKPGQAGGQGTGQYLoooo
>C4
LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
RHSALPPGMGKPGQAGGQGTGQYLoooo
>C5
MVFGLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C6
MVFGLNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
C1 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
C2 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
C3 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
C4 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
C5 MVFGLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
C6 MVFGLNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
************** *******************************
C1 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
C2 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
C3 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
C4 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
C5 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
C6 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
**************************************************
C1 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
C2 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
C3 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
C4 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
C5 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
C6 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
**************************************************
C1 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
C2 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
C3 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
C4 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
C5 LEQMRHSALPPGMGKPGQAGGQGTGQYL----
C6 LEQMRHSALPPGMGKPGQAGGQGTGQYL----
****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 178 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 178 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5372]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5372]--->[5356]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.708 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
C2 LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
C3 LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
C4 LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
C5 LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
C6 LNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKVMRIG
************** ***********************************
C1 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
C2 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
C3 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
C4 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
C5 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
C6 TMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREELDRLT
**************************************************
C1 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
C2 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
C3 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
C4 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
C5 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
C6 LPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQM
**************************************************
C1 RHSALPPGMGKPGQAGGQGTGQYL
C2 RHSALPPGMGKPGQAGGQGTGQYL
C3 RHSALPPGMGKPGQAGGQGTGQYL
C4 RHSALPPGMGKPGQAGGQGTGQYL
C5 RHSALPPGMGKPGQAGGQGTGQYL
C6 RHSALPPGMGKPGQAGGQGTGQYL
************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.43 C1 C6 99.43
TOP 5 0 99.43 C6 C1 99.43
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.43 C2 C6 99.43
TOP 5 1 99.43 C6 C2 99.43
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.43 C3 C6 99.43
TOP 5 2 99.43 C6 C3 99.43
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.43 C4 C6 99.43
TOP 5 3 99.43 C6 C4 99.43
BOT 4 5 99.44 C5 C6 99.44
TOP 5 4 99.44 C6 C5 99.44
AVG 0 C1 * 99.89
AVG 1 C2 * 99.89
AVG 2 C3 * 99.89
AVG 3 C4 * 99.89
AVG 4 C5 * 99.89
AVG 5 C6 * 99.43
TOT TOT * 99.81
CLUSTAL W (1.83) multiple sequence alignment
C1 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
C2 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
C3 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
C4 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
C5 ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG
C6 ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG
**************************************
C1 CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
C2 CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
C3 CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
C4 CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
C5 CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
C6 CGGGGGCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
***** ********************************************
C1 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
C2 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
C3 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
C4 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
C5 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
C6 ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
**************************************************
C1 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
C2 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
C3 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
C4 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
C5 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
C6 ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
**************************************************
C1 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
C2 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
C3 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
C4 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
C5 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
C6 GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
**************************************************
C1 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
C2 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
C3 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
C4 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
C5 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
C6 GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
**************************************************
C1 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
C2 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
C3 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
C4 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
C5 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
C6 GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
**************************************************
C1 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
C2 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
C3 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
C4 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
C5 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
C6 GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
**************************************************
C1 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
C2 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
C3 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
C4 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
C5 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
C6 ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
**************************************************
C1 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
C2 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
C3 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
C4 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
C5 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
C6 CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
**************************************************
C1 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
C2 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
C3 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
C4 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
C5 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
C6 ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
**********************************
>C1
------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C2
------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C3
------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C4
------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C5
ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C6
ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG
CGGGGGCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG
ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG
ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC
GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA
GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC
GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA
GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC
ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG
CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG
ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>C1
ooooLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C2
ooooLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C3
ooooLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C4
ooooLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C5
MVFGLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
>C6
MVFGLNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
LEQMRHSALPPGMGKPGQAGGQGTGQYL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 546 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790515
Setting output file names to "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 388396252
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0001374684
Seed = 1131396822
Swapseed = 1579790515
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 8 unique site patterns
Division 3 has 8 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1191.652577 -- -24.965149
Chain 2 -- -1192.661324 -- -24.965149
Chain 3 -- -1193.613123 -- -24.965149
Chain 4 -- -1191.652579 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1193.613189 -- -24.965149
Chain 2 -- -1193.613123 -- -24.965149
Chain 3 -- -1190.590887 -- -24.965149
Chain 4 -- -1190.590710 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1191.653] (-1192.661) (-1193.613) (-1191.653) * [-1193.613] (-1193.613) (-1190.591) (-1190.591)
500 -- (-742.220) (-753.239) (-755.519) [-735.896] * (-743.772) [-742.731] (-741.190) (-746.711) -- 0:00:00
1000 -- (-732.929) (-742.366) (-745.006) [-735.628] * (-737.143) [-737.313] (-736.625) (-755.521) -- 0:00:00
1500 -- [-736.807] (-735.929) (-738.699) (-736.855) * [-731.772] (-734.400) (-742.050) (-742.562) -- 0:00:00
2000 -- (-735.342) (-743.337) (-742.579) [-734.605] * (-743.368) [-732.580] (-736.312) (-737.506) -- 0:00:00
2500 -- [-734.106] (-733.710) (-736.914) (-735.854) * (-732.857) (-736.203) (-736.854) [-734.123] -- 0:00:00
3000 -- [-734.717] (-732.415) (-737.432) (-731.343) * (-738.314) (-745.327) (-738.277) [-732.900] -- 0:00:00
3500 -- (-744.026) (-730.894) [-731.777] (-736.771) * (-733.619) [-737.790] (-740.825) (-740.541) -- 0:00:00
4000 -- (-733.334) (-733.415) (-744.989) [-745.136] * [-735.033] (-731.583) (-739.707) (-735.589) -- 0:00:00
4500 -- (-737.377) (-743.465) [-740.568] (-737.212) * (-738.933) (-742.090) [-741.724] (-734.050) -- 0:00:00
5000 -- [-737.704] (-736.619) (-738.088) (-735.219) * [-739.573] (-735.095) (-734.281) (-740.520) -- 0:00:00
Average standard deviation of split frequencies: 0.098209
5500 -- (-749.163) (-734.275) (-736.805) [-731.067] * (-737.060) (-735.375) [-733.983] (-733.976) -- 0:00:00
6000 -- (-733.973) [-733.243] (-734.224) (-733.566) * (-739.611) (-738.748) [-737.997] (-733.393) -- 0:00:00
6500 -- [-738.138] (-732.542) (-735.743) (-734.557) * [-737.419] (-748.050) (-737.202) (-732.450) -- 0:00:00
7000 -- (-741.818) (-742.460) [-739.350] (-735.257) * [-734.897] (-734.025) (-736.505) (-744.672) -- 0:00:00
7500 -- (-741.054) (-732.163) [-731.791] (-740.492) * [-736.452] (-740.543) (-733.291) (-738.600) -- 0:00:00
8000 -- (-734.797) (-740.661) [-730.579] (-737.779) * (-741.001) (-732.588) (-742.685) [-738.302] -- 0:02:04
8500 -- (-744.547) [-730.690] (-736.893) (-733.699) * (-738.125) [-735.203] (-742.690) (-736.929) -- 0:01:56
9000 -- [-741.351] (-744.471) (-734.032) (-741.069) * (-733.638) [-732.601] (-745.205) (-736.738) -- 0:01:50
9500 -- (-746.318) (-748.380) [-731.316] (-736.202) * (-736.317) (-738.163) (-743.791) [-736.122] -- 0:01:44
10000 -- (-734.706) (-736.644) [-735.934] (-739.303) * (-741.762) (-732.392) [-731.974] (-734.948) -- 0:01:39
Average standard deviation of split frequencies: 0.061030
10500 -- (-734.874) [-730.320] (-740.616) (-740.361) * (-736.811) (-733.774) [-735.335] (-736.939) -- 0:01:34
11000 -- [-730.492] (-738.801) (-736.217) (-751.786) * (-740.086) (-732.958) (-737.716) [-734.618] -- 0:01:29
11500 -- [-729.556] (-739.234) (-732.766) (-734.189) * [-734.680] (-738.712) (-742.105) (-743.202) -- 0:01:25
12000 -- (-734.561) (-734.389) [-736.493] (-740.350) * (-740.827) (-744.293) (-739.327) [-738.395] -- 0:01:22
12500 -- [-734.497] (-738.999) (-734.947) (-736.765) * [-737.980] (-736.098) (-735.087) (-744.743) -- 0:01:19
13000 -- (-734.337) [-737.454] (-732.836) (-738.407) * (-741.929) [-733.614] (-744.513) (-736.418) -- 0:01:15
13500 -- [-737.628] (-741.089) (-743.189) (-743.933) * (-732.708) [-736.485] (-743.464) (-739.445) -- 0:01:13
14000 -- (-742.391) [-731.153] (-736.670) (-736.281) * (-731.699) [-730.108] (-741.593) (-737.937) -- 0:01:10
14500 -- [-736.150] (-744.547) (-732.109) (-745.943) * (-730.622) (-736.020) (-741.359) [-739.601] -- 0:01:07
15000 -- (-736.087) (-744.921) [-736.401] (-733.265) * [-730.379] (-733.491) (-731.888) (-737.158) -- 0:01:05
Average standard deviation of split frequencies: 0.052378
15500 -- [-734.957] (-735.340) (-741.421) (-742.278) * (-733.530) [-734.577] (-743.926) (-746.987) -- 0:01:03
16000 -- [-735.333] (-735.681) (-738.591) (-743.794) * (-733.497) (-733.392) [-733.219] (-743.652) -- 0:01:01
16500 -- (-733.963) [-739.059] (-742.979) (-736.098) * (-733.587) (-736.072) (-746.276) [-739.074] -- 0:00:59
17000 -- (-743.811) (-743.686) (-740.213) [-734.030] * (-733.126) (-735.035) [-734.969] (-738.664) -- 0:00:57
17500 -- (-732.782) [-745.985] (-749.699) (-734.350) * (-731.650) [-736.064] (-733.524) (-741.699) -- 0:00:56
18000 -- (-732.246) (-734.374) (-739.084) [-735.885] * (-733.397) (-735.665) (-734.383) [-735.124] -- 0:00:54
18500 -- [-745.027] (-733.896) (-735.315) (-736.533) * [-732.865] (-736.890) (-744.255) (-743.979) -- 0:00:53
19000 -- [-744.319] (-730.966) (-741.364) (-735.882) * [-730.416] (-731.970) (-741.476) (-737.326) -- 0:00:51
19500 -- (-731.622) (-735.496) [-734.144] (-732.905) * (-734.069) [-734.911] (-734.038) (-736.478) -- 0:00:50
20000 -- (-730.061) (-730.464) [-734.755] (-734.833) * (-734.591) [-737.868] (-738.161) (-737.885) -- 0:00:49
Average standard deviation of split frequencies: 0.041818
20500 -- [-729.979] (-734.671) (-742.117) (-732.291) * (-732.308) (-732.359) [-736.492] (-732.359) -- 0:00:47
21000 -- (-733.348) [-732.112] (-735.108) (-733.642) * (-734.566) [-730.028] (-739.851) (-732.972) -- 0:01:33
21500 -- (-734.739) (-732.529) [-735.313] (-737.902) * [-732.012] (-736.914) (-735.325) (-732.655) -- 0:01:31
22000 -- (-735.248) [-731.962] (-737.676) (-733.227) * [-730.695] (-731.624) (-740.449) (-733.193) -- 0:01:28
22500 -- (-733.374) (-730.558) (-737.946) [-732.885] * (-730.924) (-734.234) [-739.208] (-732.881) -- 0:01:26
23000 -- (-729.106) [-730.455] (-737.384) (-731.434) * (-729.498) (-736.920) [-736.881] (-732.168) -- 0:01:24
23500 -- (-736.367) (-731.442) (-756.043) [-731.702] * [-729.582] (-735.247) (-736.517) (-731.146) -- 0:01:23
24000 -- (-736.558) (-731.708) (-745.886) [-733.049] * [-733.908] (-738.214) (-732.661) (-730.109) -- 0:01:21
24500 -- (-731.606) (-731.179) [-740.795] (-730.421) * (-732.876) (-731.589) [-734.451] (-734.191) -- 0:01:19
25000 -- (-730.776) (-732.257) (-755.005) [-732.705] * (-731.256) (-734.493) (-737.259) [-732.473] -- 0:01:18
Average standard deviation of split frequencies: 0.023900
25500 -- [-733.523] (-731.389) (-734.332) (-732.399) * [-730.154] (-738.318) (-742.583) (-733.719) -- 0:01:16
26000 -- (-733.313) (-730.260) [-737.332] (-731.576) * (-730.362) [-734.167] (-737.824) (-732.809) -- 0:01:14
26500 -- (-732.066) (-731.089) [-731.364] (-733.599) * (-730.096) [-731.791] (-741.192) (-729.754) -- 0:01:13
27000 -- [-730.503] (-731.313) (-737.394) (-736.843) * (-735.188) [-734.426] (-737.445) (-732.337) -- 0:01:12
27500 -- (-729.726) (-731.579) (-729.818) [-735.861] * (-728.524) (-736.756) [-734.535] (-731.016) -- 0:01:10
28000 -- [-729.110] (-734.832) (-738.460) (-737.023) * (-731.209) (-734.470) [-734.515] (-734.018) -- 0:01:09
28500 -- (-732.946) (-741.068) [-737.934] (-736.433) * [-729.665] (-736.517) (-743.501) (-735.011) -- 0:01:08
29000 -- [-731.945] (-735.804) (-734.575) (-735.390) * (-730.791) (-740.620) [-738.533] (-734.329) -- 0:01:06
29500 -- (-732.335) (-735.604) [-733.404] (-736.912) * (-732.751) [-731.213] (-747.463) (-731.285) -- 0:01:05
30000 -- (-730.059) [-731.092] (-731.872) (-735.134) * [-730.771] (-735.614) (-731.676) (-733.380) -- 0:01:04
Average standard deviation of split frequencies: 0.025620
30500 -- (-729.604) [-737.222] (-732.180) (-730.761) * (-733.706) (-747.145) [-738.214] (-730.266) -- 0:01:03
31000 -- (-730.011) [-731.522] (-732.892) (-732.968) * (-734.345) (-735.925) (-735.862) [-731.463] -- 0:01:02
31500 -- (-733.860) [-731.178] (-731.867) (-731.044) * (-733.183) (-736.620) [-735.516] (-732.321) -- 0:01:01
32000 -- (-730.555) (-735.293) (-732.238) [-733.149] * (-731.025) (-735.421) [-745.118] (-729.539) -- 0:01:00
32500 -- (-731.747) (-732.533) [-732.491] (-735.764) * (-732.853) (-734.270) (-736.032) [-730.589] -- 0:00:59
33000 -- [-731.621] (-729.659) (-732.338) (-731.530) * (-735.795) (-744.314) [-740.514] (-730.163) -- 0:00:58
33500 -- (-733.419) (-732.948) (-733.683) [-731.459] * (-731.852) (-736.612) [-735.172] (-732.575) -- 0:00:57
34000 -- (-730.187) (-731.266) [-734.794] (-734.354) * (-732.292) [-730.362] (-739.458) (-735.224) -- 0:00:56
34500 -- (-729.478) (-731.404) (-736.533) [-733.418] * (-733.134) [-733.116] (-735.371) (-736.431) -- 0:01:23
35000 -- (-731.676) (-730.451) (-732.888) [-733.592] * (-731.011) [-732.231] (-738.169) (-732.422) -- 0:01:22
Average standard deviation of split frequencies: 0.026189
35500 -- (-730.796) (-731.798) [-733.377] (-732.652) * (-730.198) (-747.286) (-742.082) [-730.193] -- 0:01:21
36000 -- (-730.939) [-732.041] (-731.744) (-730.691) * [-729.399] (-740.683) (-734.539) (-732.226) -- 0:01:20
36500 -- (-731.068) [-731.226] (-737.336) (-733.518) * (-731.946) (-738.910) [-742.808] (-730.393) -- 0:01:19
37000 -- (-737.104) [-733.419] (-732.236) (-735.146) * (-732.183) (-737.285) [-740.841] (-734.291) -- 0:01:18
37500 -- (-739.299) (-733.555) [-734.201] (-732.836) * (-730.073) [-734.324] (-740.049) (-731.736) -- 0:01:17
38000 -- (-732.904) (-732.255) (-730.568) [-731.630] * (-731.748) [-731.372] (-737.488) (-734.298) -- 0:01:15
38500 -- (-731.775) [-731.512] (-731.000) (-730.568) * [-731.775] (-739.331) (-737.149) (-730.640) -- 0:01:14
39000 -- (-733.689) (-731.228) [-733.063] (-734.942) * (-730.004) [-741.345] (-735.051) (-735.809) -- 0:01:13
39500 -- [-731.329] (-735.930) (-732.626) (-734.219) * (-730.011) (-735.620) [-735.506] (-732.558) -- 0:01:12
40000 -- [-731.875] (-734.746) (-737.630) (-734.279) * (-729.733) [-730.544] (-739.909) (-729.961) -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-733.090) (-733.794) (-732.709) [-730.407] * (-729.726) [-738.666] (-736.052) (-729.909) -- 0:01:11
41000 -- (-729.898) (-736.474) (-735.116) [-733.558] * (-729.505) (-738.292) (-741.205) [-733.809] -- 0:01:10
41500 -- (-731.968) [-733.144] (-730.046) (-733.209) * (-732.988) (-741.508) [-735.914] (-729.519) -- 0:01:09
42000 -- (-731.131) (-732.816) (-734.586) [-732.869] * (-734.438) [-737.873] (-739.105) (-731.281) -- 0:01:08
42500 -- (-736.895) (-734.141) [-731.215] (-733.657) * (-740.669) (-738.568) [-738.328] (-731.896) -- 0:01:07
43000 -- (-735.533) [-731.319] (-732.285) (-730.388) * (-735.923) (-741.900) (-732.171) [-736.753] -- 0:01:06
43500 -- (-734.161) (-731.820) [-735.706] (-732.498) * (-737.581) [-732.973] (-735.838) (-732.908) -- 0:01:05
44000 -- (-733.820) (-732.140) [-736.872] (-732.017) * (-734.704) (-737.545) (-735.539) [-730.355] -- 0:01:05
44500 -- (-730.728) (-733.307) (-730.397) [-730.971] * (-731.268) (-736.151) (-734.080) [-733.376] -- 0:01:04
45000 -- [-730.459] (-738.097) (-730.138) (-730.214) * (-729.609) (-736.520) (-742.696) [-730.257] -- 0:01:03
Average standard deviation of split frequencies: 0.030231
45500 -- (-733.144) (-734.610) [-733.488] (-731.847) * (-732.986) (-741.918) (-737.984) [-731.141] -- 0:01:02
46000 -- [-734.727] (-731.931) (-731.962) (-730.977) * (-733.456) [-734.042] (-739.102) (-733.653) -- 0:01:02
46500 -- (-733.773) (-732.302) [-730.990] (-733.137) * (-734.248) (-742.037) (-748.785) [-732.238] -- 0:01:01
47000 -- (-732.626) (-736.415) [-734.163] (-732.919) * (-730.563) (-734.446) [-740.860] (-736.653) -- 0:01:00
47500 -- [-733.559] (-733.333) (-735.240) (-733.777) * (-729.853) [-740.891] (-739.721) (-732.376) -- 0:01:20
48000 -- (-731.950) (-732.773) [-730.969] (-731.818) * (-729.850) (-742.699) (-735.750) [-732.800] -- 0:01:19
48500 -- (-731.572) (-730.818) (-732.881) [-733.724] * [-733.581] (-734.641) (-737.630) (-734.427) -- 0:01:18
49000 -- [-734.543] (-732.276) (-731.625) (-736.373) * (-734.500) [-737.214] (-738.564) (-733.683) -- 0:01:17
49500 -- [-735.075] (-731.571) (-729.283) (-734.909) * (-732.108) [-737.686] (-736.116) (-731.562) -- 0:01:16
50000 -- [-731.809] (-731.138) (-729.535) (-730.735) * (-732.244) (-737.725) [-736.614] (-736.795) -- 0:01:16
Average standard deviation of split frequencies: 0.031830
50500 -- [-737.857] (-731.501) (-729.088) (-734.045) * (-732.832) (-739.442) [-731.684] (-733.282) -- 0:01:15
51000 -- (-732.716) (-732.147) [-732.585] (-736.283) * (-734.743) [-738.130] (-730.391) (-731.830) -- 0:01:14
51500 -- (-736.096) [-732.828] (-735.364) (-733.518) * (-733.150) (-738.138) (-735.417) [-731.671] -- 0:01:13
52000 -- (-734.173) (-734.600) [-731.706] (-733.936) * [-731.623] (-740.969) (-737.869) (-734.284) -- 0:01:12
52500 -- (-732.500) (-734.013) [-735.154] (-729.970) * [-735.263] (-739.309) (-740.947) (-734.432) -- 0:01:12
53000 -- [-732.955] (-734.009) (-733.197) (-732.622) * (-732.624) [-741.077] (-732.227) (-731.855) -- 0:01:11
53500 -- (-736.093) (-732.534) (-730.327) [-732.927] * (-729.479) [-744.657] (-734.435) (-733.813) -- 0:01:10
54000 -- (-732.923) (-732.964) (-728.953) [-730.997] * (-730.557) (-739.631) [-735.258] (-733.860) -- 0:01:10
54500 -- (-732.479) [-736.699] (-730.557) (-732.091) * (-731.039) (-745.158) (-740.733) [-731.448] -- 0:01:09
55000 -- (-731.799) (-734.232) [-733.010] (-730.643) * (-731.534) (-742.454) [-733.948] (-733.045) -- 0:01:08
Average standard deviation of split frequencies: 0.033229
55500 -- (-731.955) (-735.463) [-730.910] (-734.016) * (-734.011) (-741.011) [-738.575] (-733.887) -- 0:01:08
56000 -- (-733.848) (-732.417) (-732.708) [-730.806] * (-735.206) (-742.095) (-734.221) [-734.190] -- 0:01:07
56500 -- (-730.872) (-733.206) (-732.828) [-732.085] * (-736.013) (-738.625) [-734.334] (-731.949) -- 0:01:06
57000 -- (-731.766) (-731.976) [-734.784] (-731.902) * (-731.784) (-734.356) (-738.433) [-731.731] -- 0:01:06
57500 -- (-732.794) (-735.385) (-731.377) [-732.938] * (-733.366) [-734.338] (-742.438) (-730.958) -- 0:01:05
58000 -- (-732.343) [-736.715] (-732.344) (-732.692) * (-733.502) (-733.609) [-738.605] (-733.367) -- 0:01:04
58500 -- (-732.137) (-733.660) (-732.193) [-733.582] * (-733.002) [-732.916] (-738.395) (-737.574) -- 0:01:04
59000 -- [-731.758] (-739.125) (-734.219) (-730.842) * (-736.265) (-735.752) (-732.510) [-738.089] -- 0:01:03
59500 -- (-731.723) (-729.488) (-733.658) [-731.347] * [-732.666] (-730.683) (-734.595) (-731.810) -- 0:01:03
60000 -- (-734.876) [-730.495] (-731.524) (-733.369) * (-738.025) (-731.902) [-736.515] (-731.950) -- 0:01:02
Average standard deviation of split frequencies: 0.029037
60500 -- (-737.770) (-731.358) [-731.381] (-730.336) * [-738.898] (-735.714) (-739.955) (-730.379) -- 0:01:17
61000 -- [-734.196] (-731.875) (-732.285) (-735.806) * (-730.844) [-733.690] (-747.601) (-729.919) -- 0:01:16
61500 -- (-735.759) [-734.002] (-730.377) (-730.786) * (-733.233) (-736.263) (-730.743) [-730.514] -- 0:01:16
62000 -- [-731.315] (-731.208) (-732.720) (-731.679) * [-731.902] (-737.735) (-731.410) (-730.155) -- 0:01:15
62500 -- (-735.413) (-737.388) [-731.056] (-732.021) * (-735.501) (-731.089) (-730.225) [-733.497] -- 0:01:15
63000 -- (-734.259) (-735.528) [-734.496] (-732.665) * [-734.049] (-734.120) (-733.414) (-733.351) -- 0:01:14
63500 -- (-731.216) (-735.601) [-734.283] (-731.657) * (-735.806) [-732.720] (-731.901) (-734.978) -- 0:01:13
64000 -- (-733.841) (-735.436) [-736.360] (-733.309) * (-733.674) (-732.633) [-731.621] (-737.804) -- 0:01:13
64500 -- (-733.287) (-732.893) [-735.357] (-732.499) * (-733.392) (-732.806) (-731.727) [-730.986] -- 0:01:12
65000 -- (-734.586) [-736.106] (-735.372) (-735.872) * [-732.368] (-735.227) (-731.706) (-730.775) -- 0:01:11
Average standard deviation of split frequencies: 0.025713
65500 -- (-731.257) (-736.166) [-732.081] (-734.617) * (-731.742) (-735.296) (-731.176) [-734.848] -- 0:01:11
66000 -- [-732.927] (-736.499) (-732.618) (-735.561) * (-730.403) (-735.661) [-729.723] (-732.416) -- 0:01:10
66500 -- [-733.723] (-731.963) (-736.150) (-731.900) * (-734.239) (-732.432) (-729.577) [-733.829] -- 0:01:10
67000 -- [-729.865] (-732.603) (-735.974) (-735.843) * (-732.805) (-731.707) [-732.160] (-733.494) -- 0:01:09
67500 -- [-730.136] (-730.339) (-733.312) (-735.109) * (-731.892) (-732.720) (-732.599) [-731.473] -- 0:01:09
68000 -- (-733.165) [-731.385] (-734.577) (-735.748) * [-734.937] (-738.553) (-732.562) (-732.919) -- 0:01:08
68500 -- (-731.415) [-733.066] (-734.176) (-737.077) * (-732.035) (-733.294) (-733.754) [-737.524] -- 0:01:07
69000 -- (-731.765) [-733.410] (-731.332) (-732.506) * (-736.477) (-732.517) (-730.618) [-730.875] -- 0:01:07
69500 -- (-730.911) (-733.040) [-733.048] (-730.075) * (-736.254) (-733.759) (-736.675) [-728.301] -- 0:01:06
70000 -- (-736.829) (-733.808) [-734.642] (-733.033) * (-731.915) [-732.513] (-731.901) (-729.226) -- 0:01:06
Average standard deviation of split frequencies: 0.026683
70500 -- (-733.276) (-735.825) [-732.543] (-729.314) * (-737.375) (-734.860) [-734.244] (-730.493) -- 0:01:05
71000 -- (-732.423) (-731.762) [-732.485] (-730.846) * [-732.321] (-733.731) (-732.127) (-733.227) -- 0:01:05
71500 -- [-731.117] (-732.111) (-732.813) (-732.763) * (-735.291) (-732.972) (-733.511) [-732.710] -- 0:01:04
72000 -- [-729.837] (-734.884) (-730.903) (-732.828) * (-734.522) [-733.978] (-731.541) (-730.451) -- 0:01:04
72500 -- (-731.698) (-736.299) [-732.464] (-731.762) * [-731.729] (-731.489) (-732.486) (-730.989) -- 0:01:03
73000 -- (-734.976) (-731.610) [-730.920] (-732.843) * (-732.371) (-732.006) [-731.460] (-735.172) -- 0:01:03
73500 -- [-732.275] (-729.142) (-731.645) (-731.057) * (-732.835) (-733.496) (-736.126) [-729.830] -- 0:01:03
74000 -- (-731.801) [-730.500] (-732.557) (-731.167) * (-729.608) (-732.789) (-733.186) [-732.078] -- 0:01:15
74500 -- [-732.059] (-731.393) (-730.407) (-734.912) * (-736.051) (-733.544) (-732.291) [-731.688] -- 0:01:14
75000 -- (-733.935) [-733.587] (-731.153) (-732.405) * (-730.641) [-731.578] (-735.166) (-730.643) -- 0:01:14
Average standard deviation of split frequencies: 0.022020
75500 -- (-730.116) (-734.258) (-731.923) [-731.196] * [-732.357] (-733.845) (-729.569) (-733.109) -- 0:01:13
76000 -- (-731.737) (-732.189) (-730.837) [-734.713] * (-733.177) [-736.375] (-731.067) (-734.550) -- 0:01:12
76500 -- [-729.214] (-731.242) (-734.233) (-731.434) * (-735.960) (-732.978) [-733.341] (-734.001) -- 0:01:12
77000 -- (-735.980) [-731.636] (-737.516) (-733.259) * (-733.513) [-733.108] (-732.213) (-734.002) -- 0:01:11
77500 -- (-731.935) (-736.841) (-732.461) [-735.018] * [-731.901] (-735.708) (-729.930) (-731.371) -- 0:01:11
78000 -- [-736.716] (-732.575) (-732.857) (-731.419) * (-733.099) (-735.509) (-731.861) [-731.347] -- 0:01:10
78500 -- (-733.798) (-734.973) (-735.011) [-731.029] * (-733.658) (-736.258) [-729.179] (-728.855) -- 0:01:10
79000 -- (-734.132) (-738.664) (-735.044) [-730.145] * [-735.608] (-733.106) (-729.507) (-729.543) -- 0:01:09
79500 -- (-732.051) (-735.367) (-734.926) [-733.283] * (-735.044) (-731.672) [-730.565] (-733.399) -- 0:01:09
80000 -- (-731.508) [-736.592] (-731.508) (-733.025) * [-736.047] (-732.036) (-731.811) (-731.104) -- 0:01:09
Average standard deviation of split frequencies: 0.019992
80500 -- [-732.362] (-737.856) (-730.135) (-734.800) * (-735.270) (-739.596) (-739.995) [-732.708] -- 0:01:08
81000 -- [-729.893] (-738.782) (-732.527) (-732.957) * [-733.662] (-731.884) (-732.407) (-732.784) -- 0:01:08
81500 -- [-729.623] (-732.557) (-735.685) (-733.101) * [-732.371] (-733.391) (-736.259) (-733.840) -- 0:01:07
82000 -- (-731.874) [-732.074] (-735.430) (-731.916) * [-733.699] (-732.668) (-730.503) (-734.985) -- 0:01:07
82500 -- (-734.931) [-739.046] (-735.768) (-729.255) * (-733.218) (-732.866) (-730.686) [-731.881] -- 0:01:06
83000 -- [-732.018] (-733.286) (-732.262) (-734.455) * (-733.171) (-736.358) [-730.393] (-731.181) -- 0:01:06
83500 -- (-729.876) (-732.755) (-732.754) [-733.119] * (-735.055) (-734.080) (-734.563) [-732.070] -- 0:01:05
84000 -- (-730.198) (-734.703) [-733.557] (-730.382) * [-732.820] (-733.140) (-738.097) (-730.806) -- 0:01:05
84500 -- [-732.856] (-736.656) (-733.953) (-731.765) * (-733.841) (-732.649) (-740.716) [-729.709] -- 0:01:05
85000 -- (-729.936) (-735.952) [-735.499] (-731.175) * (-735.336) [-732.305] (-731.284) (-729.096) -- 0:01:04
Average standard deviation of split frequencies: 0.018089
85500 -- [-729.755] (-737.399) (-729.995) (-733.912) * (-734.648) [-730.702] (-737.481) (-731.108) -- 0:01:04
86000 -- [-730.235] (-729.828) (-735.566) (-731.445) * [-733.223] (-731.206) (-733.248) (-729.244) -- 0:01:03
86500 -- (-729.855) (-732.515) (-730.934) [-730.394] * (-733.801) (-731.125) (-737.340) [-730.939] -- 0:01:03
87000 -- (-731.566) [-730.787] (-730.998) (-731.713) * (-734.055) [-732.495] (-735.232) (-730.960) -- 0:01:02
87500 -- [-730.974] (-734.221) (-735.784) (-731.488) * (-737.297) (-733.244) [-733.437] (-731.348) -- 0:01:13
88000 -- [-729.522] (-734.486) (-730.371) (-733.005) * (-731.171) [-732.618] (-732.903) (-730.471) -- 0:01:12
88500 -- (-734.768) [-730.061] (-729.865) (-732.321) * (-732.802) [-734.573] (-734.480) (-733.740) -- 0:01:12
89000 -- (-730.017) (-732.342) [-733.008] (-732.437) * [-733.462] (-729.824) (-737.778) (-730.009) -- 0:01:11
89500 -- (-733.113) [-731.499] (-735.163) (-729.525) * (-732.045) [-733.069] (-736.302) (-737.446) -- 0:01:11
90000 -- (-731.767) (-731.365) [-730.077] (-730.748) * (-734.131) [-731.596] (-738.372) (-731.094) -- 0:01:10
Average standard deviation of split frequencies: 0.018334
90500 -- [-730.909] (-731.033) (-736.811) (-733.484) * [-734.296] (-730.966) (-734.097) (-731.511) -- 0:01:10
91000 -- (-730.332) [-731.563] (-740.538) (-731.030) * (-733.969) [-734.363] (-737.505) (-730.356) -- 0:01:09
91500 -- [-733.261] (-729.905) (-732.519) (-730.470) * (-733.009) (-734.167) (-731.971) [-733.720] -- 0:01:09
92000 -- [-733.932] (-733.190) (-731.789) (-733.614) * (-735.268) (-731.491) [-732.217] (-730.291) -- 0:01:09
92500 -- (-736.880) (-738.160) [-735.072] (-731.057) * (-733.295) (-733.812) [-729.867] (-730.839) -- 0:01:08
93000 -- (-736.818) [-730.978] (-731.113) (-730.510) * [-730.259] (-732.234) (-733.294) (-737.867) -- 0:01:08
93500 -- (-737.027) (-733.130) [-732.671] (-730.364) * (-732.441) (-732.535) [-737.098] (-738.443) -- 0:01:07
94000 -- (-734.521) (-730.009) [-732.298] (-734.404) * (-732.886) (-734.248) [-733.340] (-733.777) -- 0:01:07
94500 -- (-741.493) [-731.199] (-732.738) (-731.500) * (-732.404) (-732.519) (-730.587) [-731.037] -- 0:01:07
95000 -- (-733.146) [-732.719] (-730.792) (-739.816) * [-732.501] (-735.876) (-732.458) (-730.097) -- 0:01:06
Average standard deviation of split frequencies: 0.018350
95500 -- (-732.950) (-731.357) [-731.130] (-736.487) * (-731.177) (-736.171) [-732.815] (-733.231) -- 0:01:06
96000 -- (-733.286) (-733.432) [-733.453] (-731.367) * [-733.107] (-730.416) (-733.163) (-731.160) -- 0:01:05
96500 -- [-732.340] (-734.823) (-734.693) (-730.902) * (-733.418) (-735.440) (-733.681) [-730.535] -- 0:01:05
97000 -- (-733.324) (-734.837) (-735.904) [-730.694] * (-733.636) (-736.896) [-734.496] (-730.902) -- 0:01:05
97500 -- (-734.679) [-730.397] (-732.182) (-733.451) * (-732.547) (-735.159) [-733.087] (-734.258) -- 0:01:04
98000 -- (-733.000) [-733.740] (-732.133) (-735.171) * (-736.430) (-733.642) [-730.874] (-732.033) -- 0:01:04
98500 -- [-731.758] (-735.134) (-732.007) (-736.915) * (-732.880) (-731.624) (-731.558) [-730.486] -- 0:01:04
99000 -- [-733.026] (-731.471) (-733.564) (-732.069) * (-729.989) (-732.201) [-732.070] (-731.957) -- 0:01:03
99500 -- (-736.535) (-730.572) (-731.707) [-732.480] * (-731.993) (-733.535) [-731.536] (-730.633) -- 0:01:03
100000 -- (-735.452) [-735.698] (-732.872) (-734.312) * (-731.509) (-733.456) [-731.690] (-730.806) -- 0:01:02
Average standard deviation of split frequencies: 0.019007
100500 -- (-738.417) (-730.646) [-729.973] (-731.674) * (-735.526) (-730.044) (-732.664) [-732.624] -- 0:01:11
101000 -- (-733.784) (-731.738) [-730.528] (-735.762) * [-731.847] (-735.435) (-734.548) (-729.508) -- 0:01:11
101500 -- (-733.158) (-731.929) [-731.120] (-729.345) * (-730.511) (-734.598) (-732.860) [-731.016] -- 0:01:10
102000 -- (-730.794) (-735.343) [-732.687] (-737.198) * (-729.820) (-734.713) (-733.579) [-730.562] -- 0:01:10
102500 -- (-732.867) (-732.747) [-736.270] (-733.350) * (-731.428) (-734.763) (-734.494) [-732.739] -- 0:01:10
103000 -- (-733.023) [-734.429] (-731.002) (-735.256) * (-731.173) [-734.640] (-729.866) (-732.333) -- 0:01:09
103500 -- (-735.857) (-732.667) (-733.888) [-732.454] * [-731.614] (-733.105) (-731.754) (-730.707) -- 0:01:09
104000 -- (-733.365) [-732.448] (-733.085) (-734.399) * (-729.744) (-731.233) (-732.556) [-731.012] -- 0:01:08
104500 -- (-731.433) [-734.653] (-731.806) (-736.005) * [-729.908] (-732.364) (-730.188) (-729.506) -- 0:01:08
105000 -- (-729.580) (-732.134) [-730.880] (-734.932) * (-732.669) (-733.250) [-732.634] (-733.723) -- 0:01:08
Average standard deviation of split frequencies: 0.015448
105500 -- (-731.815) (-731.738) [-729.583] (-732.489) * (-734.377) (-733.015) (-733.846) [-734.759] -- 0:01:07
106000 -- (-731.454) (-733.731) [-732.813] (-732.332) * (-735.298) (-732.912) (-731.470) [-730.015] -- 0:01:07
106500 -- (-732.831) (-732.323) [-730.753] (-735.440) * (-734.194) (-735.227) [-733.295] (-730.868) -- 0:01:07
107000 -- [-732.741] (-732.514) (-731.941) (-737.908) * (-732.759) [-734.910] (-732.219) (-735.816) -- 0:01:06
107500 -- (-735.578) (-734.895) [-730.777] (-734.518) * (-739.242) [-732.706] (-731.709) (-732.315) -- 0:01:06
108000 -- (-731.490) [-732.976] (-735.906) (-734.539) * (-731.973) (-732.272) [-730.242] (-733.472) -- 0:01:06
108500 -- (-731.732) (-735.288) (-732.269) [-731.151] * (-732.347) (-734.776) [-735.562] (-733.601) -- 0:01:05
109000 -- (-733.570) [-730.877] (-731.116) (-732.579) * (-732.728) [-734.366] (-736.562) (-736.180) -- 0:01:05
109500 -- [-731.912] (-732.255) (-732.390) (-732.950) * (-732.211) (-733.492) [-737.132] (-737.625) -- 0:01:05
110000 -- [-731.196] (-734.052) (-732.059) (-735.050) * (-732.569) [-731.672] (-730.630) (-747.047) -- 0:01:04
Average standard deviation of split frequencies: 0.014199
110500 -- (-731.114) [-731.502] (-730.269) (-731.692) * (-736.289) (-734.183) (-732.739) [-735.233] -- 0:01:04
111000 -- (-731.760) (-732.452) [-730.984] (-731.401) * (-731.348) [-731.472] (-733.714) (-735.416) -- 0:01:04
111500 -- (-737.373) (-731.013) [-735.288] (-733.099) * (-733.892) (-737.162) [-733.070] (-735.049) -- 0:01:03
112000 -- (-733.422) (-732.198) [-730.748] (-731.379) * (-732.435) [-734.145] (-731.455) (-737.076) -- 0:01:03
112500 -- (-732.595) (-731.569) (-732.824) [-736.817] * (-732.664) (-731.215) (-734.902) [-732.651] -- 0:01:03
113000 -- (-732.848) (-734.123) (-730.569) [-733.800] * (-735.771) (-731.329) (-733.990) [-731.141] -- 0:01:02
113500 -- (-730.902) (-733.323) [-730.989] (-730.294) * [-732.129] (-730.431) (-733.394) (-734.088) -- 0:01:02
114000 -- (-730.550) (-734.790) [-733.548] (-732.514) * (-734.891) (-729.512) [-729.529] (-730.829) -- 0:01:09
114500 -- (-730.650) [-729.904] (-732.100) (-732.164) * [-733.763] (-731.864) (-730.088) (-733.053) -- 0:01:09
115000 -- (-734.663) (-731.333) [-731.037] (-736.442) * (-731.079) (-731.724) (-731.181) [-733.963] -- 0:01:09
Average standard deviation of split frequencies: 0.013320
115500 -- [-732.558] (-736.810) (-737.445) (-739.454) * (-732.566) (-737.183) [-730.416] (-735.104) -- 0:01:08
116000 -- [-734.944] (-730.784) (-731.336) (-735.676) * (-731.584) (-738.346) [-732.288] (-734.322) -- 0:01:08
116500 -- (-733.839) [-730.677] (-734.787) (-733.317) * (-732.291) (-735.205) (-733.481) [-731.619] -- 0:01:08
117000 -- [-730.677] (-731.278) (-731.250) (-733.462) * [-731.688] (-733.615) (-731.633) (-730.107) -- 0:01:07
117500 -- (-730.008) (-730.504) [-729.396] (-736.145) * (-731.957) (-734.832) [-732.963] (-734.236) -- 0:01:07
118000 -- [-731.216] (-730.566) (-731.017) (-731.427) * (-732.551) [-734.763] (-732.833) (-736.519) -- 0:01:07
118500 -- (-731.095) [-730.093] (-735.155) (-731.304) * [-731.794] (-731.635) (-733.623) (-734.972) -- 0:01:06
119000 -- (-734.109) [-729.736] (-731.478) (-734.800) * [-733.017] (-735.250) (-731.585) (-739.586) -- 0:01:06
119500 -- (-733.527) (-732.021) [-731.574] (-737.109) * (-735.549) (-733.098) (-733.081) [-733.202] -- 0:01:06
120000 -- (-730.668) (-730.710) (-732.133) [-731.620] * (-736.623) (-729.245) [-732.729] (-733.589) -- 0:01:06
Average standard deviation of split frequencies: 0.012180
120500 -- (-730.441) (-729.966) (-729.704) [-729.554] * (-733.261) [-729.936] (-733.384) (-732.150) -- 0:01:05
121000 -- (-730.713) (-732.026) (-730.818) [-732.405] * (-734.875) [-731.028] (-731.489) (-733.315) -- 0:01:05
121500 -- (-734.878) [-733.060] (-729.919) (-734.063) * (-734.682) (-735.399) (-731.884) [-730.476] -- 0:01:05
122000 -- (-730.836) (-731.723) [-732.160] (-731.307) * (-734.787) (-731.612) (-735.664) [-732.458] -- 0:01:04
122500 -- (-733.552) [-733.109] (-733.470) (-730.634) * [-733.547] (-730.806) (-730.877) (-733.458) -- 0:01:04
123000 -- (-730.438) (-733.246) (-730.144) [-731.916] * (-736.370) [-729.799] (-732.728) (-733.654) -- 0:01:04
123500 -- [-733.499] (-736.904) (-731.885) (-732.630) * [-732.815] (-730.938) (-732.687) (-732.107) -- 0:01:03
124000 -- (-731.859) (-736.530) [-730.361] (-736.800) * (-731.827) [-731.926] (-737.114) (-734.549) -- 0:01:03
124500 -- (-738.741) [-734.308] (-730.216) (-730.194) * [-731.529] (-732.775) (-733.652) (-731.640) -- 0:01:03
125000 -- (-730.782) (-731.523) (-730.395) [-730.009] * (-731.309) (-737.126) (-733.665) [-733.692] -- 0:01:03
Average standard deviation of split frequencies: 0.012293
125500 -- [-732.277] (-733.767) (-734.394) (-733.653) * (-731.219) (-732.398) [-731.501] (-733.429) -- 0:01:02
126000 -- [-731.677] (-733.715) (-741.091) (-729.416) * (-735.357) [-732.407] (-731.484) (-731.738) -- 0:01:02
126500 -- [-732.956] (-733.807) (-728.852) (-734.561) * (-735.487) [-730.641] (-732.022) (-731.218) -- 0:01:02
127000 -- (-730.808) (-732.749) [-730.346] (-729.947) * (-733.692) (-734.096) [-731.481] (-730.933) -- 0:01:01
127500 -- (-734.138) [-733.537] (-734.366) (-733.589) * (-733.921) (-735.067) [-729.248] (-731.436) -- 0:01:08
128000 -- (-737.603) (-729.314) (-729.524) [-733.697] * (-732.379) [-734.640] (-730.370) (-731.959) -- 0:01:08
128500 -- (-737.785) (-730.673) [-731.076] (-734.951) * (-732.730) [-730.679] (-731.658) (-732.846) -- 0:01:07
129000 -- [-735.514] (-731.342) (-732.786) (-737.849) * (-738.853) [-732.344] (-735.277) (-731.047) -- 0:01:07
129500 -- (-735.827) (-729.586) [-732.482] (-736.957) * [-732.062] (-733.212) (-732.100) (-736.064) -- 0:01:07
130000 -- [-732.609] (-731.316) (-735.626) (-734.173) * (-731.932) (-732.374) (-736.441) [-731.780] -- 0:01:06
Average standard deviation of split frequencies: 0.010633
130500 -- [-732.351] (-730.811) (-731.307) (-732.935) * (-730.999) [-732.334] (-735.872) (-730.206) -- 0:01:06
131000 -- [-734.992] (-732.043) (-733.323) (-734.605) * (-732.358) (-733.258) (-733.588) [-733.108] -- 0:01:06
131500 -- (-731.134) [-731.351] (-730.073) (-732.118) * (-732.723) [-732.490] (-737.187) (-735.388) -- 0:01:06
132000 -- (-734.659) [-734.518] (-732.554) (-730.543) * (-733.750) [-731.139] (-735.877) (-734.124) -- 0:01:05
132500 -- [-732.395] (-732.172) (-733.472) (-734.806) * (-733.312) (-738.083) [-735.483] (-728.766) -- 0:01:05
133000 -- (-732.578) (-735.505) (-736.515) [-732.936] * (-730.461) (-733.327) [-735.582] (-729.287) -- 0:01:05
133500 -- (-733.004) (-732.802) [-733.982] (-732.494) * [-733.013] (-733.899) (-734.112) (-738.449) -- 0:01:04
134000 -- [-733.646] (-731.763) (-733.628) (-732.546) * (-732.332) (-735.510) (-735.803) [-731.916] -- 0:01:04
134500 -- (-730.475) (-735.921) [-732.273] (-733.597) * (-731.906) (-731.584) (-735.460) [-731.565] -- 0:01:04
135000 -- (-731.307) (-730.759) (-732.083) [-735.923] * (-731.936) (-732.670) [-729.612] (-731.638) -- 0:01:04
Average standard deviation of split frequencies: 0.010919
135500 -- (-730.902) [-729.805] (-733.038) (-730.097) * (-731.401) (-732.819) [-732.289] (-729.713) -- 0:01:03
136000 -- (-735.753) [-734.040] (-734.029) (-730.178) * [-731.155] (-731.597) (-732.734) (-730.050) -- 0:01:03
136500 -- (-734.886) (-731.491) (-731.795) [-732.487] * (-734.671) (-732.866) (-731.746) [-729.654] -- 0:01:03
137000 -- (-736.044) [-732.771] (-736.181) (-736.385) * (-730.001) (-732.450) (-732.682) [-730.300] -- 0:01:02
137500 -- (-730.629) [-731.716] (-732.480) (-732.341) * (-732.502) (-729.778) [-731.717] (-731.396) -- 0:01:02
138000 -- (-733.480) [-730.425] (-735.260) (-730.900) * (-731.803) [-734.174] (-731.436) (-731.052) -- 0:01:02
138500 -- (-733.308) [-731.652] (-731.577) (-732.826) * (-729.597) (-730.948) (-731.458) [-730.721] -- 0:01:02
139000 -- (-730.409) [-731.855] (-732.641) (-731.576) * [-730.765] (-729.280) (-732.126) (-732.564) -- 0:01:01
139500 -- (-734.137) (-732.103) [-733.151] (-732.492) * (-731.759) (-732.584) [-730.745] (-734.968) -- 0:01:01
140000 -- (-728.855) [-732.519] (-731.305) (-729.776) * (-730.502) (-733.013) (-732.273) [-730.565] -- 0:01:01
Average standard deviation of split frequencies: 0.011357
140500 -- (-731.634) (-732.736) [-729.909] (-730.874) * [-734.929] (-731.290) (-731.471) (-733.164) -- 0:01:07
141000 -- [-735.620] (-731.530) (-733.225) (-742.131) * (-736.677) (-733.329) [-730.556] (-730.348) -- 0:01:07
141500 -- (-730.922) (-731.242) [-730.580] (-735.155) * (-734.149) [-730.948] (-734.158) (-730.307) -- 0:01:06
142000 -- (-731.699) (-730.757) (-737.031) [-730.063] * (-738.745) [-731.913] (-733.380) (-736.724) -- 0:01:06
142500 -- (-732.020) [-730.889] (-730.668) (-731.033) * [-734.375] (-731.996) (-731.352) (-730.931) -- 0:01:06
143000 -- [-732.109] (-735.053) (-733.166) (-731.458) * (-734.287) [-731.541] (-731.696) (-731.623) -- 0:01:05
143500 -- (-730.379) (-731.311) [-733.868] (-731.034) * (-730.472) [-732.334] (-732.772) (-736.693) -- 0:01:05
144000 -- [-729.670] (-730.827) (-740.416) (-731.697) * (-730.385) (-733.394) [-731.711] (-732.569) -- 0:01:05
144500 -- (-737.993) (-734.076) (-730.825) [-729.969] * (-730.791) (-740.113) [-730.554] (-731.190) -- 0:01:05
145000 -- (-732.352) (-730.321) (-735.363) [-730.818] * (-729.870) (-730.189) [-734.841] (-734.300) -- 0:01:04
Average standard deviation of split frequencies: 0.010942
145500 -- (-738.520) (-734.512) (-730.535) [-731.552] * [-731.120] (-731.544) (-732.434) (-731.167) -- 0:01:04
146000 -- (-731.379) [-732.802] (-731.063) (-731.930) * (-735.100) (-731.717) [-729.780] (-735.995) -- 0:01:04
146500 -- (-731.391) [-731.170] (-731.679) (-733.002) * (-734.698) (-731.063) [-731.744] (-735.426) -- 0:01:04
147000 -- [-730.686] (-733.153) (-732.254) (-732.043) * (-736.060) [-731.035] (-732.999) (-730.835) -- 0:01:03
147500 -- (-732.825) (-730.918) [-731.562] (-729.782) * [-734.825] (-730.703) (-729.985) (-733.319) -- 0:01:03
148000 -- [-729.845] (-729.657) (-730.548) (-731.518) * (-732.652) [-731.393] (-733.186) (-732.490) -- 0:01:03
148500 -- (-732.999) (-730.452) (-729.880) [-729.019] * [-730.501] (-730.025) (-730.475) (-730.874) -- 0:01:03
149000 -- (-731.130) (-731.797) [-735.240] (-730.602) * [-730.145] (-729.211) (-731.349) (-731.337) -- 0:01:02
149500 -- (-732.709) (-732.219) (-736.126) [-730.202] * (-732.802) [-730.482] (-732.223) (-738.143) -- 0:01:02
150000 -- (-730.884) [-731.476] (-731.379) (-734.626) * (-732.298) [-735.228] (-731.073) (-734.731) -- 0:01:02
Average standard deviation of split frequencies: 0.010429
150500 -- (-732.034) (-732.422) [-731.956] (-734.220) * [-731.835] (-732.241) (-729.164) (-731.880) -- 0:01:02
151000 -- (-732.161) (-731.432) (-733.057) [-732.577] * (-731.211) (-738.221) [-731.854] (-733.471) -- 0:01:01
151500 -- (-733.057) (-733.357) (-731.285) [-729.593] * [-731.961] (-732.119) (-731.891) (-732.431) -- 0:01:01
152000 -- (-734.248) (-736.209) [-730.873] (-732.744) * (-730.364) [-730.732] (-729.662) (-734.439) -- 0:01:01
152500 -- (-733.460) (-731.541) [-729.627] (-732.291) * [-730.840] (-733.104) (-733.802) (-736.274) -- 0:01:01
153000 -- (-734.135) (-729.250) (-731.327) [-731.744] * (-734.365) (-737.884) (-738.342) [-736.324] -- 0:01:00
153500 -- (-733.509) (-732.856) (-730.995) [-734.153] * [-730.658] (-733.977) (-738.214) (-729.580) -- 0:01:00
154000 -- (-733.831) (-732.166) (-732.100) [-731.409] * [-731.932] (-733.644) (-734.235) (-731.674) -- 0:01:05
154500 -- (-735.612) (-733.850) (-732.028) [-729.280] * (-734.252) [-731.183] (-732.320) (-731.572) -- 0:01:05
155000 -- (-735.536) (-731.376) (-732.318) [-731.731] * (-733.326) (-731.732) [-730.869] (-731.314) -- 0:01:05
Average standard deviation of split frequencies: 0.011732
155500 -- (-731.470) (-731.803) (-732.884) [-733.058] * (-732.781) (-732.517) [-732.239] (-736.381) -- 0:01:05
156000 -- (-730.730) (-730.378) [-731.993] (-734.081) * (-731.197) [-732.348] (-732.767) (-731.182) -- 0:01:04
156500 -- (-730.673) [-731.514] (-735.205) (-733.882) * (-734.385) (-733.518) [-732.304] (-735.029) -- 0:01:04
157000 -- [-730.703] (-731.900) (-734.052) (-747.501) * (-730.699) (-736.264) [-731.568] (-730.918) -- 0:01:04
157500 -- (-735.405) (-733.704) [-729.428] (-732.508) * (-733.115) (-734.112) (-736.080) [-729.806] -- 0:01:04
158000 -- [-730.195] (-731.355) (-734.096) (-731.418) * (-732.506) (-731.291) (-733.401) [-729.942] -- 0:01:03
158500 -- [-731.057] (-735.030) (-731.727) (-731.241) * (-735.015) [-731.709] (-732.340) (-730.440) -- 0:01:03
159000 -- (-735.010) [-732.588] (-737.172) (-732.427) * [-732.545] (-731.419) (-731.435) (-730.763) -- 0:01:03
159500 -- (-733.886) (-732.571) (-732.785) [-731.688] * (-733.429) (-738.238) (-738.631) [-735.628] -- 0:01:03
160000 -- [-730.438] (-729.957) (-737.639) (-735.506) * (-732.980) (-735.177) (-733.993) [-730.186] -- 0:01:02
Average standard deviation of split frequencies: 0.013635
160500 -- [-733.716] (-735.537) (-740.328) (-731.516) * (-732.892) (-737.039) [-730.787] (-729.974) -- 0:01:02
161000 -- (-730.873) (-731.151) (-733.146) [-730.547] * (-733.220) (-734.333) [-731.572] (-733.258) -- 0:01:02
161500 -- (-730.293) [-737.227] (-736.093) (-734.299) * (-736.411) [-732.500] (-730.186) (-733.169) -- 0:01:02
162000 -- [-733.793] (-744.722) (-731.731) (-734.037) * (-735.506) [-730.058] (-731.613) (-731.409) -- 0:01:02
162500 -- (-733.925) (-741.267) [-732.490] (-733.316) * [-731.350] (-734.585) (-731.784) (-732.924) -- 0:01:01
163000 -- (-731.901) (-731.994) (-732.419) [-731.435] * (-730.846) [-731.212] (-731.348) (-729.480) -- 0:01:01
163500 -- (-733.420) [-731.268] (-731.568) (-732.214) * (-729.288) (-732.791) (-731.749) [-732.579] -- 0:01:01
164000 -- (-734.917) (-732.638) (-733.890) [-735.443] * (-732.999) (-729.741) (-732.576) [-728.764] -- 0:01:01
164500 -- [-729.068] (-730.852) (-733.991) (-732.525) * [-733.480] (-734.726) (-738.188) (-734.168) -- 0:01:00
165000 -- (-733.654) (-731.725) [-732.739] (-735.335) * (-733.697) (-733.406) [-730.946] (-732.201) -- 0:01:00
Average standard deviation of split frequencies: 0.014041
165500 -- (-736.695) (-732.264) (-733.761) [-733.899] * (-736.347) (-732.726) (-730.999) [-733.160] -- 0:01:00
166000 -- (-730.713) [-729.617] (-736.227) (-732.827) * (-734.502) (-732.512) (-733.349) [-735.181] -- 0:01:00
166500 -- (-731.575) [-735.730] (-737.384) (-730.999) * (-730.206) [-732.637] (-736.162) (-731.111) -- 0:01:00
167000 -- [-732.241] (-730.514) (-733.542) (-733.616) * (-731.528) (-731.340) [-734.954] (-733.210) -- 0:01:04
167500 -- (-731.715) (-733.049) (-734.922) [-735.782] * (-733.795) [-729.403] (-731.610) (-731.980) -- 0:01:04
168000 -- [-734.197] (-732.650) (-735.300) (-730.763) * (-733.920) (-730.240) [-731.623] (-738.666) -- 0:01:04
168500 -- (-734.380) (-734.489) (-736.312) [-731.893] * [-732.152] (-729.557) (-732.567) (-736.742) -- 0:01:04
169000 -- (-734.150) [-739.912] (-735.396) (-732.286) * [-731.368] (-731.688) (-737.527) (-730.987) -- 0:01:03
169500 -- (-734.814) (-737.986) (-732.517) [-733.886] * (-733.007) (-730.523) (-736.032) [-732.720] -- 0:01:03
170000 -- (-735.283) (-736.189) [-729.600] (-738.789) * (-731.769) [-731.900] (-735.794) (-732.380) -- 0:01:03
Average standard deviation of split frequencies: 0.014538
170500 -- (-730.346) [-735.467] (-732.897) (-734.121) * (-731.525) (-731.337) (-732.492) [-733.256] -- 0:01:03
171000 -- (-731.718) (-735.122) (-729.714) [-729.184] * (-731.542) [-729.280] (-733.433) (-733.912) -- 0:01:03
171500 -- (-732.413) (-735.525) (-729.941) [-731.170] * (-733.781) (-731.571) [-730.248] (-731.790) -- 0:01:02
172000 -- (-733.647) (-731.726) [-729.907] (-731.979) * (-733.113) [-731.014] (-733.367) (-734.509) -- 0:01:02
172500 -- (-732.099) (-732.101) (-732.644) [-732.770] * (-737.426) [-731.929] (-731.979) (-731.606) -- 0:01:02
173000 -- (-729.923) [-733.605] (-735.289) (-730.676) * (-739.103) [-732.981] (-730.515) (-732.295) -- 0:01:02
173500 -- (-732.684) (-734.073) [-732.354] (-734.027) * [-730.115] (-732.928) (-730.472) (-732.050) -- 0:01:01
174000 -- (-730.018) (-732.382) (-733.054) [-729.604] * [-731.397] (-730.587) (-731.465) (-732.478) -- 0:01:01
174500 -- [-729.824] (-732.687) (-732.773) (-734.802) * [-736.472] (-730.413) (-730.971) (-735.610) -- 0:01:01
175000 -- (-732.619) [-732.968] (-731.945) (-732.977) * (-732.097) (-733.270) [-731.167] (-736.711) -- 0:01:01
Average standard deviation of split frequencies: 0.013956
175500 -- (-732.599) [-733.079] (-733.812) (-735.915) * (-736.766) (-732.789) [-732.969] (-732.058) -- 0:01:01
176000 -- [-730.782] (-731.406) (-735.222) (-734.266) * (-731.982) [-732.703] (-730.062) (-731.661) -- 0:01:00
176500 -- (-733.754) (-730.185) (-735.005) [-731.648] * (-731.261) [-732.038] (-730.043) (-731.424) -- 0:01:00
177000 -- [-732.264] (-733.666) (-733.833) (-732.218) * (-736.494) (-731.876) [-730.788] (-731.540) -- 0:01:00
177500 -- (-730.426) (-732.138) (-733.196) [-730.868] * (-733.347) (-731.685) [-732.323] (-732.406) -- 0:01:00
178000 -- (-730.717) (-731.247) [-732.877] (-730.187) * [-732.345] (-732.383) (-734.491) (-732.016) -- 0:01:00
178500 -- (-733.884) [-734.559] (-732.327) (-735.059) * (-732.080) (-730.140) (-731.669) [-731.750] -- 0:00:59
179000 -- (-731.807) (-734.301) [-730.759] (-732.425) * (-734.539) [-732.854] (-728.951) (-731.183) -- 0:00:59
179500 -- (-734.585) [-732.632] (-732.151) (-733.515) * [-733.037] (-730.733) (-731.837) (-729.957) -- 0:00:59
180000 -- (-737.826) [-733.625] (-730.817) (-737.924) * (-731.788) [-729.683] (-733.446) (-731.989) -- 0:00:59
Average standard deviation of split frequencies: 0.013046
180500 -- [-731.497] (-734.476) (-734.627) (-734.552) * (-730.923) (-731.413) [-732.036] (-734.570) -- 0:01:03
181000 -- [-731.123] (-735.081) (-732.658) (-732.618) * [-729.440] (-731.004) (-728.166) (-730.822) -- 0:01:03
181500 -- (-730.493) [-734.867] (-732.013) (-731.461) * (-730.109) (-731.653) (-730.516) [-731.988] -- 0:01:03
182000 -- (-733.932) (-735.295) (-729.180) [-730.282] * (-734.477) (-732.985) (-728.067) [-733.651] -- 0:01:02
182500 -- (-730.071) (-734.814) (-731.933) [-732.970] * (-733.562) (-732.555) [-730.196] (-733.509) -- 0:01:02
183000 -- [-730.648] (-733.400) (-731.397) (-733.995) * [-732.219] (-732.904) (-733.751) (-734.616) -- 0:01:02
183500 -- (-732.007) (-733.167) [-729.727] (-732.672) * [-730.275] (-731.349) (-732.655) (-732.105) -- 0:01:02
184000 -- (-735.825) (-731.626) [-730.974] (-734.186) * (-731.790) (-730.280) (-728.292) [-731.192] -- 0:01:02
184500 -- (-731.647) [-734.185] (-731.827) (-730.570) * [-730.206] (-731.409) (-730.571) (-733.052) -- 0:01:01
185000 -- (-735.002) [-731.412] (-736.528) (-732.459) * (-732.763) (-735.924) [-730.256] (-732.681) -- 0:01:01
Average standard deviation of split frequencies: 0.012272
185500 -- (-731.231) (-731.081) (-737.959) [-730.661] * (-733.032) [-735.041] (-730.140) (-731.569) -- 0:01:01
186000 -- (-735.053) (-734.385) [-732.815] (-733.640) * (-732.439) (-731.832) (-730.427) [-731.810] -- 0:01:01
186500 -- (-737.025) (-733.719) (-732.727) [-734.007] * (-729.362) (-732.599) [-733.972] (-731.223) -- 0:01:01
187000 -- (-733.601) (-731.974) [-736.162] (-729.844) * (-733.018) [-732.629] (-734.261) (-732.349) -- 0:01:00
187500 -- (-730.526) (-733.887) (-732.110) [-729.042] * (-734.360) (-735.025) (-734.147) [-731.374] -- 0:01:00
188000 -- [-731.500] (-731.961) (-732.243) (-733.196) * (-732.537) [-731.750] (-738.552) (-732.683) -- 0:01:00
188500 -- [-732.443] (-731.493) (-731.847) (-733.731) * (-732.433) (-732.082) (-734.824) [-731.340] -- 0:01:00
189000 -- (-730.960) (-733.059) [-733.807] (-732.558) * (-733.121) [-734.969] (-730.745) (-735.212) -- 0:01:00
189500 -- [-731.463] (-730.923) (-735.102) (-733.606) * (-731.361) (-734.655) (-731.007) [-735.307] -- 0:00:59
190000 -- [-733.166] (-731.671) (-731.292) (-732.387) * (-734.089) [-731.960] (-732.575) (-737.107) -- 0:00:59
Average standard deviation of split frequencies: 0.011061
190500 -- (-734.735) [-734.913] (-733.862) (-730.829) * (-732.846) [-730.651] (-734.030) (-740.359) -- 0:00:59
191000 -- [-735.568] (-732.998) (-733.312) (-738.430) * [-732.008] (-735.834) (-730.691) (-735.474) -- 0:00:59
191500 -- (-734.260) [-731.170] (-733.092) (-736.094) * (-733.896) [-729.603] (-730.827) (-735.445) -- 0:00:59
192000 -- (-737.213) [-729.574] (-734.362) (-732.900) * [-730.989] (-731.496) (-730.577) (-738.214) -- 0:00:58
192500 -- (-738.026) [-733.254] (-733.111) (-732.486) * (-730.398) [-731.153] (-731.968) (-735.632) -- 0:00:58
193000 -- (-732.838) [-736.731] (-735.026) (-730.075) * (-732.027) [-731.332] (-731.275) (-735.385) -- 0:00:58
193500 -- [-732.836] (-733.887) (-734.444) (-734.796) * (-734.640) (-732.334) [-733.569] (-730.171) -- 0:00:58
194000 -- (-734.157) [-737.368] (-734.922) (-735.864) * (-732.714) (-732.201) (-730.035) [-732.125] -- 0:01:02
194500 -- (-736.350) [-730.129] (-740.333) (-733.333) * (-733.820) [-734.033] (-735.102) (-732.680) -- 0:01:02
195000 -- (-731.820) [-731.840] (-738.445) (-732.642) * (-732.139) [-729.208] (-731.441) (-729.154) -- 0:01:01
Average standard deviation of split frequencies: 0.012026
195500 -- (-737.207) [-733.957] (-731.687) (-736.362) * (-734.055) (-729.757) [-728.720] (-731.915) -- 0:01:01
196000 -- [-732.798] (-735.795) (-733.738) (-733.218) * (-734.170) (-729.874) [-730.380] (-731.169) -- 0:01:01
196500 -- (-733.479) [-732.889] (-731.497) (-739.485) * [-732.418] (-731.659) (-730.745) (-732.826) -- 0:01:01
197000 -- [-733.955] (-734.368) (-732.887) (-731.506) * (-733.851) (-730.788) [-729.955] (-734.923) -- 0:01:01
197500 -- [-730.537] (-732.849) (-736.284) (-732.131) * (-732.538) (-730.834) (-729.694) [-730.668] -- 0:01:00
198000 -- (-731.165) (-732.075) (-730.440) [-733.250] * [-729.561] (-730.564) (-732.102) (-730.269) -- 0:01:00
198500 -- (-731.913) (-730.694) (-731.280) [-732.967] * (-731.679) (-731.255) (-730.854) [-733.457] -- 0:01:00
199000 -- (-736.850) (-731.553) (-733.251) [-732.226] * (-731.163) (-732.978) [-733.175] (-735.177) -- 0:01:00
199500 -- (-732.763) [-730.908] (-731.562) (-731.088) * (-733.020) (-731.398) [-729.841] (-737.055) -- 0:01:00
200000 -- (-731.148) (-731.507) (-735.207) [-731.384] * [-730.436] (-737.657) (-736.082) (-732.558) -- 0:00:59
Average standard deviation of split frequencies: 0.011993
200500 -- (-730.348) [-730.982] (-737.586) (-733.542) * (-730.555) [-730.670] (-732.281) (-733.276) -- 0:00:59
201000 -- [-734.708] (-730.159) (-735.219) (-731.192) * (-731.031) (-732.301) [-730.946] (-735.276) -- 0:00:59
201500 -- (-730.613) (-732.691) (-733.743) [-731.828] * [-731.197] (-734.929) (-729.461) (-738.184) -- 0:00:59
202000 -- [-733.097] (-733.454) (-732.726) (-731.432) * (-735.563) (-733.431) (-732.259) [-732.740] -- 0:00:59
202500 -- (-733.582) [-730.840] (-734.028) (-730.697) * (-735.231) (-732.270) [-731.751] (-732.743) -- 0:00:59
203000 -- [-729.687] (-732.490) (-735.330) (-734.202) * [-731.758] (-733.681) (-731.412) (-731.604) -- 0:00:58
203500 -- (-731.461) [-731.768] (-736.093) (-730.659) * (-732.525) [-732.927] (-730.460) (-731.454) -- 0:00:58
204000 -- [-730.639] (-733.385) (-737.278) (-731.920) * (-735.634) (-730.573) (-730.272) [-731.942] -- 0:00:58
204500 -- (-732.043) (-732.150) [-735.530] (-732.414) * (-734.901) (-731.035) (-731.148) [-731.252] -- 0:00:58
205000 -- (-730.951) (-731.807) [-732.404] (-734.188) * (-735.844) (-733.052) (-730.655) [-732.317] -- 0:00:58
Average standard deviation of split frequencies: 0.011099
205500 -- (-731.580) [-733.126] (-734.197) (-730.753) * (-730.858) (-735.046) (-734.667) [-731.325] -- 0:00:57
206000 -- [-731.603] (-731.856) (-735.221) (-733.155) * (-736.472) (-731.596) (-736.905) [-731.607] -- 0:00:57
206500 -- (-732.061) [-731.173] (-736.144) (-733.403) * (-735.266) (-731.634) (-730.710) [-735.682] -- 0:00:57
207000 -- [-730.421] (-737.682) (-734.960) (-730.208) * (-738.619) (-732.963) [-729.020] (-735.539) -- 0:01:01
207500 -- (-731.422) [-735.059] (-732.410) (-733.035) * (-737.523) (-732.890) [-729.874] (-735.408) -- 0:01:01
208000 -- (-732.473) (-736.733) (-734.959) [-733.103] * (-730.995) (-733.079) (-732.953) [-736.684] -- 0:01:00
208500 -- [-732.602] (-733.242) (-737.874) (-735.181) * [-732.470] (-733.273) (-733.040) (-736.816) -- 0:01:00
209000 -- [-730.948] (-733.670) (-734.031) (-731.970) * (-730.018) [-732.941] (-730.739) (-740.296) -- 0:01:00
209500 -- (-732.134) [-729.281] (-732.395) (-738.723) * (-729.587) [-732.074] (-729.249) (-739.332) -- 0:01:00
210000 -- (-730.682) (-733.856) [-731.904] (-732.499) * (-734.673) (-732.685) (-732.636) [-736.013] -- 0:01:00
Average standard deviation of split frequencies: 0.011077
210500 -- (-734.560) (-731.684) (-733.634) [-731.890] * (-732.491) (-732.769) (-732.091) [-739.089] -- 0:01:00
211000 -- (-732.603) (-731.784) (-732.444) [-731.437] * (-734.953) (-730.922) (-731.207) [-735.776] -- 0:00:59
211500 -- (-730.902) (-734.541) [-735.113] (-731.364) * (-734.626) (-732.948) [-731.681] (-735.831) -- 0:00:59
212000 -- (-732.833) [-731.332] (-734.719) (-731.717) * [-728.948] (-734.613) (-731.740) (-741.792) -- 0:00:59
212500 -- (-731.191) (-732.673) (-731.024) [-729.236] * (-731.481) (-730.632) [-733.314] (-731.214) -- 0:00:59
213000 -- (-732.798) (-730.832) [-730.042] (-733.643) * (-734.517) (-734.176) [-731.160] (-732.616) -- 0:00:59
213500 -- (-733.188) (-733.725) (-729.879) [-731.464] * (-734.982) (-733.117) [-731.920] (-731.821) -- 0:00:58
214000 -- [-732.687] (-731.155) (-732.521) (-737.273) * [-731.854] (-733.350) (-731.121) (-732.302) -- 0:00:58
214500 -- (-731.942) (-731.062) (-730.441) [-731.626] * (-732.980) (-731.433) [-732.325] (-733.145) -- 0:00:58
215000 -- (-736.061) [-729.758] (-737.475) (-732.443) * (-733.995) (-734.993) (-735.895) [-730.311] -- 0:00:58
Average standard deviation of split frequencies: 0.011349
215500 -- [-736.485] (-735.217) (-733.387) (-730.719) * [-731.634] (-734.008) (-735.614) (-731.492) -- 0:00:58
216000 -- (-733.825) [-731.345] (-732.277) (-731.126) * (-732.882) [-731.759] (-735.672) (-734.103) -- 0:00:58
216500 -- (-729.958) (-734.542) [-735.051] (-731.815) * (-733.987) (-735.636) (-736.895) [-733.452] -- 0:00:57
217000 -- (-731.907) (-734.429) [-736.075] (-733.878) * [-729.855] (-738.101) (-738.590) (-731.292) -- 0:00:57
217500 -- [-730.376] (-732.078) (-737.194) (-730.600) * (-732.792) [-735.002] (-732.245) (-731.993) -- 0:00:57
218000 -- (-731.396) [-734.775] (-731.575) (-730.715) * (-732.336) [-732.643] (-733.769) (-730.564) -- 0:00:57
218500 -- (-730.917) (-729.211) (-733.128) [-734.682] * [-730.271] (-732.311) (-732.136) (-733.189) -- 0:00:57
219000 -- [-731.883] (-730.662) (-730.786) (-732.535) * (-731.966) (-735.730) [-735.329] (-732.644) -- 0:00:57
219500 -- (-731.973) (-730.809) [-730.520] (-732.383) * (-730.137) [-732.102] (-739.152) (-731.208) -- 0:01:00
220000 -- (-731.259) [-732.827] (-732.966) (-729.700) * (-738.543) (-731.603) (-730.682) [-731.856] -- 0:01:00
Average standard deviation of split frequencies: 0.011581
220500 -- (-731.678) (-735.602) [-731.982] (-728.837) * (-731.357) (-730.473) [-728.962] (-731.398) -- 0:01:00
221000 -- (-737.020) (-736.581) [-730.644] (-731.995) * (-732.411) (-733.293) [-729.858] (-732.563) -- 0:00:59
221500 -- (-731.664) (-732.864) [-730.064] (-733.211) * (-731.048) (-733.819) [-730.176] (-732.925) -- 0:00:59
222000 -- (-734.421) (-733.461) [-731.802] (-734.095) * [-730.835] (-731.555) (-730.654) (-730.972) -- 0:00:59
222500 -- (-736.580) (-732.974) [-731.942] (-731.216) * [-733.798] (-733.024) (-733.630) (-731.132) -- 0:00:59
223000 -- (-732.707) [-730.989] (-732.313) (-731.832) * (-733.613) (-731.746) (-733.880) [-732.669] -- 0:00:59
223500 -- (-730.269) [-731.310] (-732.442) (-733.786) * (-732.968) (-732.520) (-731.803) [-734.101] -- 0:00:59
224000 -- [-730.325] (-732.581) (-732.950) (-732.917) * (-734.464) (-732.260) (-737.671) [-731.633] -- 0:00:58
224500 -- (-730.645) [-730.124] (-732.909) (-732.043) * [-732.810] (-731.619) (-730.500) (-736.750) -- 0:00:58
225000 -- (-739.781) (-730.260) [-730.588] (-733.823) * [-730.841] (-734.091) (-732.475) (-734.522) -- 0:00:58
Average standard deviation of split frequencies: 0.010429
225500 -- [-738.498] (-730.786) (-733.217) (-739.341) * (-734.145) (-732.537) [-730.307] (-734.822) -- 0:00:58
226000 -- (-731.472) [-729.180] (-732.229) (-736.868) * [-730.905] (-732.678) (-731.812) (-733.536) -- 0:00:58
226500 -- (-729.040) [-731.754] (-732.549) (-732.422) * (-738.070) (-733.069) (-733.601) [-733.721] -- 0:00:58
227000 -- (-730.835) (-730.857) (-730.053) [-730.458] * [-733.862] (-735.361) (-731.656) (-732.079) -- 0:00:57
227500 -- (-732.546) (-734.318) [-730.279] (-729.110) * [-732.611] (-732.548) (-732.370) (-731.191) -- 0:00:57
228000 -- (-731.480) (-734.622) [-732.084] (-730.874) * [-731.582] (-734.959) (-731.630) (-732.936) -- 0:00:57
228500 -- [-731.498] (-731.210) (-732.966) (-732.307) * [-734.700] (-734.473) (-738.559) (-732.210) -- 0:00:57
229000 -- [-731.809] (-728.997) (-731.760) (-729.329) * (-733.397) (-731.610) (-737.589) [-732.614] -- 0:00:57
229500 -- (-733.945) [-729.451] (-733.187) (-732.042) * [-730.618] (-735.846) (-735.894) (-730.607) -- 0:00:57
230000 -- (-730.569) (-731.318) (-730.917) [-730.205] * (-730.352) (-731.981) (-730.095) [-734.301] -- 0:00:56
Average standard deviation of split frequencies: 0.011079
230500 -- (-730.194) (-729.269) [-732.792] (-733.024) * [-732.185] (-731.260) (-730.591) (-730.252) -- 0:00:56
231000 -- (-732.931) [-732.639] (-729.984) (-731.823) * (-730.029) (-732.842) [-730.782] (-732.735) -- 0:00:56
231500 -- [-731.632] (-735.053) (-733.385) (-735.769) * (-733.095) [-733.646] (-731.038) (-733.005) -- 0:00:56
232000 -- (-733.673) [-732.582] (-730.061) (-736.526) * (-733.981) (-734.558) [-730.562] (-732.512) -- 0:00:59
232500 -- [-730.483] (-732.669) (-731.817) (-741.262) * (-734.921) (-732.260) (-728.758) [-734.088] -- 0:00:59
233000 -- (-730.863) [-730.305] (-732.931) (-737.022) * (-736.052) (-733.793) [-733.191] (-737.060) -- 0:00:59
233500 -- (-729.979) [-736.096] (-733.371) (-734.572) * [-731.587] (-731.048) (-738.109) (-733.262) -- 0:00:59
234000 -- (-730.025) (-736.129) [-731.461] (-738.558) * (-729.998) [-730.003] (-733.328) (-733.167) -- 0:00:58
234500 -- (-733.573) (-736.162) [-731.161] (-735.211) * (-731.978) (-738.234) [-730.642] (-731.564) -- 0:00:58
235000 -- [-729.536] (-731.256) (-731.428) (-734.885) * (-736.026) (-731.092) (-730.930) [-733.998] -- 0:00:58
Average standard deviation of split frequencies: 0.009433
235500 -- (-732.562) (-730.649) (-731.509) [-734.631] * (-731.512) (-734.864) [-731.099] (-733.244) -- 0:00:58
236000 -- (-731.540) (-731.190) (-736.012) [-732.317] * (-731.836) (-732.978) (-734.962) [-733.167] -- 0:00:58
236500 -- (-732.007) [-732.359] (-734.923) (-730.015) * (-737.506) (-733.995) (-731.282) [-733.255] -- 0:00:58
237000 -- (-731.984) [-731.009] (-731.584) (-735.518) * [-731.424] (-734.272) (-729.668) (-731.020) -- 0:00:57
237500 -- [-731.721] (-736.418) (-731.653) (-731.695) * (-730.682) (-734.348) (-734.348) [-732.181] -- 0:00:57
238000 -- (-732.813) (-732.978) (-733.018) [-734.724] * (-732.592) [-733.716] (-732.696) (-735.233) -- 0:00:57
238500 -- (-737.460) (-731.516) [-736.247] (-731.231) * (-731.092) (-735.438) (-734.074) [-735.577] -- 0:00:57
239000 -- (-732.532) (-732.727) [-732.219] (-733.957) * (-732.893) (-732.597) [-733.300] (-740.099) -- 0:00:57
239500 -- (-738.690) (-735.779) (-732.212) [-734.562] * (-731.787) (-733.776) [-732.624] (-738.927) -- 0:00:57
240000 -- (-731.644) [-732.476] (-733.001) (-733.274) * (-736.084) (-730.132) [-731.504] (-739.851) -- 0:00:56
Average standard deviation of split frequencies: 0.009563
240500 -- (-731.480) (-731.954) [-730.608] (-734.174) * (-732.400) [-735.421] (-730.954) (-733.747) -- 0:00:56
241000 -- (-732.726) [-730.697] (-731.899) (-736.834) * [-734.304] (-735.700) (-733.002) (-730.777) -- 0:00:56
241500 -- (-733.247) (-731.885) (-733.899) [-732.438] * (-738.376) (-731.519) [-731.769] (-731.416) -- 0:00:56
242000 -- [-732.496] (-729.580) (-733.642) (-732.358) * (-733.380) (-732.429) [-729.881] (-730.901) -- 0:00:56
242500 -- (-736.462) (-736.274) (-732.982) [-731.871] * (-732.300) [-733.267] (-731.511) (-730.044) -- 0:00:56
243000 -- (-734.651) [-738.622] (-734.642) (-733.884) * (-734.807) [-731.753] (-731.677) (-735.329) -- 0:00:56
243500 -- (-732.108) (-735.641) [-730.446] (-734.148) * (-734.175) (-733.095) (-729.512) [-730.576] -- 0:00:55
244000 -- (-732.455) [-735.834] (-730.863) (-734.639) * (-731.679) (-734.540) [-731.450] (-729.106) -- 0:00:55
244500 -- [-731.966] (-736.926) (-729.966) (-734.898) * (-730.652) [-733.085] (-737.109) (-736.592) -- 0:00:55
245000 -- (-739.152) [-733.001] (-735.602) (-731.457) * (-732.084) (-732.410) [-729.621] (-735.759) -- 0:00:55
Average standard deviation of split frequencies: 0.009049
245500 -- (-738.132) (-731.364) [-731.023] (-739.586) * (-729.318) [-731.089] (-732.408) (-729.533) -- 0:00:58
246000 -- (-736.093) (-731.797) (-731.494) [-733.210] * [-733.529] (-738.970) (-731.349) (-730.106) -- 0:00:58
246500 -- (-732.649) (-731.979) (-732.974) [-737.334] * (-732.226) [-733.908] (-730.440) (-734.021) -- 0:00:58
247000 -- (-733.874) (-734.530) [-730.677] (-733.902) * (-732.133) (-733.263) [-731.650] (-730.966) -- 0:00:57
247500 -- (-736.830) (-732.473) (-732.984) [-735.196] * [-731.624] (-733.005) (-730.713) (-737.675) -- 0:00:57
248000 -- (-738.514) [-732.150] (-732.361) (-734.130) * (-731.236) [-733.822] (-731.654) (-732.332) -- 0:00:57
248500 -- [-741.289] (-736.875) (-730.632) (-735.330) * (-732.454) (-732.633) (-729.571) [-731.718] -- 0:00:57
249000 -- (-731.193) (-730.970) [-730.581] (-735.313) * [-731.992] (-731.579) (-730.218) (-732.232) -- 0:00:57
249500 -- [-734.184] (-731.020) (-731.557) (-735.738) * (-730.689) (-731.177) [-738.487] (-732.262) -- 0:00:57
250000 -- [-733.516] (-731.946) (-735.225) (-736.046) * (-732.195) (-733.330) [-734.384] (-732.773) -- 0:00:57
Average standard deviation of split frequencies: 0.010731
250500 -- [-731.725] (-729.762) (-735.616) (-731.239) * [-733.475] (-734.735) (-731.631) (-730.264) -- 0:00:56
251000 -- (-732.438) (-731.468) (-730.784) [-733.631] * (-733.188) (-732.198) [-732.740] (-732.005) -- 0:00:56
251500 -- (-733.901) (-733.425) [-732.113] (-732.203) * (-729.642) [-734.274] (-730.816) (-730.503) -- 0:00:56
252000 -- (-732.805) (-730.090) (-730.029) [-731.987] * (-733.550) (-731.706) [-729.954] (-730.488) -- 0:00:56
252500 -- (-735.049) (-731.251) [-734.721] (-734.288) * [-730.539] (-732.559) (-733.770) (-732.191) -- 0:00:56
253000 -- (-733.968) [-733.765] (-730.531) (-733.811) * (-731.845) (-730.213) [-733.570] (-730.363) -- 0:00:56
253500 -- (-736.829) (-736.427) [-731.189] (-734.183) * (-731.848) (-731.847) [-732.681] (-730.824) -- 0:00:55
254000 -- (-735.051) (-733.618) (-733.016) [-732.030] * (-732.005) (-730.222) (-730.385) [-734.237] -- 0:00:55
254500 -- [-731.406] (-736.178) (-732.202) (-729.920) * [-732.089] (-730.072) (-733.712) (-731.610) -- 0:00:55
255000 -- [-730.908] (-730.414) (-733.108) (-732.408) * [-733.629] (-730.686) (-736.358) (-730.143) -- 0:00:55
Average standard deviation of split frequencies: 0.010243
255500 -- (-730.565) [-731.148] (-730.878) (-734.697) * (-732.095) (-733.897) (-735.006) [-732.774] -- 0:00:55
256000 -- (-734.891) (-732.274) [-730.532] (-732.382) * [-736.498] (-731.506) (-732.362) (-730.197) -- 0:00:55
256500 -- (-733.229) (-732.848) [-729.832] (-731.753) * (-734.518) (-732.074) (-731.855) [-732.323] -- 0:00:55
257000 -- (-733.346) [-731.856] (-731.498) (-735.679) * (-730.667) (-731.672) [-731.446] (-732.925) -- 0:00:54
257500 -- (-735.173) [-729.824] (-731.982) (-731.651) * [-731.327] (-732.640) (-732.787) (-729.821) -- 0:00:54
258000 -- [-735.598] (-734.818) (-731.843) (-736.103) * [-732.671] (-733.148) (-730.262) (-729.409) -- 0:00:54
258500 -- [-731.886] (-732.888) (-735.513) (-730.210) * (-733.694) (-732.706) (-729.917) [-731.934] -- 0:00:57
259000 -- (-732.225) [-734.517] (-736.597) (-732.889) * [-731.342] (-731.234) (-730.822) (-732.629) -- 0:00:57
259500 -- [-733.159] (-736.773) (-731.107) (-735.711) * [-733.409] (-734.964) (-734.778) (-730.820) -- 0:00:57
260000 -- (-735.935) [-733.261] (-737.015) (-733.445) * [-730.517] (-733.729) (-730.628) (-729.866) -- 0:00:56
Average standard deviation of split frequencies: 0.011416
260500 -- (-736.384) [-731.604] (-737.354) (-731.462) * [-731.819] (-731.065) (-729.749) (-733.070) -- 0:00:56
261000 -- [-733.898] (-733.099) (-737.901) (-733.704) * [-732.942] (-732.113) (-731.552) (-732.792) -- 0:00:56
261500 -- [-734.670] (-734.588) (-734.564) (-731.992) * (-731.201) [-731.529] (-731.651) (-731.381) -- 0:00:56
262000 -- (-733.668) (-731.854) [-733.422] (-731.508) * (-732.156) [-730.842] (-734.411) (-732.469) -- 0:00:56
262500 -- [-732.400] (-731.885) (-733.673) (-732.621) * (-730.891) [-735.095] (-733.394) (-731.100) -- 0:00:56
263000 -- (-734.626) [-731.445] (-733.043) (-730.749) * [-731.200] (-730.486) (-735.767) (-731.253) -- 0:00:56
263500 -- (-735.936) (-733.847) [-733.162] (-734.381) * (-731.792) (-731.941) (-737.038) [-732.121] -- 0:00:55
264000 -- (-733.041) (-733.547) [-732.723] (-734.321) * (-733.339) (-729.771) [-733.277] (-731.678) -- 0:00:55
264500 -- (-732.134) (-733.983) [-731.442] (-734.253) * [-731.814] (-731.974) (-730.965) (-735.483) -- 0:00:55
265000 -- (-736.802) (-731.229) (-739.101) [-734.492] * (-733.609) (-731.582) (-733.385) [-732.438] -- 0:00:55
Average standard deviation of split frequencies: 0.012614
265500 -- (-734.611) [-732.300] (-738.160) (-737.011) * (-732.616) [-730.123] (-731.072) (-732.020) -- 0:00:55
266000 -- [-733.273] (-733.605) (-733.624) (-738.173) * (-734.701) (-734.566) [-735.526] (-730.994) -- 0:00:55
266500 -- [-731.750] (-733.045) (-731.581) (-735.676) * (-733.039) [-734.986] (-734.180) (-732.407) -- 0:00:55
267000 -- (-732.943) [-730.227] (-735.143) (-735.174) * (-734.015) (-734.653) [-730.937] (-732.153) -- 0:00:54
267500 -- (-732.522) [-729.899] (-734.156) (-733.538) * (-736.881) [-730.867] (-732.382) (-734.179) -- 0:00:54
268000 -- (-730.579) [-730.624] (-731.596) (-731.942) * (-731.158) (-732.311) (-731.588) [-730.845] -- 0:00:54
268500 -- [-732.181] (-730.169) (-734.160) (-732.336) * (-730.840) (-732.234) (-732.555) [-731.009] -- 0:00:54
269000 -- (-730.446) (-729.608) (-731.584) [-729.061] * [-733.274] (-731.787) (-730.618) (-732.402) -- 0:00:54
269500 -- [-730.308] (-730.404) (-730.571) (-730.675) * (-735.174) (-731.609) (-738.955) [-730.081] -- 0:00:54
270000 -- (-728.593) [-736.879] (-733.767) (-732.142) * (-730.593) (-732.833) (-734.487) [-734.364] -- 0:00:54
Average standard deviation of split frequencies: 0.014036
270500 -- (-731.065) (-729.951) [-730.754] (-731.127) * (-730.859) (-732.090) [-734.563] (-732.689) -- 0:00:53
271000 -- (-732.041) (-736.753) (-732.240) [-731.453] * (-732.016) (-731.157) (-732.053) [-732.736] -- 0:00:53
271500 -- (-730.953) [-731.325] (-733.209) (-731.918) * (-733.217) [-729.961] (-731.565) (-733.039) -- 0:00:56
272000 -- (-733.399) [-734.468] (-734.418) (-733.574) * (-730.781) (-733.787) (-732.094) [-730.853] -- 0:00:56
272500 -- [-730.803] (-736.460) (-731.735) (-731.684) * [-732.379] (-732.815) (-734.566) (-730.448) -- 0:00:56
273000 -- (-730.054) (-731.451) [-730.704] (-731.972) * [-730.010] (-730.652) (-738.297) (-733.505) -- 0:00:55
273500 -- (-731.702) (-731.362) [-731.033] (-732.202) * (-735.202) [-734.356] (-736.175) (-738.375) -- 0:00:55
274000 -- (-729.702) (-734.865) (-730.187) [-735.154] * (-734.507) (-733.070) [-734.887] (-731.092) -- 0:00:55
274500 -- (-736.627) (-736.757) (-731.450) [-732.543] * (-732.272) (-731.657) (-736.106) [-730.488] -- 0:00:55
275000 -- (-732.811) (-730.872) [-731.045] (-734.375) * (-732.367) [-733.307] (-732.464) (-733.176) -- 0:00:55
Average standard deviation of split frequencies: 0.012063
275500 -- (-736.186) (-731.763) (-736.334) [-733.947] * [-733.541] (-734.312) (-732.749) (-732.659) -- 0:00:55
276000 -- (-730.803) [-730.444] (-730.071) (-732.508) * (-732.803) (-733.274) (-731.465) [-733.556] -- 0:00:55
276500 -- [-729.825] (-735.925) (-729.909) (-733.824) * (-731.275) (-733.540) (-734.900) [-730.496] -- 0:00:54
277000 -- (-731.268) (-731.525) [-733.816] (-734.176) * (-737.855) [-731.589] (-732.078) (-733.493) -- 0:00:54
277500 -- (-731.236) (-736.767) (-732.632) [-730.995] * (-736.105) (-731.559) [-735.105] (-734.580) -- 0:00:54
278000 -- (-732.124) (-736.038) (-733.009) [-732.279] * (-734.872) [-731.769] (-736.405) (-732.927) -- 0:00:54
278500 -- (-737.159) (-734.544) (-735.161) [-733.513] * (-733.377) [-733.133] (-734.586) (-736.242) -- 0:00:54
279000 -- (-731.687) [-736.945] (-735.945) (-735.561) * (-732.930) (-732.931) (-733.137) [-733.106] -- 0:00:54
279500 -- (-733.186) (-733.237) (-736.168) [-730.697] * (-728.922) (-732.079) (-732.640) [-732.317] -- 0:00:54
280000 -- (-731.771) (-735.944) (-735.300) [-732.353] * (-732.294) (-733.936) [-732.075] (-739.520) -- 0:00:53
Average standard deviation of split frequencies: 0.013437
280500 -- (-734.388) (-734.046) (-735.198) [-731.944] * (-735.040) (-734.532) [-732.498] (-734.877) -- 0:00:53
281000 -- [-732.390] (-737.398) (-736.646) (-730.281) * (-733.399) [-733.032] (-734.576) (-732.145) -- 0:00:53
281500 -- (-732.085) (-737.816) (-736.564) [-729.767] * (-737.738) [-729.994] (-734.219) (-733.253) -- 0:00:53
282000 -- [-735.212] (-734.804) (-739.434) (-730.129) * (-736.496) (-731.304) (-737.200) [-731.540] -- 0:00:53
282500 -- (-733.432) (-730.900) [-729.517] (-731.058) * (-735.086) (-730.885) [-732.709] (-732.537) -- 0:00:53
283000 -- (-733.905) (-730.975) [-730.148] (-736.607) * (-738.743) [-732.546] (-738.909) (-735.653) -- 0:00:53
283500 -- [-738.145] (-732.169) (-731.002) (-730.212) * (-735.853) (-738.755) (-732.365) [-734.531] -- 0:00:53
284000 -- (-730.645) [-731.630] (-729.450) (-733.454) * (-733.470) (-734.372) [-732.808] (-734.888) -- 0:00:52
284500 -- (-733.412) (-731.544) (-731.373) [-732.402] * (-732.693) [-730.590] (-735.834) (-732.848) -- 0:00:52
285000 -- [-733.443] (-734.509) (-730.755) (-732.238) * (-734.269) [-732.138] (-734.907) (-733.882) -- 0:00:52
Average standard deviation of split frequencies: 0.012604
285500 -- (-737.453) (-731.948) [-731.066] (-730.516) * (-733.156) [-732.955] (-731.231) (-732.256) -- 0:00:55
286000 -- (-737.720) (-730.370) (-733.444) [-731.044] * (-729.613) (-733.698) (-730.879) [-734.321] -- 0:00:54
286500 -- [-736.255] (-732.422) (-737.689) (-730.916) * [-733.739] (-740.489) (-729.776) (-732.037) -- 0:00:54
287000 -- (-733.813) (-736.917) [-735.051] (-734.864) * (-731.251) (-737.698) (-731.326) [-731.634] -- 0:00:54
287500 -- (-734.069) [-730.455] (-732.356) (-738.565) * (-733.873) (-731.272) (-731.935) [-733.136] -- 0:00:54
288000 -- (-734.232) (-736.106) (-738.329) [-732.941] * (-733.131) [-730.657] (-734.643) (-732.592) -- 0:00:54
288500 -- (-731.788) [-730.937] (-735.156) (-731.008) * (-735.881) [-732.954] (-732.268) (-734.981) -- 0:00:54
289000 -- (-733.271) (-735.752) (-734.714) [-731.385] * (-731.685) (-732.495) [-730.046] (-736.153) -- 0:00:54
289500 -- (-732.503) (-732.230) [-732.510] (-729.925) * (-733.806) [-730.099] (-731.825) (-732.406) -- 0:00:53
290000 -- [-731.447] (-730.208) (-733.661) (-729.849) * [-732.890] (-734.263) (-729.951) (-729.833) -- 0:00:53
Average standard deviation of split frequencies: 0.012974
290500 -- (-732.519) (-733.211) (-733.750) [-729.384] * (-733.472) (-731.625) (-729.029) [-732.121] -- 0:00:53
291000 -- (-737.900) (-733.145) (-731.826) [-731.289] * [-731.721] (-734.833) (-730.477) (-730.056) -- 0:00:53
291500 -- (-730.151) [-733.415] (-734.303) (-730.841) * (-734.478) (-734.868) [-730.462] (-734.662) -- 0:00:53
292000 -- (-736.854) (-732.526) (-730.100) [-731.111] * (-733.984) (-737.744) (-737.284) [-731.225] -- 0:00:53
292500 -- (-734.144) (-729.117) (-731.141) [-731.535] * (-736.606) (-736.547) (-735.271) [-734.349] -- 0:00:53
293000 -- (-731.046) (-731.343) (-731.265) [-731.238] * (-732.216) [-737.672] (-733.335) (-731.961) -- 0:00:53
293500 -- (-731.928) (-732.504) (-735.997) [-730.736] * (-733.774) (-734.408) (-737.647) [-734.634] -- 0:00:52
294000 -- (-732.199) (-733.151) [-733.608] (-732.794) * (-736.988) (-731.458) [-731.263] (-730.102) -- 0:00:52
294500 -- (-731.835) [-731.146] (-732.538) (-734.148) * (-730.320) (-732.278) [-730.228] (-731.240) -- 0:00:52
295000 -- (-733.870) (-734.165) (-731.326) [-734.786] * [-737.703] (-731.836) (-731.274) (-731.498) -- 0:00:52
Average standard deviation of split frequencies: 0.012085
295500 -- [-733.365] (-735.543) (-737.235) (-729.836) * [-736.761] (-732.543) (-732.741) (-732.830) -- 0:00:52
296000 -- (-735.244) [-737.154] (-735.646) (-732.112) * (-731.254) [-734.099] (-731.934) (-731.176) -- 0:00:52
296500 -- (-731.845) (-731.606) (-735.541) [-732.685] * (-731.433) (-734.832) (-729.882) [-732.459] -- 0:00:52
297000 -- (-731.302) (-730.477) [-733.190] (-732.660) * (-730.943) (-734.828) (-731.018) [-730.400] -- 0:00:52
297500 -- (-730.705) (-731.624) (-732.857) [-731.407] * [-734.971] (-732.728) (-736.904) (-734.100) -- 0:00:51
298000 -- (-733.390) (-730.756) (-733.887) [-732.081] * (-732.588) (-736.519) (-735.605) [-731.480] -- 0:00:51
298500 -- (-734.437) (-732.558) [-734.649] (-736.236) * (-732.099) (-732.009) [-732.967] (-731.578) -- 0:00:54
299000 -- (-732.097) (-733.162) [-735.774] (-736.543) * (-733.171) (-739.809) [-731.803] (-732.105) -- 0:00:53
299500 -- (-729.895) (-731.961) (-731.452) [-733.799] * (-732.916) [-737.385] (-735.826) (-733.356) -- 0:00:53
300000 -- (-731.614) [-729.383] (-734.047) (-731.732) * (-731.413) (-731.408) (-735.444) [-730.198] -- 0:00:53
Average standard deviation of split frequencies: 0.010888
300500 -- (-735.698) (-729.368) (-734.018) [-734.633] * (-734.300) (-731.399) [-735.342] (-733.145) -- 0:00:53
301000 -- [-732.833] (-733.722) (-731.612) (-732.001) * [-730.526] (-731.299) (-731.274) (-730.745) -- 0:00:53
301500 -- (-732.382) [-729.828] (-734.813) (-729.906) * [-730.000] (-731.708) (-732.519) (-728.644) -- 0:00:53
302000 -- (-732.300) [-731.057] (-735.497) (-734.214) * (-731.197) (-733.516) [-733.170] (-731.856) -- 0:00:53
302500 -- [-731.626] (-734.634) (-735.928) (-731.275) * (-733.889) [-732.283] (-731.777) (-731.924) -- 0:00:53
303000 -- (-731.924) (-734.084) [-732.862] (-731.696) * (-731.458) (-733.024) (-734.459) [-733.126] -- 0:00:52
303500 -- (-733.395) (-734.095) (-731.276) [-732.983] * (-731.268) [-731.416] (-732.374) (-734.405) -- 0:00:52
304000 -- (-737.581) (-731.561) [-731.135] (-731.561) * [-730.748] (-737.896) (-737.368) (-733.691) -- 0:00:52
304500 -- (-732.189) (-730.068) (-731.786) [-730.098] * (-732.509) (-730.980) (-733.560) [-730.857] -- 0:00:52
305000 -- [-729.438] (-732.075) (-730.782) (-730.074) * (-734.314) (-734.602) (-733.195) [-732.855] -- 0:00:52
Average standard deviation of split frequencies: 0.011725
305500 -- (-731.398) [-732.239] (-730.322) (-731.159) * (-730.560) (-732.943) (-734.768) [-731.914] -- 0:00:52
306000 -- (-730.123) (-732.269) (-729.894) [-733.416] * (-731.843) (-735.914) [-733.909] (-731.457) -- 0:00:52
306500 -- (-732.437) (-733.238) [-732.121] (-730.029) * (-730.972) [-736.092] (-733.547) (-737.274) -- 0:00:52
307000 -- (-731.610) (-734.633) (-732.706) [-730.975] * (-736.253) [-734.118] (-732.295) (-728.878) -- 0:00:51
307500 -- (-731.701) (-731.787) [-733.559] (-733.585) * [-732.619] (-733.755) (-734.531) (-731.464) -- 0:00:51
308000 -- [-731.979] (-732.538) (-730.006) (-733.889) * (-732.281) [-733.885] (-733.511) (-733.423) -- 0:00:51
308500 -- (-734.469) [-732.028] (-732.446) (-733.191) * [-732.237] (-736.098) (-731.330) (-733.351) -- 0:00:51
309000 -- (-743.641) (-735.086) (-730.529) [-735.604] * (-730.793) [-734.054] (-735.946) (-735.347) -- 0:00:51
309500 -- (-734.506) [-733.380] (-732.809) (-730.785) * (-732.598) [-735.161] (-734.637) (-730.309) -- 0:00:51
310000 -- (-730.919) (-731.891) [-733.983] (-733.409) * [-734.333] (-734.187) (-731.016) (-733.562) -- 0:00:51
Average standard deviation of split frequencies: 0.012050
310500 -- (-729.319) (-730.318) [-732.911] (-732.872) * (-730.060) (-733.614) (-735.520) [-734.737] -- 0:00:51
311000 -- [-732.837] (-733.248) (-730.905) (-733.353) * (-730.224) (-735.271) (-732.723) [-734.124] -- 0:00:50
311500 -- (-733.390) [-731.307] (-732.086) (-733.930) * [-731.476] (-735.058) (-733.058) (-734.193) -- 0:00:50
312000 -- [-732.616] (-736.491) (-730.774) (-738.033) * (-732.897) (-733.137) (-734.011) [-732.463] -- 0:00:52
312500 -- (-732.840) (-733.369) [-733.338] (-732.372) * (-729.073) (-737.644) (-729.699) [-734.363] -- 0:00:52
313000 -- (-731.804) (-736.494) (-733.625) [-732.769] * [-733.161] (-731.265) (-730.784) (-733.139) -- 0:00:52
313500 -- [-732.195] (-732.630) (-735.376) (-731.441) * (-731.644) (-737.569) [-729.322] (-732.997) -- 0:00:52
314000 -- (-732.991) [-735.084] (-736.569) (-733.592) * [-731.243] (-732.906) (-734.386) (-731.656) -- 0:00:52
314500 -- (-732.108) (-731.315) (-735.896) [-733.832] * (-735.585) (-731.824) [-732.868] (-731.035) -- 0:00:52
315000 -- (-732.602) (-730.406) [-732.225] (-736.597) * (-733.664) (-731.377) (-732.298) [-735.431] -- 0:00:52
Average standard deviation of split frequencies: 0.011934
315500 -- (-731.428) [-731.611] (-731.044) (-730.187) * [-729.757] (-735.634) (-732.226) (-732.151) -- 0:00:52
316000 -- (-729.366) (-734.204) (-735.912) [-730.949] * (-734.746) (-733.140) (-739.609) [-729.208] -- 0:00:51
316500 -- (-731.416) (-733.705) [-731.726] (-737.926) * (-735.223) (-731.918) [-733.014] (-732.492) -- 0:00:51
317000 -- (-732.245) (-737.450) [-733.141] (-734.518) * (-731.123) (-733.833) (-731.243) [-731.278] -- 0:00:51
317500 -- (-728.489) (-739.062) [-731.201] (-732.162) * (-730.894) [-730.293] (-734.091) (-731.022) -- 0:00:51
318000 -- (-731.014) (-737.476) [-731.619] (-730.411) * (-731.924) (-729.721) [-733.292] (-732.991) -- 0:00:51
318500 -- (-731.220) [-733.048] (-730.895) (-731.791) * (-731.463) (-732.480) (-734.076) [-729.792] -- 0:00:51
319000 -- (-731.287) (-733.426) [-731.559] (-735.193) * (-732.341) (-734.153) (-733.636) [-733.821] -- 0:00:51
319500 -- (-730.000) (-732.321) [-731.106] (-733.136) * (-732.648) (-732.040) (-734.848) [-732.116] -- 0:00:51
320000 -- (-730.840) (-732.724) (-730.880) [-731.681] * (-733.543) [-733.550] (-734.395) (-736.774) -- 0:00:50
Average standard deviation of split frequencies: 0.011674
320500 -- [-736.891] (-734.412) (-730.818) (-735.478) * [-736.541] (-733.689) (-732.589) (-731.620) -- 0:00:50
321000 -- (-729.825) (-731.407) [-731.164] (-734.535) * (-735.571) (-730.462) (-733.115) [-733.961] -- 0:00:50
321500 -- (-730.815) (-732.032) [-733.256] (-732.868) * (-731.450) (-731.197) [-731.842] (-733.046) -- 0:00:50
322000 -- [-732.716] (-736.619) (-732.123) (-731.992) * (-730.330) [-731.494] (-731.768) (-732.039) -- 0:00:50
322500 -- [-731.073] (-732.824) (-731.344) (-732.555) * (-733.324) (-734.194) (-730.685) [-733.319] -- 0:00:50
323000 -- [-729.528] (-732.660) (-737.561) (-733.203) * [-732.025] (-730.557) (-733.805) (-733.432) -- 0:00:50
323500 -- (-731.991) [-731.676] (-732.843) (-735.017) * [-728.488] (-734.129) (-736.218) (-734.850) -- 0:00:50
324000 -- (-732.877) (-731.282) (-730.949) [-732.919] * [-734.300] (-735.423) (-737.170) (-730.669) -- 0:00:50
324500 -- (-731.685) [-731.812] (-731.332) (-733.560) * (-733.395) (-733.035) (-732.810) [-737.836] -- 0:00:49
325000 -- (-732.805) (-733.249) (-737.411) [-730.824] * (-730.661) (-732.465) [-731.361] (-732.076) -- 0:00:51
Average standard deviation of split frequencies: 0.010755
325500 -- (-733.842) (-731.969) [-732.446] (-729.888) * (-734.860) (-735.898) (-731.926) [-732.698] -- 0:00:51
326000 -- (-732.574) [-733.540] (-730.797) (-734.574) * (-739.480) (-730.924) (-731.947) [-735.177] -- 0:00:51
326500 -- (-731.515) [-733.018] (-731.118) (-733.302) * [-730.976] (-733.055) (-736.445) (-735.960) -- 0:00:51
327000 -- (-731.890) (-734.419) [-733.108] (-731.103) * [-732.236] (-735.138) (-732.117) (-732.670) -- 0:00:51
327500 -- (-730.109) (-733.603) (-734.772) [-731.194] * (-731.827) (-730.391) [-731.564] (-735.124) -- 0:00:51
328000 -- (-730.810) [-733.278] (-736.343) (-735.662) * (-732.224) [-730.929] (-734.587) (-735.528) -- 0:00:51
328500 -- (-732.652) (-734.089) (-733.348) [-731.076] * [-732.623] (-735.923) (-730.075) (-733.792) -- 0:00:51
329000 -- (-729.936) (-736.352) [-735.685] (-734.838) * (-733.583) (-731.070) (-735.224) [-731.988] -- 0:00:50
329500 -- (-732.328) (-735.481) [-735.215] (-732.765) * (-734.800) (-730.808) (-740.396) [-735.107] -- 0:00:50
330000 -- (-733.344) (-733.732) [-734.263] (-732.347) * (-734.618) (-732.195) [-733.091] (-732.129) -- 0:00:50
Average standard deviation of split frequencies: 0.011070
330500 -- (-735.919) (-731.938) (-731.369) [-732.159] * (-730.582) [-731.703] (-730.739) (-732.444) -- 0:00:50
331000 -- (-738.214) (-731.277) [-730.908] (-732.564) * (-740.107) (-732.708) (-732.365) [-731.676] -- 0:00:50
331500 -- (-733.699) (-736.141) [-731.976] (-733.456) * (-743.199) (-731.737) (-733.251) [-732.923] -- 0:00:50
332000 -- (-734.923) (-732.103) (-734.345) [-734.527] * (-732.241) (-738.675) [-731.848] (-736.545) -- 0:00:50
332500 -- [-732.225] (-730.953) (-735.726) (-732.006) * (-729.993) [-734.939] (-734.247) (-737.187) -- 0:00:50
333000 -- (-735.948) (-734.542) [-731.232] (-734.115) * (-734.457) (-732.916) (-732.916) [-734.373] -- 0:00:50
333500 -- (-732.264) [-738.239] (-733.930) (-730.552) * [-728.340] (-733.895) (-732.051) (-731.505) -- 0:00:49
334000 -- (-730.153) (-734.008) (-732.197) [-731.487] * (-732.055) (-734.183) (-731.516) [-729.116] -- 0:00:49
334500 -- (-730.249) [-733.925] (-733.319) (-732.848) * (-735.166) (-731.394) [-735.122] (-734.537) -- 0:00:49
335000 -- [-729.470] (-731.923) (-734.152) (-734.843) * (-731.116) (-734.338) [-732.776] (-732.710) -- 0:00:49
Average standard deviation of split frequencies: 0.009470
335500 -- (-733.653) (-731.848) [-731.654] (-731.962) * [-730.778] (-732.309) (-729.639) (-735.028) -- 0:00:49
336000 -- (-732.152) [-730.545] (-729.990) (-732.159) * [-733.922] (-734.989) (-732.487) (-731.580) -- 0:00:49
336500 -- (-733.663) (-732.389) [-732.589] (-737.225) * [-730.484] (-730.328) (-735.794) (-731.971) -- 0:00:49
337000 -- (-733.966) (-733.371) [-731.526] (-730.583) * (-738.415) (-730.798) [-733.139] (-734.898) -- 0:00:49
337500 -- (-733.206) (-731.358) (-734.919) [-730.967] * [-735.227] (-731.053) (-730.648) (-734.669) -- 0:00:49
338000 -- [-733.002] (-731.264) (-736.252) (-733.693) * (-732.466) (-732.651) [-731.938] (-734.401) -- 0:00:48
338500 -- (-732.543) (-735.681) [-735.030] (-731.707) * (-728.419) [-731.800] (-731.639) (-732.544) -- 0:00:50
339000 -- (-736.425) (-730.198) (-734.891) [-731.952] * [-730.959] (-731.144) (-732.356) (-735.081) -- 0:00:50
339500 -- (-733.155) (-731.124) (-733.003) [-736.086] * [-731.200] (-732.008) (-734.088) (-739.150) -- 0:00:50
340000 -- (-732.432) (-742.269) [-732.175] (-736.358) * (-734.041) [-736.079] (-731.739) (-737.732) -- 0:00:50
Average standard deviation of split frequencies: 0.009225
340500 -- (-731.751) [-730.653] (-731.549) (-736.547) * (-730.512) (-733.556) (-736.104) [-737.357] -- 0:00:50
341000 -- (-732.417) [-731.280] (-732.543) (-734.837) * (-733.296) (-731.617) (-731.807) [-737.261] -- 0:00:50
341500 -- (-728.868) (-732.357) (-729.881) [-731.811] * (-728.926) [-735.203] (-736.669) (-736.250) -- 0:00:50
342000 -- (-731.503) (-731.331) [-737.496] (-731.399) * (-731.820) [-730.619] (-735.738) (-734.742) -- 0:00:50
342500 -- (-733.926) (-731.116) (-737.168) [-731.518] * (-730.736) [-732.193] (-731.460) (-736.254) -- 0:00:49
343000 -- (-732.362) (-735.223) (-732.161) [-732.503] * (-731.509) [-733.458] (-734.776) (-733.240) -- 0:00:49
343500 -- (-730.250) (-735.607) [-732.368] (-731.381) * [-735.613] (-732.098) (-730.949) (-732.433) -- 0:00:49
344000 -- (-730.787) (-731.462) (-737.694) [-730.547] * (-735.081) (-732.319) [-730.939] (-734.633) -- 0:00:49
344500 -- [-730.536] (-733.718) (-730.122) (-734.609) * [-733.556] (-733.402) (-734.284) (-735.815) -- 0:00:49
345000 -- [-731.055] (-738.378) (-731.408) (-734.147) * [-731.916] (-729.590) (-729.858) (-735.802) -- 0:00:49
Average standard deviation of split frequencies: 0.011380
345500 -- [-730.266] (-731.021) (-733.153) (-731.547) * (-731.340) (-728.748) (-734.727) [-731.529] -- 0:00:49
346000 -- [-729.264] (-735.976) (-732.370) (-731.038) * (-731.545) (-733.337) (-734.147) [-734.807] -- 0:00:49
346500 -- (-732.105) (-738.194) [-731.029] (-729.612) * (-734.230) (-733.568) (-732.425) [-734.189] -- 0:00:49
347000 -- (-730.529) [-734.595] (-733.994) (-735.375) * (-730.917) (-730.302) [-734.828] (-732.271) -- 0:00:48
347500 -- (-732.887) (-734.956) (-731.164) [-733.478] * (-737.788) [-730.930] (-734.590) (-735.546) -- 0:00:48
348000 -- (-732.581) (-733.379) (-734.249) [-730.364] * (-731.310) (-735.333) [-732.272] (-736.080) -- 0:00:48
348500 -- [-731.205] (-735.633) (-734.060) (-732.625) * [-733.413] (-732.949) (-732.157) (-740.326) -- 0:00:48
349000 -- (-731.463) (-732.535) (-730.188) [-731.824] * (-734.261) (-735.423) (-735.631) [-735.538] -- 0:00:48
349500 -- (-738.217) (-734.035) [-732.809] (-730.294) * [-731.963] (-733.783) (-731.549) (-734.303) -- 0:00:48
350000 -- [-735.746] (-731.309) (-735.936) (-731.048) * (-733.228) [-734.314] (-733.163) (-733.881) -- 0:00:48
Average standard deviation of split frequencies: 0.009914
350500 -- (-730.543) [-734.495] (-729.744) (-732.170) * (-732.844) (-733.443) [-734.899] (-734.668) -- 0:00:48
351000 -- (-734.210) [-731.921] (-733.631) (-734.394) * (-733.816) [-736.385] (-733.086) (-735.740) -- 0:00:48
351500 -- [-735.689] (-735.275) (-733.135) (-732.697) * (-733.858) (-734.515) (-731.926) [-731.357] -- 0:00:47
352000 -- (-731.576) (-735.818) [-730.731] (-733.885) * (-732.806) (-736.396) [-735.604] (-732.396) -- 0:00:49
352500 -- (-730.142) (-734.609) [-729.930] (-730.677) * (-732.669) (-735.221) (-736.670) [-731.029] -- 0:00:49
353000 -- (-732.792) (-732.521) (-735.595) [-732.728] * (-733.370) (-733.817) (-734.451) [-731.434] -- 0:00:49
353500 -- (-733.360) [-732.108] (-736.636) (-732.044) * (-734.527) (-738.735) (-733.676) [-730.159] -- 0:00:49
354000 -- [-733.546] (-730.458) (-731.525) (-733.489) * (-735.985) (-735.381) [-732.636] (-732.298) -- 0:00:49
354500 -- (-733.850) (-730.818) (-729.934) [-732.394] * (-732.035) (-733.578) [-731.076] (-735.400) -- 0:00:49
355000 -- (-732.296) (-733.487) (-731.289) [-732.616] * (-734.132) [-733.988] (-732.074) (-737.989) -- 0:00:49
Average standard deviation of split frequencies: 0.009357
355500 -- [-731.790] (-733.369) (-729.265) (-732.033) * (-733.262) (-731.245) (-735.238) [-739.586] -- 0:00:48
356000 -- (-735.834) (-733.332) [-731.827] (-729.983) * (-736.720) (-732.196) (-733.763) [-735.056] -- 0:00:48
356500 -- (-730.042) (-735.554) (-734.501) [-729.888] * (-734.624) (-733.136) [-736.489] (-730.546) -- 0:00:48
357000 -- (-737.384) (-732.325) (-733.669) [-730.099] * [-738.202] (-733.614) (-731.821) (-735.405) -- 0:00:48
357500 -- (-732.111) [-733.863] (-731.597) (-731.503) * (-737.416) [-731.072] (-735.319) (-735.266) -- 0:00:48
358000 -- (-733.111) (-734.980) [-735.390] (-732.264) * (-734.910) (-732.777) [-735.797] (-735.589) -- 0:00:48
358500 -- (-730.793) [-734.296] (-733.754) (-734.442) * [-731.263] (-737.396) (-732.684) (-733.165) -- 0:00:48
359000 -- (-729.574) (-730.946) [-728.945] (-731.510) * (-731.762) [-731.144] (-733.368) (-734.659) -- 0:00:48
359500 -- (-730.455) [-731.482] (-731.595) (-732.174) * (-731.653) [-735.743] (-732.819) (-733.212) -- 0:00:48
360000 -- (-732.871) [-731.433] (-735.690) (-735.115) * (-730.577) [-735.632] (-733.390) (-732.513) -- 0:00:47
Average standard deviation of split frequencies: 0.009884
360500 -- (-733.864) (-730.710) [-735.643] (-733.383) * (-734.396) [-737.610] (-736.540) (-735.304) -- 0:00:47
361000 -- (-735.688) (-731.530) (-735.207) [-732.031] * (-734.223) (-733.851) [-731.526] (-731.853) -- 0:00:47
361500 -- (-732.735) [-730.691] (-729.222) (-732.823) * (-729.192) (-732.965) (-732.970) [-734.475] -- 0:00:47
362000 -- [-733.724] (-730.688) (-729.837) (-732.819) * (-732.598) [-734.708] (-731.658) (-736.085) -- 0:00:47
362500 -- (-734.113) [-730.407] (-731.952) (-733.452) * [-733.900] (-732.858) (-732.556) (-737.243) -- 0:00:47
363000 -- (-731.219) (-730.888) (-731.582) [-731.582] * [-729.799] (-735.538) (-737.146) (-733.610) -- 0:00:47
363500 -- (-735.241) (-732.565) (-731.959) [-732.234] * (-731.130) (-737.505) [-736.581] (-739.294) -- 0:00:47
364000 -- (-731.936) [-731.517] (-734.664) (-731.069) * [-731.617] (-733.708) (-732.924) (-739.968) -- 0:00:47
364500 -- (-730.800) [-732.811] (-732.098) (-731.775) * (-735.631) [-731.448] (-735.008) (-735.254) -- 0:00:47
365000 -- (-734.066) [-732.995] (-729.879) (-736.942) * (-734.274) [-733.722] (-735.962) (-737.455) -- 0:00:48
Average standard deviation of split frequencies: 0.009338
365500 -- [-732.780] (-734.025) (-732.618) (-737.615) * (-734.617) (-739.134) (-732.171) [-735.854] -- 0:00:48
366000 -- (-732.621) (-731.046) [-730.323] (-737.182) * (-736.760) (-734.700) (-731.653) [-733.301] -- 0:00:48
366500 -- [-734.427] (-736.644) (-729.947) (-729.633) * (-731.777) (-731.384) [-731.957] (-735.002) -- 0:00:48
367000 -- (-733.431) (-732.466) (-732.199) [-730.263] * (-731.527) [-733.076] (-736.203) (-738.609) -- 0:00:48
367500 -- (-731.137) (-733.384) [-733.554] (-730.472) * [-730.757] (-734.536) (-732.315) (-741.036) -- 0:00:48
368000 -- [-730.426] (-731.729) (-730.401) (-731.365) * [-729.846] (-735.710) (-729.379) (-740.156) -- 0:00:48
368500 -- (-729.725) [-728.637] (-731.013) (-731.054) * (-730.296) (-733.476) (-734.036) [-734.987] -- 0:00:47
369000 -- (-734.277) (-731.427) (-729.798) [-731.977] * [-729.963] (-734.697) (-730.171) (-738.461) -- 0:00:47
369500 -- [-729.793] (-731.454) (-737.783) (-730.161) * (-730.300) [-732.859] (-732.250) (-731.421) -- 0:00:47
370000 -- (-730.519) (-730.989) [-735.558] (-731.110) * (-730.893) [-732.927] (-734.369) (-736.555) -- 0:00:47
Average standard deviation of split frequencies: 0.009777
370500 -- [-731.488] (-735.479) (-730.522) (-732.383) * [-730.750] (-733.612) (-729.891) (-736.487) -- 0:00:47
371000 -- [-732.114] (-730.674) (-731.610) (-736.072) * (-732.443) (-734.013) [-733.904] (-732.370) -- 0:00:47
371500 -- [-738.984] (-734.857) (-731.697) (-730.654) * (-732.994) (-734.185) [-731.952] (-734.116) -- 0:00:47
372000 -- (-736.738) [-732.961] (-732.928) (-734.737) * (-731.623) (-735.241) (-733.563) [-732.287] -- 0:00:47
372500 -- (-735.933) [-732.780] (-731.946) (-732.132) * (-732.415) (-735.028) (-730.232) [-735.642] -- 0:00:47
373000 -- (-737.111) [-733.017] (-731.609) (-731.869) * (-734.919) (-734.746) (-730.834) [-734.303] -- 0:00:47
373500 -- (-731.756) [-731.588] (-732.008) (-738.950) * (-733.167) (-731.313) [-733.210] (-741.396) -- 0:00:46
374000 -- (-728.061) (-732.629) (-730.484) [-734.042] * (-734.999) [-731.977] (-734.773) (-732.869) -- 0:00:46
374500 -- (-731.928) [-738.953] (-731.396) (-734.332) * [-732.762] (-731.857) (-734.178) (-736.329) -- 0:00:46
375000 -- [-729.224] (-730.571) (-730.608) (-733.150) * (-732.481) (-730.458) (-734.345) [-734.379] -- 0:00:46
Average standard deviation of split frequencies: 0.009873
375500 -- (-732.964) (-730.836) [-730.382] (-730.931) * (-729.074) (-734.019) [-732.441] (-738.328) -- 0:00:46
376000 -- [-731.850] (-731.197) (-734.154) (-732.407) * (-732.985) (-735.940) (-734.020) [-732.726] -- 0:00:46
376500 -- (-730.866) (-739.091) (-735.493) [-732.317] * (-732.874) (-735.286) [-732.058] (-734.819) -- 0:00:46
377000 -- (-733.673) (-737.785) [-730.030] (-731.831) * [-733.585] (-736.473) (-735.223) (-732.404) -- 0:00:46
377500 -- [-729.394] (-730.883) (-731.754) (-730.540) * [-732.059] (-734.278) (-734.109) (-735.776) -- 0:00:46
378000 -- (-737.263) (-730.669) [-732.740] (-732.956) * (-732.274) [-735.151] (-731.150) (-731.340) -- 0:00:46
378500 -- (-737.575) [-732.660] (-733.957) (-731.758) * [-734.294] (-731.006) (-731.475) (-733.357) -- 0:00:47
379000 -- (-733.187) (-733.846) [-733.152] (-731.604) * (-734.090) (-734.605) [-734.528] (-740.216) -- 0:00:47
379500 -- (-731.270) (-732.279) [-733.008] (-733.751) * [-733.074] (-734.196) (-734.119) (-736.329) -- 0:00:47
380000 -- (-732.959) (-732.884) (-735.064) [-731.953] * (-734.952) (-730.862) (-732.581) [-733.190] -- 0:00:47
Average standard deviation of split frequencies: 0.010567
380500 -- [-730.756] (-731.204) (-734.863) (-731.338) * (-735.085) (-731.033) (-732.745) [-735.668] -- 0:00:47
381000 -- (-730.892) (-732.827) [-730.658] (-732.718) * (-735.073) (-733.499) [-734.750] (-731.569) -- 0:00:47
381500 -- [-730.770] (-731.623) (-734.770) (-731.227) * (-734.791) (-732.440) [-733.517] (-731.865) -- 0:00:47
382000 -- (-729.989) [-732.140] (-729.769) (-736.415) * (-731.999) (-732.724) (-731.081) [-730.807] -- 0:00:46
382500 -- (-732.062) (-730.724) (-732.850) [-732.158] * (-731.558) [-731.026] (-732.728) (-730.328) -- 0:00:46
383000 -- (-730.654) [-731.472] (-731.203) (-732.183) * (-735.225) (-732.030) (-734.287) [-730.165] -- 0:00:46
383500 -- [-733.022] (-731.643) (-734.178) (-731.204) * (-733.517) (-729.637) (-736.471) [-740.844] -- 0:00:46
384000 -- (-730.937) (-732.095) (-733.256) [-733.635] * [-733.063] (-731.208) (-737.988) (-740.382) -- 0:00:46
384500 -- (-732.276) [-732.487] (-733.093) (-737.635) * (-734.161) (-730.519) (-737.333) [-735.759] -- 0:00:46
385000 -- (-732.588) (-730.453) (-733.145) [-734.582] * (-730.604) (-731.247) (-740.440) [-736.930] -- 0:00:46
Average standard deviation of split frequencies: 0.010828
385500 -- (-733.026) (-730.068) [-734.657] (-730.204) * (-733.853) (-734.166) (-735.752) [-729.940] -- 0:00:46
386000 -- [-731.150] (-733.700) (-732.829) (-732.719) * (-733.074) (-734.986) [-734.972] (-728.501) -- 0:00:46
386500 -- [-732.849] (-729.948) (-734.183) (-732.165) * (-735.953) [-731.020] (-732.952) (-735.270) -- 0:00:46
387000 -- (-734.447) (-734.617) (-732.477) [-730.697] * [-730.926] (-731.400) (-738.371) (-734.628) -- 0:00:45
387500 -- [-734.433] (-735.484) (-731.589) (-731.208) * (-738.396) [-730.745] (-737.124) (-735.962) -- 0:00:45
388000 -- (-738.479) [-732.000] (-733.992) (-733.250) * (-734.530) [-731.443] (-734.739) (-735.548) -- 0:00:45
388500 -- (-732.412) [-732.136] (-735.316) (-729.634) * (-730.123) (-731.106) [-730.068] (-729.474) -- 0:00:45
389000 -- [-731.451] (-733.601) (-734.523) (-730.726) * [-732.861] (-732.871) (-734.698) (-728.924) -- 0:00:45
389500 -- [-729.960] (-733.125) (-734.257) (-731.503) * (-729.636) (-734.424) [-732.534] (-732.644) -- 0:00:45
390000 -- (-731.686) [-730.810] (-737.983) (-735.149) * (-730.118) (-732.235) [-731.561] (-735.090) -- 0:00:45
Average standard deviation of split frequencies: 0.011101
390500 -- (-730.811) [-729.572] (-733.465) (-733.303) * (-736.524) [-731.460] (-729.620) (-730.650) -- 0:00:45
391000 -- (-734.399) (-735.057) (-733.144) [-730.374] * (-734.578) (-734.732) [-731.616] (-731.273) -- 0:00:45
391500 -- [-730.116] (-731.888) (-729.694) (-731.042) * (-732.096) (-738.778) (-731.549) [-730.992] -- 0:00:46
392000 -- (-732.442) (-732.129) [-729.546] (-732.555) * [-730.634] (-733.819) (-731.269) (-733.550) -- 0:00:46
392500 -- [-729.154] (-731.481) (-732.795) (-733.382) * (-734.239) (-732.113) (-733.640) [-734.310] -- 0:00:46
393000 -- (-730.736) (-730.863) [-733.967] (-730.654) * (-732.563) (-732.783) [-732.957] (-731.173) -- 0:00:46
393500 -- (-737.014) (-732.167) [-729.327] (-732.858) * (-730.722) [-730.724] (-733.102) (-732.440) -- 0:00:46
394000 -- (-735.744) (-732.898) (-732.235) [-734.628] * (-730.698) (-731.508) (-730.536) [-730.897] -- 0:00:46
394500 -- [-734.819] (-730.929) (-736.034) (-730.382) * (-734.166) (-733.582) [-728.576] (-736.847) -- 0:00:46
395000 -- (-734.358) [-728.714] (-741.110) (-732.038) * [-732.386] (-729.417) (-731.122) (-729.803) -- 0:00:45
Average standard deviation of split frequencies: 0.011825
395500 -- (-732.339) [-729.392] (-733.083) (-732.524) * (-732.108) [-730.199] (-737.984) (-731.377) -- 0:00:45
396000 -- (-734.957) [-730.113] (-735.079) (-733.079) * (-732.026) (-734.027) [-731.509] (-733.870) -- 0:00:45
396500 -- (-738.431) (-732.227) (-737.023) [-730.534] * (-732.353) (-732.209) (-732.888) [-733.244] -- 0:00:45
397000 -- (-730.784) (-732.919) (-735.293) [-737.608] * (-733.874) (-733.147) (-735.102) [-732.771] -- 0:00:45
397500 -- (-730.983) (-729.742) [-735.499] (-734.417) * [-734.667] (-732.642) (-729.877) (-729.831) -- 0:00:45
398000 -- (-735.671) [-731.627] (-734.438) (-730.622) * (-733.386) (-733.389) [-731.692] (-735.784) -- 0:00:45
398500 -- [-730.297] (-730.408) (-732.661) (-735.451) * (-731.147) [-734.054] (-730.040) (-736.457) -- 0:00:45
399000 -- (-733.300) [-731.376] (-732.186) (-730.984) * [-732.010] (-733.085) (-729.500) (-730.741) -- 0:00:45
399500 -- (-736.634) (-737.474) [-736.040] (-732.855) * (-730.713) [-730.952] (-731.854) (-732.672) -- 0:00:45
400000 -- [-729.615] (-731.580) (-733.279) (-731.207) * (-730.721) (-732.131) [-729.677] (-729.647) -- 0:00:44
Average standard deviation of split frequencies: 0.011138
400500 -- (-731.819) (-732.944) [-730.324] (-732.536) * (-731.699) (-732.614) [-731.296] (-734.928) -- 0:00:44
401000 -- (-732.799) (-734.610) [-731.364] (-735.067) * [-733.434] (-734.945) (-729.342) (-731.725) -- 0:00:44
401500 -- (-731.437) [-731.502] (-733.005) (-737.876) * (-729.087) (-734.778) (-731.451) [-734.472] -- 0:00:44
402000 -- [-733.918] (-729.618) (-735.564) (-732.303) * (-733.073) [-730.700] (-728.696) (-732.027) -- 0:00:44
402500 -- (-738.487) [-729.577] (-734.083) (-737.511) * [-734.746] (-737.015) (-731.048) (-730.925) -- 0:00:44
403000 -- (-735.555) [-730.337] (-736.127) (-733.767) * (-736.894) (-734.097) [-732.083] (-731.582) -- 0:00:44
403500 -- [-731.617] (-732.802) (-732.248) (-733.324) * (-733.355) (-741.194) [-731.402] (-733.301) -- 0:00:44
404000 -- (-734.108) [-731.645] (-730.902) (-734.496) * [-733.522] (-733.430) (-730.992) (-732.638) -- 0:00:44
404500 -- (-731.014) (-735.598) (-730.045) [-730.411] * (-734.968) [-732.777] (-730.502) (-734.733) -- 0:00:44
405000 -- (-732.892) [-731.174] (-732.946) (-731.665) * [-733.931] (-730.870) (-732.038) (-730.714) -- 0:00:45
Average standard deviation of split frequencies: 0.011301
405500 -- (-731.840) [-730.431] (-734.776) (-736.138) * (-733.462) (-734.951) [-730.737] (-730.711) -- 0:00:45
406000 -- [-731.409] (-735.973) (-732.862) (-738.161) * (-730.972) (-732.710) [-729.238] (-732.068) -- 0:00:45
406500 -- (-732.570) [-730.886] (-730.741) (-731.963) * (-734.509) (-731.283) [-732.126] (-730.089) -- 0:00:45
407000 -- [-732.316] (-731.735) (-731.615) (-732.159) * (-731.268) (-730.994) [-733.448] (-733.078) -- 0:00:45
407500 -- (-733.894) (-733.706) (-737.113) [-732.782] * (-731.052) [-733.040] (-732.151) (-731.662) -- 0:00:45
408000 -- (-736.687) (-730.378) [-732.979] (-736.669) * (-732.163) (-731.475) [-731.907] (-730.965) -- 0:00:44
408500 -- (-733.478) (-739.546) (-732.520) [-731.466] * (-731.856) [-732.889] (-732.279) (-735.726) -- 0:00:44
409000 -- (-737.417) (-732.942) [-734.812] (-732.417) * (-730.886) [-736.003] (-738.040) (-733.116) -- 0:00:44
409500 -- (-732.788) (-730.511) [-730.227] (-732.398) * (-731.461) (-731.564) [-737.248] (-731.678) -- 0:00:44
410000 -- (-732.485) (-733.165) [-731.318] (-732.990) * (-733.088) (-732.754) [-732.756] (-731.784) -- 0:00:44
Average standard deviation of split frequencies: 0.010484
410500 -- [-730.502] (-732.234) (-731.806) (-737.343) * (-732.737) (-735.776) [-734.032] (-729.270) -- 0:00:44
411000 -- [-733.808] (-731.623) (-731.199) (-730.164) * (-734.278) (-732.932) (-731.986) [-732.069] -- 0:00:44
411500 -- (-731.869) (-732.117) (-732.425) [-731.326] * (-732.229) [-732.984] (-737.234) (-734.981) -- 0:00:44
412000 -- [-729.543] (-735.404) (-735.487) (-730.926) * (-732.387) [-732.925] (-732.782) (-734.555) -- 0:00:44
412500 -- (-729.175) [-732.912] (-733.522) (-736.280) * (-732.001) (-729.713) (-732.743) [-736.209] -- 0:00:44
413000 -- [-731.631] (-734.467) (-732.727) (-730.941) * [-732.254] (-730.069) (-734.692) (-731.697) -- 0:00:44
413500 -- [-732.171] (-732.839) (-735.565) (-736.752) * [-730.134] (-734.495) (-730.875) (-735.627) -- 0:00:43
414000 -- (-730.573) (-731.791) (-732.246) [-729.843] * [-736.083] (-731.408) (-730.143) (-734.661) -- 0:00:43
414500 -- (-732.754) (-733.128) [-735.670] (-731.858) * [-735.449] (-735.277) (-730.406) (-731.303) -- 0:00:43
415000 -- (-729.029) (-732.813) (-736.649) [-730.149] * (-734.419) (-730.748) [-732.219] (-736.678) -- 0:00:43
Average standard deviation of split frequencies: 0.010350
415500 -- (-732.531) [-737.369] (-734.817) (-731.915) * (-731.677) (-732.211) (-734.116) [-731.144] -- 0:00:43
416000 -- [-734.518] (-729.986) (-736.725) (-735.146) * (-735.121) (-737.107) [-730.573] (-732.398) -- 0:00:43
416500 -- (-734.354) [-729.518] (-732.202) (-735.337) * (-733.315) [-733.370] (-734.861) (-730.843) -- 0:00:43
417000 -- (-735.250) [-729.300] (-732.031) (-731.093) * (-732.670) [-735.164] (-736.924) (-732.924) -- 0:00:43
417500 -- (-733.970) (-733.725) (-732.207) [-731.910] * (-733.508) (-731.578) (-737.695) [-731.699] -- 0:00:43
418000 -- (-731.944) (-732.133) (-736.678) [-731.238] * (-735.776) [-730.671] (-731.207) (-732.187) -- 0:00:44
418500 -- (-732.713) (-732.600) [-732.681] (-734.114) * (-730.112) (-729.564) [-734.501] (-729.956) -- 0:00:44
419000 -- (-731.710) (-735.621) (-734.631) [-733.523] * [-733.429] (-730.620) (-734.819) (-735.258) -- 0:00:44
419500 -- (-732.856) [-730.610] (-731.774) (-732.203) * (-731.568) [-729.184] (-735.319) (-731.994) -- 0:00:44
420000 -- (-732.442) [-730.226] (-731.622) (-733.440) * [-730.660] (-730.011) (-732.327) (-730.824) -- 0:00:44
Average standard deviation of split frequencies: 0.009712
420500 -- [-732.490] (-735.076) (-733.011) (-731.753) * (-732.418) (-730.457) [-731.606] (-733.900) -- 0:00:44
421000 -- (-733.180) [-734.801] (-730.999) (-730.771) * (-730.471) [-733.448] (-733.848) (-731.412) -- 0:00:44
421500 -- (-732.650) [-731.485] (-732.568) (-731.385) * [-730.417] (-735.614) (-735.033) (-735.238) -- 0:00:43
422000 -- (-736.688) (-735.026) [-736.935] (-733.965) * (-730.907) (-735.776) [-732.749] (-736.375) -- 0:00:43
422500 -- (-733.368) (-732.230) [-735.743] (-730.363) * (-734.132) (-734.558) (-734.246) [-732.645] -- 0:00:43
423000 -- [-730.653] (-736.228) (-730.935) (-731.760) * (-729.626) (-731.732) (-734.550) [-735.791] -- 0:00:43
423500 -- [-735.205] (-730.924) (-733.337) (-729.883) * (-729.949) (-733.201) [-732.055] (-733.367) -- 0:00:43
424000 -- (-733.003) (-731.635) (-731.836) [-730.366] * (-732.689) [-733.376] (-733.198) (-733.168) -- 0:00:43
424500 -- (-731.981) (-734.033) (-732.346) [-729.686] * (-732.059) (-733.185) (-734.063) [-732.416] -- 0:00:43
425000 -- [-730.973] (-734.347) (-730.548) (-729.492) * (-735.017) (-731.914) [-733.292] (-731.962) -- 0:00:43
Average standard deviation of split frequencies: 0.009885
425500 -- (-734.182) (-735.425) (-737.494) [-730.895] * [-733.702] (-729.876) (-734.120) (-732.435) -- 0:00:43
426000 -- [-732.716] (-738.648) (-731.880) (-732.276) * [-732.934] (-729.564) (-732.691) (-734.643) -- 0:00:43
426500 -- (-729.725) (-732.388) [-731.600] (-734.880) * [-730.182] (-729.321) (-736.963) (-731.622) -- 0:00:43
427000 -- (-735.826) (-731.532) (-736.651) [-729.370] * (-733.892) [-729.442] (-731.850) (-734.431) -- 0:00:42
427500 -- (-730.550) (-734.700) [-732.270] (-736.766) * [-731.946] (-735.518) (-733.427) (-733.691) -- 0:00:42
428000 -- (-732.733) [-731.447] (-734.916) (-734.987) * (-729.414) [-730.279] (-733.090) (-732.665) -- 0:00:42
428500 -- (-730.579) [-731.937] (-731.894) (-734.790) * (-731.638) [-730.838] (-732.712) (-733.071) -- 0:00:42
429000 -- (-734.124) (-735.113) (-735.531) [-737.791] * (-735.023) (-731.485) [-731.745] (-737.109) -- 0:00:42
429500 -- (-730.804) (-731.619) [-733.259] (-733.814) * [-731.188] (-734.027) (-733.181) (-733.476) -- 0:00:42
430000 -- (-731.455) (-734.410) (-734.052) [-733.039] * (-736.802) (-734.847) [-731.366] (-734.167) -- 0:00:42
Average standard deviation of split frequencies: 0.009413
430500 -- (-737.044) (-731.818) (-736.940) [-729.491] * (-732.508) (-735.023) [-731.934] (-731.599) -- 0:00:42
431000 -- (-733.751) (-733.392) [-733.164] (-731.010) * (-738.090) [-732.285] (-733.445) (-734.772) -- 0:00:43
431500 -- (-735.701) (-735.792) (-732.319) [-732.903] * (-733.640) (-731.357) [-732.146] (-733.717) -- 0:00:43
432000 -- (-734.017) [-731.967] (-732.015) (-730.661) * (-735.156) [-730.867] (-731.452) (-733.177) -- 0:00:43
432500 -- [-731.195] (-731.978) (-731.242) (-732.065) * (-736.221) [-731.095] (-735.785) (-734.532) -- 0:00:43
433000 -- (-730.068) [-736.607] (-735.757) (-733.636) * (-734.093) (-737.159) [-732.454] (-736.394) -- 0:00:43
433500 -- [-732.217] (-733.827) (-732.466) (-733.768) * (-731.823) [-735.192] (-732.739) (-735.903) -- 0:00:43
434000 -- (-735.360) [-734.545] (-734.929) (-734.308) * [-731.100] (-732.057) (-730.631) (-736.734) -- 0:00:43
434500 -- (-736.666) (-735.388) [-732.324] (-737.901) * (-732.849) [-731.029] (-733.891) (-735.967) -- 0:00:42
435000 -- [-732.656] (-732.623) (-733.654) (-729.137) * (-736.609) (-731.231) (-732.515) [-735.069] -- 0:00:42
Average standard deviation of split frequencies: 0.008289
435500 -- (-730.483) (-735.080) [-733.054] (-737.463) * [-730.993] (-735.873) (-734.951) (-734.847) -- 0:00:42
436000 -- (-730.448) (-737.522) [-735.279] (-731.153) * (-731.326) (-735.729) (-737.425) [-734.457] -- 0:00:42
436500 -- (-736.047) (-731.883) [-734.506] (-735.901) * (-733.819) [-730.374] (-734.035) (-734.862) -- 0:00:42
437000 -- (-732.859) [-733.263] (-734.530) (-738.599) * [-734.557] (-731.116) (-734.667) (-734.624) -- 0:00:42
437500 -- (-737.039) [-733.319] (-732.340) (-731.212) * (-732.989) [-730.799] (-730.647) (-734.018) -- 0:00:42
438000 -- [-731.101] (-731.904) (-730.456) (-732.550) * (-735.031) (-734.460) (-732.548) [-733.679] -- 0:00:42
438500 -- [-730.866] (-733.152) (-731.669) (-732.186) * (-737.912) (-732.693) (-732.463) [-733.420] -- 0:00:42
439000 -- (-728.374) (-732.031) (-734.327) [-730.765] * [-733.005] (-731.067) (-733.674) (-732.146) -- 0:00:42
439500 -- (-735.022) (-737.063) [-730.824] (-732.982) * (-730.404) [-729.594] (-733.225) (-735.733) -- 0:00:42
440000 -- (-730.733) [-733.044] (-736.609) (-733.376) * (-732.052) (-730.578) [-734.435] (-735.043) -- 0:00:41
Average standard deviation of split frequencies: 0.008915
440500 -- (-730.547) (-735.724) [-731.548] (-730.672) * [-734.768] (-732.882) (-735.934) (-735.607) -- 0:00:41
441000 -- [-730.546] (-734.660) (-731.969) (-731.454) * (-730.387) [-733.116] (-733.254) (-734.000) -- 0:00:41
441500 -- [-736.419] (-732.872) (-733.024) (-732.827) * (-733.444) [-731.127] (-732.812) (-733.535) -- 0:00:41
442000 -- (-733.483) (-733.136) (-730.351) [-732.157] * (-736.657) [-732.769] (-733.904) (-734.102) -- 0:00:41
442500 -- (-732.803) (-732.706) (-731.230) [-730.404] * (-734.091) (-731.501) (-737.787) [-734.241] -- 0:00:41
443000 -- (-732.692) (-731.905) (-734.139) [-732.133] * (-736.147) (-733.187) (-733.097) [-729.660] -- 0:00:41
443500 -- (-735.966) (-735.752) (-733.116) [-733.196] * (-735.243) (-732.265) (-734.772) [-733.877] -- 0:00:41
444000 -- (-730.919) [-732.865] (-734.192) (-733.907) * (-731.887) (-731.209) [-732.663] (-732.416) -- 0:00:41
444500 -- (-734.013) (-730.690) (-731.634) [-734.508] * [-733.297] (-731.878) (-735.010) (-734.316) -- 0:00:42
445000 -- [-731.513] (-730.431) (-730.277) (-735.607) * [-734.299] (-732.847) (-733.337) (-733.117) -- 0:00:42
Average standard deviation of split frequencies: 0.009019
445500 -- (-733.509) (-729.985) [-730.602] (-732.984) * (-736.865) (-733.939) [-728.975] (-732.747) -- 0:00:42
446000 -- [-732.312] (-731.397) (-732.560) (-731.953) * (-734.776) [-732.029] (-729.637) (-736.189) -- 0:00:42
446500 -- (-731.416) (-735.143) [-734.243] (-735.792) * (-732.859) (-733.317) [-730.539] (-736.922) -- 0:00:42
447000 -- (-733.723) (-733.986) [-731.209] (-733.098) * [-732.822] (-734.099) (-730.900) (-732.665) -- 0:00:42
447500 -- (-730.746) [-731.944] (-732.536) (-733.794) * (-734.124) (-736.426) [-734.132] (-732.910) -- 0:00:41
448000 -- (-731.794) (-731.469) (-730.452) [-735.335] * (-735.503) (-736.801) [-738.093] (-735.415) -- 0:00:41
448500 -- (-731.668) (-730.713) [-732.213] (-737.343) * (-732.064) (-733.617) (-735.612) [-733.938] -- 0:00:41
449000 -- (-731.678) (-736.521) (-730.216) [-731.275] * (-732.950) (-732.934) (-731.853) [-730.795] -- 0:00:41
449500 -- [-731.705] (-731.055) (-737.045) (-730.404) * [-734.505] (-735.470) (-729.473) (-731.283) -- 0:00:41
450000 -- (-733.940) [-730.762] (-738.991) (-730.428) * (-736.966) (-737.946) (-733.879) [-733.582] -- 0:00:41
Average standard deviation of split frequencies: 0.009065
450500 -- (-735.100) (-735.431) (-731.443) [-731.557] * [-732.935] (-740.004) (-734.530) (-729.664) -- 0:00:41
451000 -- (-734.279) (-737.243) (-735.947) [-729.805] * (-733.057) (-736.580) [-734.005] (-731.835) -- 0:00:41
451500 -- (-732.834) (-730.384) (-737.214) [-731.487] * [-731.426] (-732.134) (-734.504) (-731.209) -- 0:00:41
452000 -- (-734.858) (-732.458) (-739.456) [-734.433] * (-732.676) (-741.350) [-730.717] (-731.960) -- 0:00:41
452500 -- (-734.323) [-729.865] (-732.487) (-734.729) * (-731.619) (-730.228) [-735.556] (-729.887) -- 0:00:41
453000 -- (-729.921) [-731.626] (-731.555) (-733.987) * (-734.889) [-737.505] (-733.058) (-733.175) -- 0:00:41
453500 -- [-731.852] (-730.502) (-730.534) (-737.849) * (-732.935) (-733.498) [-732.142] (-731.503) -- 0:00:40
454000 -- (-734.456) (-731.626) (-736.277) [-733.433] * [-734.060] (-733.052) (-730.312) (-730.778) -- 0:00:40
454500 -- (-732.456) (-731.076) (-729.319) [-735.405] * (-739.045) (-732.243) [-731.103] (-730.581) -- 0:00:40
455000 -- (-731.491) [-732.484] (-732.900) (-733.280) * (-734.641) [-733.205] (-735.250) (-730.765) -- 0:00:40
Average standard deviation of split frequencies: 0.008546
455500 -- (-731.637) [-734.053] (-731.872) (-734.706) * [-732.222] (-732.091) (-734.782) (-731.176) -- 0:00:40
456000 -- (-733.720) (-732.552) (-731.104) [-731.267] * [-734.165] (-735.039) (-733.112) (-734.086) -- 0:00:40
456500 -- (-731.728) [-731.102] (-731.335) (-731.998) * (-734.121) [-729.714] (-732.053) (-731.194) -- 0:00:40
457000 -- (-730.676) [-732.164] (-731.984) (-732.530) * (-730.384) (-733.201) (-732.980) [-733.323] -- 0:00:40
457500 -- (-732.363) (-734.046) (-733.475) [-731.591] * (-733.737) (-731.188) (-732.884) [-735.377] -- 0:00:41
458000 -- [-730.966] (-732.870) (-732.569) (-734.969) * (-736.259) (-733.952) [-733.955] (-731.331) -- 0:00:41
458500 -- [-730.048] (-731.232) (-736.232) (-733.063) * [-729.677] (-735.607) (-738.735) (-730.910) -- 0:00:41
459000 -- (-732.995) [-730.495] (-733.625) (-733.507) * (-731.064) (-731.858) [-732.119] (-729.536) -- 0:00:41
459500 -- (-733.256) (-730.445) [-734.270] (-734.017) * (-733.448) (-733.694) (-732.181) [-733.524] -- 0:00:41
460000 -- (-731.979) (-732.071) (-733.962) [-734.022] * (-737.360) [-731.617] (-740.007) (-729.553) -- 0:00:41
Average standard deviation of split frequencies: 0.008323
460500 -- (-733.545) (-732.306) (-731.888) [-731.936] * [-730.495] (-733.419) (-736.107) (-731.657) -- 0:00:41
461000 -- (-730.518) (-733.133) (-735.906) [-731.984] * (-730.547) (-733.016) (-733.665) [-731.907] -- 0:00:40
461500 -- [-730.231] (-732.299) (-734.905) (-731.225) * (-732.264) (-732.352) (-734.940) [-733.565] -- 0:00:40
462000 -- [-730.586] (-729.932) (-736.960) (-731.634) * (-735.862) [-733.228] (-734.843) (-732.968) -- 0:00:40
462500 -- (-731.534) (-730.570) [-732.544] (-733.658) * [-735.060] (-731.146) (-732.566) (-730.437) -- 0:00:40
463000 -- [-729.831] (-733.538) (-730.969) (-730.402) * (-732.191) [-732.330] (-731.446) (-731.346) -- 0:00:40
463500 -- (-730.757) (-733.235) (-737.150) [-733.483] * (-731.666) [-730.212] (-732.318) (-732.132) -- 0:00:40
464000 -- (-729.325) [-731.601] (-734.119) (-730.588) * (-732.232) (-734.253) (-732.755) [-733.781] -- 0:00:40
464500 -- (-731.364) (-734.745) [-729.471] (-738.033) * (-730.480) (-732.567) [-734.719] (-734.225) -- 0:00:40
465000 -- (-729.242) (-732.996) [-732.556] (-735.666) * (-729.981) (-737.104) (-733.813) [-734.561] -- 0:00:40
Average standard deviation of split frequencies: 0.008295
465500 -- [-728.855] (-730.880) (-731.331) (-731.959) * [-731.558] (-733.873) (-734.310) (-729.163) -- 0:00:40
466000 -- (-731.791) (-735.041) [-730.958] (-733.913) * (-729.397) [-732.438] (-735.860) (-732.146) -- 0:00:40
466500 -- (-734.754) (-734.528) (-734.933) [-731.714] * (-731.857) (-734.433) (-733.540) [-733.204] -- 0:00:40
467000 -- [-736.047] (-732.059) (-733.591) (-733.475) * (-735.797) (-732.093) (-732.420) [-733.979] -- 0:00:39
467500 -- (-730.104) (-736.195) (-734.100) [-734.918] * (-736.738) [-734.800] (-732.646) (-734.601) -- 0:00:39
468000 -- (-731.896) (-733.109) (-732.382) [-734.216] * [-730.102] (-732.477) (-733.918) (-734.410) -- 0:00:39
468500 -- (-732.275) (-732.102) [-732.913] (-733.468) * [-733.656] (-731.459) (-734.804) (-736.699) -- 0:00:39
469000 -- [-730.975] (-734.032) (-733.710) (-733.324) * (-733.664) (-731.545) (-730.773) [-732.606] -- 0:00:39
469500 -- (-732.136) (-730.051) (-736.620) [-732.522] * (-732.603) [-732.639] (-735.159) (-732.491) -- 0:00:39
470000 -- (-731.133) (-732.309) [-736.487] (-733.922) * (-730.864) [-728.743] (-731.322) (-732.010) -- 0:00:39
Average standard deviation of split frequencies: 0.007812
470500 -- [-731.058] (-731.431) (-734.825) (-738.620) * (-731.389) (-732.611) (-733.282) [-729.972] -- 0:00:39
471000 -- (-730.971) [-730.192] (-734.431) (-732.517) * (-732.126) [-733.187] (-735.493) (-732.957) -- 0:00:40
471500 -- (-740.896) (-731.206) [-734.551] (-734.429) * (-730.568) (-732.850) [-733.609] (-732.743) -- 0:00:40
472000 -- (-733.573) (-733.703) (-735.124) [-731.763] * [-733.276] (-729.990) (-732.840) (-734.914) -- 0:00:40
472500 -- (-733.237) (-731.570) [-734.224] (-733.500) * (-733.531) (-732.529) (-732.938) [-731.682] -- 0:00:40
473000 -- [-730.374] (-730.656) (-733.100) (-730.756) * (-734.027) [-729.805] (-737.206) (-733.146) -- 0:00:40
473500 -- (-734.814) (-731.072) (-736.249) [-730.654] * (-734.751) [-732.226] (-737.289) (-732.779) -- 0:00:40
474000 -- [-729.749] (-733.215) (-732.719) (-731.874) * (-733.000) [-731.393] (-732.378) (-733.145) -- 0:00:39
474500 -- (-736.561) (-728.915) (-733.400) [-732.560] * [-731.579] (-731.135) (-732.487) (-734.085) -- 0:00:39
475000 -- (-731.737) (-729.807) [-733.306] (-736.631) * (-732.813) [-731.625] (-731.247) (-733.604) -- 0:00:39
Average standard deviation of split frequencies: 0.007791
475500 -- (-737.057) (-730.784) [-734.737] (-735.071) * (-729.796) (-732.002) [-732.802] (-734.561) -- 0:00:39
476000 -- (-738.006) (-735.805) [-732.591] (-734.259) * (-733.042) [-733.577] (-732.567) (-733.629) -- 0:00:39
476500 -- (-730.945) [-733.987] (-738.954) (-736.416) * [-734.416] (-734.883) (-730.272) (-731.477) -- 0:00:39
477000 -- (-733.743) (-731.982) [-739.371] (-734.051) * (-731.789) (-732.537) [-730.855] (-734.162) -- 0:00:39
477500 -- [-732.298] (-734.900) (-739.706) (-741.009) * (-733.307) (-733.183) (-730.693) [-735.896] -- 0:00:39
478000 -- (-734.172) [-731.525] (-732.374) (-732.608) * (-734.010) [-732.782] (-730.389) (-739.417) -- 0:00:39
478500 -- [-734.213] (-733.176) (-731.044) (-730.853) * (-731.222) (-739.325) [-731.979] (-730.869) -- 0:00:39
479000 -- (-733.299) (-730.167) (-733.079) [-731.426] * [-733.204] (-736.934) (-735.945) (-731.400) -- 0:00:39
479500 -- (-735.087) (-729.043) [-734.019] (-732.488) * (-735.763) (-736.003) (-737.399) [-732.767] -- 0:00:39
480000 -- (-732.915) (-731.981) (-738.843) [-731.686] * (-735.396) [-730.875] (-735.386) (-735.523) -- 0:00:39
Average standard deviation of split frequencies: 0.007846
480500 -- (-732.005) [-731.995] (-735.929) (-731.842) * [-733.349] (-730.432) (-734.026) (-731.741) -- 0:00:38
481000 -- [-732.972] (-733.495) (-736.117) (-733.121) * (-734.039) (-730.104) [-730.336] (-729.996) -- 0:00:38
481500 -- (-736.018) [-730.187] (-730.748) (-731.914) * (-733.934) (-734.194) (-731.580) [-735.527] -- 0:00:38
482000 -- (-734.805) [-733.972] (-734.074) (-733.988) * (-732.136) [-731.707] (-730.792) (-734.212) -- 0:00:38
482500 -- [-734.416] (-730.395) (-733.944) (-736.298) * (-735.840) (-731.918) (-729.726) [-733.598] -- 0:00:38
483000 -- (-734.809) (-733.384) [-734.049] (-732.306) * (-733.325) (-732.945) (-732.536) [-733.891] -- 0:00:38
483500 -- (-732.607) (-732.979) [-739.309] (-731.023) * [-734.546] (-733.143) (-742.244) (-733.988) -- 0:00:38
484000 -- (-732.582) [-731.359] (-737.034) (-732.944) * (-732.061) [-731.169] (-732.046) (-735.808) -- 0:00:38
484500 -- (-733.350) (-729.625) [-735.885] (-731.568) * (-735.071) (-731.264) [-731.472] (-735.377) -- 0:00:39
485000 -- (-731.002) [-729.837] (-736.096) (-734.102) * [-736.440] (-734.131) (-730.393) (-731.747) -- 0:00:39
Average standard deviation of split frequencies: 0.007695
485500 -- (-734.093) (-730.480) [-732.874] (-733.234) * (-735.247) (-730.542) [-732.512] (-732.502) -- 0:00:39
486000 -- (-736.550) [-730.857] (-736.138) (-731.734) * (-734.347) (-742.666) [-732.752] (-731.603) -- 0:00:39
486500 -- (-732.552) [-729.736] (-731.699) (-733.306) * [-736.572] (-731.148) (-733.935) (-732.414) -- 0:00:39
487000 -- (-734.502) (-731.911) [-731.208] (-735.469) * (-731.576) [-733.919] (-732.596) (-731.992) -- 0:00:38
487500 -- (-734.920) [-732.993] (-736.346) (-738.431) * (-732.554) (-735.129) (-732.326) [-730.988] -- 0:00:38
488000 -- (-737.685) (-732.975) [-733.075] (-735.370) * (-733.079) [-732.594] (-732.416) (-731.058) -- 0:00:38
488500 -- (-734.145) [-729.873] (-734.804) (-732.320) * (-733.702) (-734.663) [-734.280] (-730.711) -- 0:00:38
489000 -- (-732.472) (-732.497) (-734.076) [-733.051] * (-734.634) (-731.242) [-730.707] (-733.165) -- 0:00:38
489500 -- (-730.061) (-731.414) [-738.693] (-730.528) * [-733.176] (-733.621) (-731.003) (-737.801) -- 0:00:38
490000 -- [-732.085] (-730.818) (-731.502) (-730.382) * (-734.552) [-733.069] (-732.522) (-735.613) -- 0:00:38
Average standard deviation of split frequencies: 0.006917
490500 -- (-733.007) (-731.850) (-737.106) [-731.310] * (-731.780) (-730.858) [-735.288] (-734.546) -- 0:00:38
491000 -- [-734.578] (-733.908) (-739.904) (-731.707) * [-733.691] (-734.076) (-732.814) (-730.262) -- 0:00:38
491500 -- (-732.253) [-734.923] (-737.121) (-738.655) * (-733.043) (-734.695) (-733.538) [-733.410] -- 0:00:38
492000 -- (-733.699) (-731.664) [-732.900] (-736.595) * (-731.187) (-735.217) [-736.351] (-734.972) -- 0:00:38
492500 -- [-733.290] (-736.732) (-729.827) (-732.013) * (-732.320) [-733.153] (-735.767) (-732.339) -- 0:00:38
493000 -- [-732.636] (-732.362) (-733.388) (-730.667) * [-734.142] (-729.969) (-732.333) (-731.566) -- 0:00:38
493500 -- (-734.645) (-729.443) [-735.061] (-730.799) * (-732.255) (-738.548) (-736.682) [-730.819] -- 0:00:37
494000 -- (-731.433) (-732.792) [-733.758] (-735.613) * (-732.814) (-732.956) [-734.882] (-729.547) -- 0:00:37
494500 -- (-732.463) (-730.859) (-732.416) [-734.752] * [-733.236] (-734.539) (-732.399) (-732.494) -- 0:00:37
495000 -- (-733.655) (-731.274) (-736.316) [-732.362] * [-734.995] (-734.794) (-731.941) (-732.691) -- 0:00:37
Average standard deviation of split frequencies: 0.007366
495500 -- (-734.777) (-730.528) [-733.732] (-730.095) * (-730.275) [-735.083] (-736.295) (-734.046) -- 0:00:37
496000 -- [-732.988] (-729.782) (-732.626) (-730.191) * (-731.848) (-733.604) (-731.984) [-736.050] -- 0:00:37
496500 -- (-730.621) [-730.698] (-734.362) (-731.526) * (-730.281) [-730.893] (-732.083) (-739.390) -- 0:00:37
497000 -- (-732.871) [-734.636] (-731.682) (-731.282) * (-731.179) (-732.913) [-732.540] (-735.618) -- 0:00:37
497500 -- [-732.018] (-730.319) (-731.171) (-734.319) * [-730.023] (-734.543) (-735.999) (-741.948) -- 0:00:38
498000 -- [-731.836] (-729.703) (-731.519) (-732.070) * (-735.263) (-731.263) [-734.152] (-732.322) -- 0:00:38
498500 -- (-730.750) (-731.373) [-732.755] (-732.379) * [-730.188] (-731.512) (-730.523) (-731.633) -- 0:00:38
499000 -- [-732.561] (-732.904) (-730.701) (-729.365) * (-732.063) (-733.025) (-731.101) [-730.563] -- 0:00:38
499500 -- (-737.592) [-734.665] (-734.290) (-732.415) * (-731.301) (-739.786) [-730.287] (-730.094) -- 0:00:38
500000 -- (-732.912) (-738.610) [-733.688] (-731.777) * [-733.340] (-733.784) (-734.408) (-739.658) -- 0:00:38
Average standard deviation of split frequencies: 0.007219
500500 -- (-734.597) [-729.825] (-733.204) (-730.862) * (-736.979) (-734.786) [-731.453] (-732.636) -- 0:00:37
501000 -- [-731.343] (-736.616) (-733.081) (-733.408) * (-732.410) (-731.740) [-731.741] (-734.783) -- 0:00:37
501500 -- (-734.568) [-731.945] (-730.364) (-736.151) * (-731.289) [-731.227] (-732.360) (-731.387) -- 0:00:37
502000 -- (-730.346) (-734.930) [-730.852] (-731.539) * (-731.549) [-739.136] (-734.949) (-731.939) -- 0:00:37
502500 -- (-730.193) (-729.153) [-730.293] (-732.701) * (-732.883) [-735.247] (-739.991) (-732.314) -- 0:00:37
503000 -- (-729.762) (-729.593) [-732.851] (-730.756) * (-734.223) (-743.621) (-734.055) [-729.995] -- 0:00:37
503500 -- [-732.250] (-732.446) (-736.310) (-731.365) * (-734.297) (-734.852) [-733.404] (-731.163) -- 0:00:37
504000 -- (-734.183) [-731.636] (-733.953) (-732.644) * (-729.832) (-740.351) (-734.776) [-733.119] -- 0:00:37
504500 -- (-732.399) (-730.591) [-731.924] (-736.495) * (-731.883) [-732.407] (-730.768) (-731.104) -- 0:00:37
505000 -- (-733.138) (-734.972) [-738.641] (-733.024) * (-732.410) (-732.861) [-740.067] (-734.091) -- 0:00:37
Average standard deviation of split frequencies: 0.007337
505500 -- (-731.360) [-733.897] (-736.605) (-730.769) * (-732.018) [-736.102] (-734.371) (-729.854) -- 0:00:37
506000 -- [-731.741] (-730.591) (-731.643) (-732.378) * (-733.129) (-732.765) [-734.669] (-734.945) -- 0:00:37
506500 -- [-734.578] (-734.362) (-736.427) (-734.695) * (-732.241) (-736.371) [-732.446] (-731.689) -- 0:00:37
507000 -- [-735.672] (-733.114) (-736.477) (-733.018) * (-731.854) [-731.112] (-731.682) (-734.267) -- 0:00:36
507500 -- [-733.629] (-732.862) (-732.886) (-733.886) * (-731.512) (-734.160) [-734.758] (-732.439) -- 0:00:36
508000 -- (-732.925) [-729.525] (-736.034) (-734.632) * (-733.158) (-730.396) (-731.232) [-731.898] -- 0:00:36
508500 -- (-731.623) [-732.853] (-732.465) (-732.567) * (-736.735) [-730.595] (-733.726) (-731.382) -- 0:00:36
509000 -- (-732.190) (-730.968) [-737.230] (-733.543) * (-740.893) (-731.818) (-729.069) [-731.037] -- 0:00:36
509500 -- (-734.550) (-733.781) (-733.023) [-730.609] * (-733.197) (-735.074) [-730.830] (-733.358) -- 0:00:36
510000 -- (-732.159) [-732.715] (-730.384) (-731.387) * [-735.805] (-733.389) (-729.872) (-736.964) -- 0:00:36
Average standard deviation of split frequencies: 0.007616
510500 -- (-734.744) [-731.109] (-732.496) (-732.146) * (-732.999) (-731.936) (-729.278) [-732.627] -- 0:00:36
511000 -- [-733.525] (-735.661) (-731.776) (-731.331) * (-733.876) [-734.280] (-729.960) (-732.883) -- 0:00:37
511500 -- (-732.158) (-731.466) (-734.934) [-732.096] * [-734.617] (-731.533) (-736.964) (-731.539) -- 0:00:37
512000 -- (-732.918) [-732.445] (-731.797) (-733.435) * (-734.120) (-732.056) [-732.362] (-737.226) -- 0:00:37
512500 -- (-730.520) [-731.885] (-735.027) (-733.924) * [-732.233] (-731.306) (-730.738) (-732.228) -- 0:00:37
513000 -- (-730.865) (-733.565) [-732.311] (-734.314) * [-730.790] (-731.023) (-728.595) (-730.115) -- 0:00:37
513500 -- (-731.313) (-735.113) (-731.599) [-732.618] * (-737.082) (-731.306) [-731.072] (-731.601) -- 0:00:36
514000 -- (-731.658) (-733.776) [-734.405] (-733.042) * (-731.496) [-730.235] (-732.579) (-733.114) -- 0:00:36
514500 -- (-734.251) [-731.759] (-732.413) (-731.120) * (-729.196) [-733.430] (-731.033) (-733.068) -- 0:00:36
515000 -- [-734.769] (-730.725) (-734.998) (-735.583) * (-730.231) (-731.582) [-729.815] (-732.881) -- 0:00:36
Average standard deviation of split frequencies: 0.007370
515500 -- (-737.888) [-735.032] (-734.977) (-738.195) * (-730.953) (-731.028) [-733.946] (-732.490) -- 0:00:36
516000 -- (-731.047) [-733.048] (-734.851) (-736.532) * (-730.981) (-729.613) (-733.397) [-730.482] -- 0:00:36
516500 -- [-734.346] (-740.248) (-736.637) (-735.506) * (-733.080) (-729.807) [-732.648] (-733.313) -- 0:00:36
517000 -- [-733.873] (-736.191) (-737.522) (-732.062) * (-735.900) (-731.848) (-733.422) [-734.173] -- 0:00:36
517500 -- (-732.721) [-731.826] (-731.721) (-731.966) * (-729.675) [-728.926] (-733.834) (-734.834) -- 0:00:36
518000 -- [-730.006] (-731.336) (-733.103) (-733.046) * (-732.612) (-732.157) (-736.649) [-734.929] -- 0:00:36
518500 -- (-733.410) [-730.600] (-731.971) (-732.686) * (-735.921) (-733.617) [-732.457] (-731.970) -- 0:00:36
519000 -- (-734.371) (-731.268) (-732.091) [-732.247] * (-732.762) (-731.505) [-734.637] (-730.647) -- 0:00:36
519500 -- (-734.428) (-735.778) (-733.250) [-731.993] * (-734.714) [-729.562] (-732.580) (-732.975) -- 0:00:36
520000 -- (-734.813) [-733.587] (-737.681) (-740.472) * (-731.808) [-729.122] (-732.330) (-731.330) -- 0:00:36
Average standard deviation of split frequencies: 0.007485
520500 -- (-737.010) (-730.935) (-732.082) [-738.638] * (-730.627) (-730.574) (-731.059) [-730.542] -- 0:00:35
521000 -- [-732.939] (-732.104) (-730.362) (-737.027) * [-733.190] (-731.629) (-735.193) (-732.017) -- 0:00:35
521500 -- (-734.908) [-730.373] (-731.303) (-736.542) * (-733.638) (-729.235) (-733.403) [-732.193] -- 0:00:35
522000 -- (-734.836) [-730.613] (-733.068) (-734.637) * (-733.034) (-732.200) [-735.288] (-733.447) -- 0:00:35
522500 -- (-735.847) [-730.824] (-732.637) (-737.176) * (-730.920) [-732.230] (-731.818) (-733.257) -- 0:00:35
523000 -- (-733.921) (-730.703) [-731.787] (-735.472) * (-737.195) (-733.339) [-734.317] (-731.349) -- 0:00:35
523500 -- (-731.400) [-733.597] (-729.506) (-735.322) * [-735.616] (-734.746) (-734.591) (-731.347) -- 0:00:35
524000 -- [-731.253] (-731.910) (-733.507) (-737.960) * [-733.310] (-732.621) (-734.528) (-733.501) -- 0:00:35
524500 -- (-732.760) (-730.649) (-732.340) [-738.520] * (-731.089) [-735.672] (-732.903) (-730.468) -- 0:00:36
525000 -- (-735.392) [-729.901] (-731.984) (-731.711) * (-734.487) (-734.909) (-729.769) [-732.162] -- 0:00:36
Average standard deviation of split frequencies: 0.006931
525500 -- (-736.087) (-731.034) [-731.028] (-733.439) * (-739.766) (-732.570) [-734.823] (-735.149) -- 0:00:36
526000 -- (-732.905) [-732.410] (-732.052) (-732.989) * [-734.290] (-734.538) (-732.676) (-735.193) -- 0:00:36
526500 -- (-730.618) (-730.610) (-734.116) [-730.981] * (-732.680) (-735.326) (-732.090) [-733.324] -- 0:00:35
527000 -- (-739.628) (-732.715) [-736.988] (-736.701) * [-733.309] (-732.749) (-736.324) (-733.640) -- 0:00:35
527500 -- (-741.537) [-731.678] (-736.876) (-734.425) * (-730.335) (-729.914) (-735.865) [-733.169] -- 0:00:35
528000 -- (-736.718) [-733.458] (-738.111) (-734.708) * (-730.208) (-735.748) (-731.249) [-733.134] -- 0:00:35
528500 -- (-733.700) [-731.501] (-737.911) (-729.029) * (-730.631) (-731.997) [-731.064] (-733.330) -- 0:00:35
529000 -- (-732.047) [-730.072] (-736.320) (-732.093) * [-732.037] (-729.257) (-730.999) (-731.322) -- 0:00:35
529500 -- (-733.494) (-734.645) [-733.189] (-730.569) * [-734.429] (-734.228) (-732.809) (-734.548) -- 0:00:35
530000 -- (-730.969) (-734.089) [-732.450] (-729.541) * [-733.034] (-733.502) (-732.522) (-732.269) -- 0:00:35
Average standard deviation of split frequencies: 0.007521
530500 -- (-734.683) [-729.792] (-732.673) (-733.663) * [-736.765] (-731.255) (-732.236) (-733.241) -- 0:00:35
531000 -- (-731.284) (-730.542) [-730.940] (-730.734) * (-734.100) [-733.465] (-730.024) (-731.289) -- 0:00:35
531500 -- (-735.684) [-733.891] (-734.980) (-736.617) * (-729.788) (-733.692) (-735.148) [-730.378] -- 0:00:35
532000 -- (-731.180) [-732.498] (-733.313) (-735.275) * (-729.415) [-731.228] (-737.282) (-729.831) -- 0:00:35
532500 -- [-732.387] (-733.192) (-733.416) (-733.830) * (-731.789) [-732.520] (-732.908) (-731.412) -- 0:00:35
533000 -- (-732.125) (-733.983) (-733.386) [-738.931] * (-731.121) [-734.582] (-732.847) (-732.954) -- 0:00:35
533500 -- (-739.936) (-731.131) (-739.101) [-734.943] * [-732.691] (-730.970) (-733.341) (-736.034) -- 0:00:34
534000 -- (-731.486) (-734.927) (-735.488) [-730.893] * (-733.073) [-731.805] (-732.490) (-734.521) -- 0:00:34
534500 -- (-734.335) (-734.509) [-731.819] (-736.324) * [-730.317] (-731.206) (-733.986) (-730.233) -- 0:00:34
535000 -- (-735.328) (-734.194) [-731.460] (-733.451) * (-729.803) (-732.728) (-730.439) [-731.742] -- 0:00:34
Average standard deviation of split frequencies: 0.007564
535500 -- [-731.343] (-735.630) (-739.160) (-732.846) * (-737.589) (-732.495) [-730.965] (-731.376) -- 0:00:34
536000 -- (-732.790) (-736.400) [-737.212] (-735.702) * [-732.850] (-731.600) (-733.514) (-730.744) -- 0:00:34
536500 -- (-733.709) (-731.551) (-732.515) [-736.227] * [-734.109] (-730.435) (-733.781) (-731.655) -- 0:00:34
537000 -- [-732.959] (-733.993) (-731.871) (-736.267) * (-730.374) (-730.493) (-732.611) [-733.891] -- 0:00:34
537500 -- (-732.793) (-734.524) [-730.649] (-730.264) * (-732.924) (-733.822) (-734.459) [-731.055] -- 0:00:35
538000 -- (-732.325) (-733.233) (-732.471) [-735.903] * [-730.059] (-731.479) (-732.557) (-731.038) -- 0:00:35
538500 -- (-732.353) (-734.157) [-733.042] (-737.221) * (-729.945) [-733.186] (-734.312) (-732.449) -- 0:00:35
539000 -- (-733.315) (-733.871) [-733.243] (-732.982) * [-731.309] (-735.345) (-731.496) (-730.860) -- 0:00:35
539500 -- [-737.417] (-735.501) (-733.621) (-731.504) * [-736.137] (-737.410) (-732.500) (-730.731) -- 0:00:34
540000 -- (-733.725) (-731.124) [-730.853] (-731.202) * [-733.241] (-732.896) (-734.460) (-733.510) -- 0:00:34
Average standard deviation of split frequencies: 0.007382
540500 -- (-734.137) (-734.553) [-730.170] (-733.388) * [-729.403] (-737.526) (-732.925) (-729.696) -- 0:00:34
541000 -- (-730.633) [-732.912] (-731.545) (-735.961) * [-732.097] (-733.570) (-731.243) (-734.304) -- 0:00:34
541500 -- (-731.346) (-734.113) [-731.320] (-735.362) * (-731.867) [-730.361] (-730.741) (-733.947) -- 0:00:34
542000 -- (-736.425) [-734.122] (-732.542) (-733.459) * (-732.460) (-733.438) (-732.550) [-733.260] -- 0:00:34
542500 -- (-735.481) (-733.673) [-732.096] (-732.372) * (-734.843) (-734.313) [-731.271] (-736.168) -- 0:00:34
543000 -- (-732.084) (-731.570) (-734.003) [-733.659] * (-734.437) (-734.657) (-734.208) [-730.585] -- 0:00:34
543500 -- [-733.344] (-729.610) (-731.851) (-734.230) * (-734.073) [-731.248] (-736.713) (-732.199) -- 0:00:34
544000 -- (-734.018) (-731.622) [-730.966] (-736.073) * (-731.580) [-729.640] (-731.849) (-731.620) -- 0:00:34
544500 -- (-732.926) [-735.225] (-731.730) (-735.579) * [-730.521] (-729.754) (-737.280) (-730.832) -- 0:00:34
545000 -- (-730.013) (-732.713) [-736.993] (-733.585) * (-735.659) [-734.754] (-734.151) (-736.802) -- 0:00:34
Average standard deviation of split frequencies: 0.007662
545500 -- (-731.549) (-735.327) (-734.429) [-734.873] * [-736.157] (-733.287) (-731.476) (-731.667) -- 0:00:34
546000 -- (-736.725) (-730.856) (-733.009) [-731.847] * (-732.456) (-730.820) (-734.254) [-731.544] -- 0:00:34
546500 -- (-739.988) (-732.726) (-735.807) [-730.614] * (-733.486) (-735.196) (-734.602) [-734.599] -- 0:00:34
547000 -- [-735.867] (-733.492) (-731.464) (-730.418) * (-731.308) [-729.586] (-732.848) (-730.240) -- 0:00:33
547500 -- (-732.652) (-734.010) [-730.971] (-732.016) * (-733.783) (-733.344) [-732.596] (-730.708) -- 0:00:33
548000 -- (-737.605) (-735.071) (-731.292) [-731.786] * (-733.591) (-732.871) (-733.610) [-731.350] -- 0:00:33
548500 -- (-734.892) [-734.660] (-741.105) (-737.664) * [-730.445] (-731.915) (-735.364) (-731.218) -- 0:00:33
549000 -- (-733.318) (-733.727) [-731.118] (-736.447) * (-736.820) (-731.431) [-734.283] (-734.087) -- 0:00:33
549500 -- [-734.014] (-730.345) (-730.200) (-734.766) * (-731.082) [-731.224] (-733.759) (-738.593) -- 0:00:33
550000 -- (-733.943) (-734.082) (-730.399) [-730.105] * [-731.959] (-731.406) (-732.417) (-733.125) -- 0:00:33
Average standard deviation of split frequencies: 0.006902
550500 -- (-733.616) (-736.422) (-732.414) [-729.523] * (-732.239) [-729.700] (-735.360) (-734.612) -- 0:00:33
551000 -- (-735.509) (-734.217) (-732.438) [-731.615] * (-733.689) (-734.369) (-734.050) [-731.191] -- 0:00:34
551500 -- (-734.071) (-732.140) (-731.619) [-733.127] * (-739.317) [-732.164] (-734.097) (-732.754) -- 0:00:34
552000 -- (-734.872) (-736.677) (-730.680) [-733.236] * (-730.672) (-731.579) [-735.659] (-731.320) -- 0:00:34
552500 -- (-729.855) (-732.800) [-732.054] (-732.210) * (-736.571) (-735.422) (-733.633) [-730.843] -- 0:00:34
553000 -- [-733.662] (-735.181) (-735.909) (-731.564) * (-735.920) (-734.244) (-743.004) [-731.494] -- 0:00:33
553500 -- [-737.229] (-732.674) (-732.387) (-735.414) * [-730.876] (-733.322) (-736.356) (-734.969) -- 0:00:33
554000 -- (-731.460) (-735.144) [-733.366] (-733.432) * [-734.351] (-729.551) (-738.223) (-731.821) -- 0:00:33
554500 -- (-736.914) (-734.695) [-731.975] (-732.320) * [-731.875] (-732.597) (-736.885) (-733.628) -- 0:00:33
555000 -- (-734.933) (-729.164) (-732.132) [-733.619] * (-729.583) (-731.220) [-733.083] (-732.807) -- 0:00:33
Average standard deviation of split frequencies: 0.006359
555500 -- (-733.560) [-731.917] (-730.604) (-732.229) * (-734.558) (-736.875) (-737.136) [-733.490] -- 0:00:33
556000 -- [-739.774] (-729.338) (-730.563) (-731.953) * (-730.555) (-736.991) (-734.810) [-731.428] -- 0:00:33
556500 -- (-733.458) [-733.096] (-731.667) (-734.305) * [-731.864] (-733.866) (-733.762) (-733.582) -- 0:00:33
557000 -- (-731.506) [-730.926] (-730.199) (-734.580) * [-731.262] (-731.977) (-730.769) (-736.560) -- 0:00:33
557500 -- (-733.004) (-731.624) (-732.157) [-738.878] * (-730.002) (-734.293) [-735.915] (-735.012) -- 0:00:33
558000 -- (-732.858) (-731.071) [-731.199] (-732.659) * (-731.485) (-733.946) [-732.419] (-735.075) -- 0:00:33
558500 -- (-732.693) [-733.507] (-733.222) (-731.569) * (-732.797) [-730.287] (-731.421) (-731.787) -- 0:00:33
559000 -- (-737.317) (-733.206) [-732.286] (-735.501) * (-732.230) [-731.522] (-735.230) (-731.975) -- 0:00:33
559500 -- (-737.933) (-732.825) (-731.360) [-731.465] * (-733.016) [-734.047] (-735.620) (-732.929) -- 0:00:33
560000 -- [-729.788] (-731.980) (-732.956) (-729.930) * (-729.988) (-732.488) (-732.576) [-734.607] -- 0:00:33
Average standard deviation of split frequencies: 0.005938
560500 -- (-730.149) [-732.923] (-735.046) (-731.835) * [-733.496] (-733.609) (-733.040) (-737.884) -- 0:00:32
561000 -- (-730.346) (-736.667) (-735.756) [-733.434] * [-732.173] (-733.798) (-731.158) (-733.116) -- 0:00:32
561500 -- (-730.532) [-733.505] (-732.189) (-730.875) * (-730.158) (-733.550) [-731.795] (-733.671) -- 0:00:32
562000 -- [-734.055] (-732.286) (-732.867) (-731.470) * (-730.949) (-733.663) (-735.371) [-730.264] -- 0:00:32
562500 -- (-730.822) (-731.746) (-732.976) [-729.936] * (-729.755) (-734.109) [-733.201] (-730.469) -- 0:00:32
563000 -- (-730.540) [-731.864] (-731.592) (-731.495) * (-740.804) (-730.741) (-732.548) [-729.844] -- 0:00:32
563500 -- (-735.258) [-731.850] (-734.628) (-735.188) * (-731.936) [-734.330] (-731.274) (-735.835) -- 0:00:32
564000 -- (-729.719) [-731.056] (-731.342) (-732.777) * (-734.256) (-732.720) [-732.667] (-733.729) -- 0:00:32
564500 -- (-735.708) (-734.853) (-730.031) [-733.300] * (-734.683) [-730.741] (-730.439) (-733.774) -- 0:00:33
565000 -- (-735.277) [-734.562] (-731.221) (-733.110) * (-732.666) [-730.928] (-733.575) (-732.063) -- 0:00:33
Average standard deviation of split frequencies: 0.006090
565500 -- (-731.158) (-733.422) [-732.874] (-735.601) * [-731.704] (-733.372) (-730.763) (-735.021) -- 0:00:33
566000 -- (-732.002) (-734.461) (-729.944) [-734.993] * (-730.531) (-732.023) (-731.272) [-732.881] -- 0:00:32
566500 -- (-735.873) (-732.867) (-731.127) [-732.990] * [-733.224] (-730.330) (-736.153) (-733.591) -- 0:00:32
567000 -- (-735.148) [-732.870] (-736.707) (-731.761) * (-730.784) (-732.201) [-732.513] (-735.113) -- 0:00:32
567500 -- (-735.184) (-731.872) [-729.929] (-735.566) * (-732.303) [-732.004] (-732.176) (-734.838) -- 0:00:32
568000 -- [-733.158] (-730.544) (-736.465) (-736.253) * [-734.236] (-729.962) (-732.481) (-731.886) -- 0:00:32
568500 -- (-733.499) (-730.947) [-736.111] (-732.529) * [-732.935] (-731.739) (-736.456) (-736.009) -- 0:00:32
569000 -- (-733.325) (-732.092) [-734.544] (-734.410) * [-731.920] (-732.504) (-733.436) (-731.087) -- 0:00:32
569500 -- [-730.222] (-732.715) (-734.824) (-738.428) * (-732.829) (-733.045) [-731.766] (-732.795) -- 0:00:32
570000 -- (-732.619) (-730.975) [-730.865] (-735.696) * (-734.405) (-730.746) (-730.728) [-731.467] -- 0:00:32
Average standard deviation of split frequencies: 0.006350
570500 -- (-737.653) (-732.352) (-732.633) [-731.825] * (-737.451) (-733.667) (-732.487) [-732.365] -- 0:00:32
571000 -- (-730.203) (-729.637) (-738.604) [-730.548] * (-731.816) (-735.405) [-731.507] (-731.661) -- 0:00:32
571500 -- (-729.663) (-731.743) (-731.382) [-733.460] * (-734.019) (-730.646) (-733.788) [-731.868] -- 0:00:32
572000 -- (-732.989) [-730.991] (-731.173) (-733.334) * (-734.388) (-730.992) (-729.622) [-732.574] -- 0:00:32
572500 -- (-730.539) [-733.572] (-734.415) (-734.114) * (-735.026) [-733.064] (-735.835) (-730.130) -- 0:00:32
573000 -- [-730.619] (-732.283) (-729.594) (-735.225) * (-735.569) [-734.297] (-730.567) (-729.657) -- 0:00:32
573500 -- (-737.259) (-732.879) (-732.237) [-734.064] * (-737.858) [-730.967] (-730.436) (-732.746) -- 0:00:31
574000 -- (-736.403) (-732.510) [-731.200] (-734.416) * (-736.059) [-733.454] (-732.458) (-733.704) -- 0:00:31
574500 -- (-739.393) (-735.477) (-729.683) [-732.376] * (-743.077) (-733.383) (-729.033) [-732.530] -- 0:00:31
575000 -- [-736.332] (-734.383) (-731.566) (-734.117) * (-736.302) [-730.924] (-732.631) (-732.209) -- 0:00:31
Average standard deviation of split frequencies: 0.006138
575500 -- (-736.650) [-737.279] (-733.127) (-732.908) * (-732.477) [-733.718] (-737.532) (-735.966) -- 0:00:31
576000 -- (-736.695) (-733.030) [-729.599] (-733.376) * (-738.873) [-737.862] (-732.640) (-731.442) -- 0:00:31
576500 -- (-736.635) [-730.082] (-729.831) (-732.581) * (-732.925) (-733.162) [-734.241] (-732.698) -- 0:00:31
577000 -- (-736.224) (-732.302) (-731.432) [-738.082] * (-738.065) [-730.373] (-730.620) (-733.377) -- 0:00:31
577500 -- [-732.935] (-730.891) (-729.566) (-735.242) * (-730.931) [-733.898] (-732.737) (-731.037) -- 0:00:32
578000 -- [-733.557] (-735.463) (-729.916) (-732.058) * [-734.213] (-735.959) (-732.103) (-729.810) -- 0:00:32
578500 -- (-735.846) (-733.546) (-729.984) [-730.414] * [-737.243] (-732.587) (-731.541) (-730.724) -- 0:00:32
579000 -- (-735.578) (-735.242) (-732.742) [-733.077] * (-731.176) [-732.671] (-731.767) (-734.064) -- 0:00:31
579500 -- (-736.527) (-730.020) (-735.219) [-731.532] * [-733.494] (-732.592) (-732.302) (-731.725) -- 0:00:31
580000 -- (-729.831) (-733.662) (-728.809) [-731.706] * [-729.446] (-733.073) (-729.986) (-736.685) -- 0:00:31
Average standard deviation of split frequencies: 0.006698
580500 -- (-734.686) (-732.368) (-731.999) [-732.831] * [-730.420] (-731.619) (-729.933) (-738.652) -- 0:00:31
581000 -- (-732.915) (-734.960) (-730.427) [-729.830] * (-730.006) (-729.620) (-731.163) [-732.708] -- 0:00:31
581500 -- [-731.987] (-734.714) (-733.179) (-729.556) * (-730.645) (-732.324) (-731.680) [-731.388] -- 0:00:31
582000 -- [-730.402] (-734.113) (-735.948) (-730.722) * (-732.242) (-730.455) (-733.989) [-732.418] -- 0:00:31
582500 -- (-731.587) (-731.317) [-732.964] (-733.351) * [-730.399] (-734.848) (-733.219) (-731.060) -- 0:00:31
583000 -- (-734.069) (-735.097) (-730.488) [-731.338] * [-733.523] (-733.777) (-733.224) (-731.209) -- 0:00:31
583500 -- [-733.036] (-733.747) (-733.438) (-739.851) * (-731.348) [-734.381] (-735.328) (-731.404) -- 0:00:31
584000 -- (-733.624) [-733.807] (-733.931) (-738.771) * [-731.230] (-732.868) (-732.606) (-732.895) -- 0:00:31
584500 -- (-732.044) (-731.905) [-735.001] (-731.199) * (-732.045) (-737.584) (-731.466) [-733.813] -- 0:00:31
585000 -- (-733.933) (-736.566) (-732.144) [-731.136] * (-736.056) [-735.196] (-735.651) (-732.189) -- 0:00:31
Average standard deviation of split frequencies: 0.006888
585500 -- [-730.277] (-737.280) (-737.108) (-735.272) * (-731.202) [-734.643] (-732.122) (-733.460) -- 0:00:31
586000 -- (-732.630) [-734.471] (-732.667) (-731.436) * (-730.763) (-733.477) [-731.444] (-730.787) -- 0:00:31
586500 -- [-736.156] (-732.861) (-733.718) (-733.635) * [-731.308] (-734.271) (-730.196) (-733.628) -- 0:00:31
587000 -- (-733.690) (-734.069) [-731.713] (-735.152) * (-730.756) (-733.700) [-729.727] (-730.738) -- 0:00:30
587500 -- (-731.755) (-734.328) (-731.768) [-734.661] * (-732.293) (-736.010) [-732.330] (-731.197) -- 0:00:30
588000 -- (-731.059) (-737.854) (-737.319) [-733.854] * (-732.345) (-735.892) [-731.527] (-733.048) -- 0:00:30
588500 -- (-731.348) [-735.230] (-731.819) (-731.451) * [-732.377] (-734.438) (-732.402) (-733.507) -- 0:00:30
589000 -- (-732.260) (-733.431) [-735.360] (-737.670) * [-730.398] (-736.812) (-732.160) (-730.575) -- 0:00:30
589500 -- (-733.456) (-731.613) [-731.218] (-731.594) * (-732.261) (-738.292) [-733.329] (-729.267) -- 0:00:30
590000 -- (-730.368) (-730.221) (-732.664) [-731.631] * (-733.958) (-738.713) [-733.497] (-733.987) -- 0:00:30
Average standard deviation of split frequencies: 0.006784
590500 -- [-731.574] (-730.187) (-733.948) (-731.749) * [-731.442] (-734.520) (-734.437) (-735.398) -- 0:00:30
591000 -- (-730.698) (-737.738) (-732.017) [-734.144] * (-736.109) [-731.518] (-734.609) (-732.988) -- 0:00:31
591500 -- (-732.295) (-735.388) [-734.960] (-731.018) * (-738.653) [-731.859] (-733.566) (-730.301) -- 0:00:31
592000 -- (-731.265) [-729.974] (-730.751) (-738.593) * (-730.294) [-730.918] (-729.960) (-729.093) -- 0:00:31
592500 -- [-732.028] (-731.142) (-732.746) (-735.289) * [-732.928] (-731.326) (-731.710) (-733.343) -- 0:00:30
593000 -- (-732.934) (-733.681) (-733.751) [-731.883] * (-735.923) [-735.125] (-729.511) (-731.208) -- 0:00:30
593500 -- (-733.205) (-732.678) (-731.852) [-730.541] * [-732.184] (-731.181) (-732.673) (-737.148) -- 0:00:30
594000 -- [-730.836] (-732.717) (-729.168) (-731.555) * (-731.067) [-735.093] (-730.860) (-736.361) -- 0:00:30
594500 -- (-733.260) [-733.690] (-731.799) (-731.741) * [-731.523] (-732.467) (-733.985) (-731.205) -- 0:00:30
595000 -- (-733.043) [-730.985] (-732.380) (-732.704) * (-732.635) (-733.710) (-734.500) [-735.554] -- 0:00:30
Average standard deviation of split frequencies: 0.006921
595500 -- [-730.061] (-732.305) (-730.327) (-732.557) * (-731.943) (-731.794) [-730.049] (-734.018) -- 0:00:30
596000 -- (-735.154) [-730.572] (-730.402) (-734.818) * (-735.940) (-736.125) [-733.209] (-734.321) -- 0:00:30
596500 -- (-733.321) (-731.049) [-731.550] (-734.760) * (-730.511) (-731.708) (-734.493) [-734.704] -- 0:00:30
597000 -- (-734.441) [-730.340] (-731.631) (-734.390) * (-730.846) (-736.919) (-735.226) [-731.099] -- 0:00:30
597500 -- (-733.732) [-730.206] (-733.503) (-732.360) * [-731.357] (-732.716) (-734.843) (-733.916) -- 0:00:30
598000 -- (-731.350) [-730.452] (-735.184) (-738.138) * (-733.590) (-732.888) [-731.509] (-734.899) -- 0:00:30
598500 -- (-731.233) [-732.583] (-746.744) (-730.237) * [-733.415] (-736.978) (-733.336) (-734.692) -- 0:00:30
599000 -- (-732.525) [-729.755] (-733.278) (-734.635) * (-731.254) [-729.675] (-733.097) (-735.669) -- 0:00:30
599500 -- (-735.110) [-736.197] (-732.012) (-731.177) * [-732.636] (-731.247) (-732.633) (-731.896) -- 0:00:30
600000 -- (-732.971) [-733.064] (-737.228) (-732.641) * [-735.367] (-732.693) (-732.057) (-735.453) -- 0:00:29
Average standard deviation of split frequencies: 0.007063
600500 -- (-729.043) (-736.101) (-735.169) [-731.120] * [-732.157] (-731.128) (-730.158) (-730.761) -- 0:00:29
601000 -- (-735.593) (-731.921) [-732.169] (-732.323) * (-733.226) [-730.952] (-731.908) (-733.191) -- 0:00:29
601500 -- (-732.827) (-729.919) (-732.127) [-729.651] * [-730.546] (-734.315) (-733.758) (-735.227) -- 0:00:29
602000 -- (-730.254) (-734.648) [-732.297] (-735.029) * (-732.682) (-736.205) [-734.911] (-733.215) -- 0:00:29
602500 -- (-731.367) [-733.907] (-730.314) (-734.058) * (-730.898) [-729.905] (-736.635) (-733.135) -- 0:00:29
603000 -- [-732.527] (-736.299) (-732.045) (-731.619) * [-730.258] (-731.308) (-730.649) (-733.444) -- 0:00:29
603500 -- (-732.366) (-740.635) (-734.582) [-730.741] * [-732.347] (-732.458) (-735.051) (-733.094) -- 0:00:29
604000 -- (-734.455) (-729.046) [-730.592] (-733.473) * (-733.306) [-732.284] (-733.118) (-731.652) -- 0:00:30
604500 -- (-731.229) (-730.286) (-733.722) [-732.044] * [-729.956] (-734.015) (-734.570) (-733.556) -- 0:00:30
605000 -- (-730.790) (-734.244) [-731.856] (-730.348) * (-736.957) (-734.072) (-731.725) [-732.639] -- 0:00:30
Average standard deviation of split frequencies: 0.007341
605500 -- (-736.977) (-735.887) (-731.439) [-732.752] * (-733.839) (-730.366) (-735.420) [-731.860] -- 0:00:29
606000 -- [-733.147] (-734.719) (-732.268) (-732.666) * (-730.187) (-735.802) [-733.048] (-735.045) -- 0:00:29
606500 -- [-730.713] (-730.622) (-733.147) (-731.826) * (-733.180) [-730.859] (-731.275) (-734.488) -- 0:00:29
607000 -- (-730.871) (-729.634) (-735.287) [-729.951] * (-732.161) (-732.900) [-737.498] (-736.219) -- 0:00:29
607500 -- (-729.640) (-730.428) [-735.806] (-734.131) * (-733.248) [-731.302] (-731.598) (-739.241) -- 0:00:29
608000 -- (-732.085) (-732.075) [-731.437] (-737.231) * [-733.769] (-733.628) (-732.105) (-731.671) -- 0:00:29
608500 -- (-732.223) (-730.564) (-729.521) [-733.466] * [-731.265] (-735.311) (-736.064) (-735.072) -- 0:00:29
609000 -- [-731.463] (-733.212) (-731.234) (-735.504) * [-731.778] (-735.092) (-733.840) (-737.625) -- 0:00:29
609500 -- [-731.998] (-733.411) (-733.916) (-731.837) * (-733.356) [-735.550] (-733.450) (-738.062) -- 0:00:29
610000 -- (-731.906) (-732.227) [-732.027] (-737.098) * (-732.317) (-733.676) (-734.551) [-737.294] -- 0:00:29
Average standard deviation of split frequencies: 0.007237
610500 -- (-732.265) (-732.280) [-731.945] (-730.271) * [-732.003] (-736.084) (-731.590) (-735.005) -- 0:00:29
611000 -- (-735.558) (-731.520) (-732.505) [-730.270] * (-734.821) [-732.513] (-733.024) (-733.223) -- 0:00:29
611500 -- (-733.841) (-732.861) (-731.916) [-734.716] * (-731.116) (-730.714) [-733.593] (-737.334) -- 0:00:29
612000 -- (-744.504) (-732.979) (-731.389) [-735.176] * (-734.732) (-730.157) [-732.995] (-736.920) -- 0:00:29
612500 -- (-741.689) (-729.468) (-734.931) [-733.090] * (-731.399) [-730.715] (-739.198) (-736.356) -- 0:00:29
613000 -- (-737.071) [-730.833] (-735.996) (-739.083) * (-732.106) (-732.890) [-732.955] (-732.746) -- 0:00:29
613500 -- (-741.541) [-730.177] (-732.916) (-736.443) * (-732.911) (-732.426) (-733.579) [-734.724] -- 0:00:28
614000 -- (-734.868) (-735.233) [-731.583] (-733.398) * [-738.733] (-730.782) (-736.622) (-735.975) -- 0:00:28
614500 -- (-733.454) (-731.768) (-733.317) [-732.118] * (-728.806) (-735.028) [-733.156] (-733.522) -- 0:00:28
615000 -- (-735.036) (-733.539) [-735.651] (-730.784) * [-734.092] (-733.960) (-733.770) (-734.782) -- 0:00:28
Average standard deviation of split frequencies: 0.007509
615500 -- [-729.390] (-731.868) (-732.272) (-731.173) * [-734.051] (-730.401) (-734.406) (-733.553) -- 0:00:28
616000 -- (-734.623) [-735.831] (-732.379) (-735.388) * (-732.068) (-731.745) [-732.342] (-734.475) -- 0:00:28
616500 -- (-734.065) (-736.855) [-730.326] (-733.816) * (-733.893) (-731.494) [-734.024] (-734.974) -- 0:00:28
617000 -- (-730.889) [-735.544] (-733.200) (-734.575) * [-732.109] (-737.526) (-733.510) (-736.747) -- 0:00:28
617500 -- (-734.115) (-730.627) (-731.965) [-731.897] * (-733.680) (-735.482) [-730.551] (-730.862) -- 0:00:29
618000 -- [-730.148] (-729.979) (-730.756) (-730.116) * (-732.710) (-737.204) [-732.631] (-731.109) -- 0:00:29
618500 -- (-732.519) [-731.235] (-730.709) (-731.730) * [-732.715] (-734.252) (-735.891) (-734.118) -- 0:00:28
619000 -- (-735.791) (-733.363) (-731.921) [-733.803] * (-732.866) (-731.751) (-731.877) [-733.789] -- 0:00:28
619500 -- (-733.755) (-730.894) (-732.384) [-737.190] * (-732.448) (-735.784) [-731.848] (-734.325) -- 0:00:28
620000 -- [-734.807] (-730.703) (-737.020) (-734.177) * [-729.860] (-733.976) (-731.358) (-730.394) -- 0:00:28
Average standard deviation of split frequencies: 0.007880
620500 -- (-733.649) (-730.816) [-730.997] (-736.590) * (-729.057) [-731.814] (-733.769) (-729.602) -- 0:00:28
621000 -- (-735.054) (-732.853) (-731.801) [-736.129] * [-731.884] (-732.351) (-732.496) (-730.966) -- 0:00:28
621500 -- (-733.148) [-731.762] (-729.972) (-732.093) * [-731.143] (-733.592) (-733.115) (-733.343) -- 0:00:28
622000 -- [-732.596] (-732.792) (-730.262) (-737.429) * (-732.768) [-732.016] (-734.576) (-733.278) -- 0:00:28
622500 -- (-734.102) [-731.023] (-731.115) (-729.804) * (-734.215) [-729.750] (-735.765) (-733.373) -- 0:00:28
623000 -- (-732.654) [-734.201] (-730.298) (-731.622) * (-732.332) (-730.259) (-733.000) [-732.436] -- 0:00:28
623500 -- [-731.391] (-734.334) (-731.137) (-731.392) * [-731.443] (-729.708) (-734.496) (-733.670) -- 0:00:28
624000 -- (-736.055) [-732.503] (-730.796) (-732.020) * (-735.996) (-730.342) (-733.653) [-731.002] -- 0:00:28
624500 -- [-733.549] (-732.490) (-730.827) (-733.977) * (-737.137) (-735.310) (-731.450) [-730.020] -- 0:00:28
625000 -- (-733.902) [-732.851] (-734.665) (-731.135) * (-734.422) [-732.954] (-731.624) (-730.490) -- 0:00:28
Average standard deviation of split frequencies: 0.008472
625500 -- [-732.051] (-732.077) (-731.030) (-735.357) * (-734.212) (-737.029) [-731.107] (-729.136) -- 0:00:28
626000 -- (-734.359) [-732.346] (-730.231) (-730.505) * (-735.181) (-730.758) [-730.913] (-730.500) -- 0:00:28
626500 -- (-732.255) [-730.206] (-729.415) (-735.338) * [-732.874] (-736.922) (-732.172) (-732.109) -- 0:00:28
627000 -- [-730.783] (-731.055) (-730.854) (-733.799) * (-732.037) [-733.571] (-734.025) (-730.510) -- 0:00:27
627500 -- (-730.869) [-732.324] (-731.698) (-730.877) * [-733.873] (-733.475) (-732.171) (-731.635) -- 0:00:27
628000 -- (-732.983) (-733.488) [-730.348] (-731.262) * (-731.825) (-729.515) [-733.324] (-731.605) -- 0:00:27
628500 -- [-730.865] (-733.250) (-731.269) (-734.227) * (-730.419) (-730.989) [-732.840] (-731.993) -- 0:00:27
629000 -- (-733.651) (-732.365) [-735.541] (-733.428) * (-732.776) (-734.340) (-738.355) [-730.407] -- 0:00:27
629500 -- [-731.552] (-729.644) (-736.453) (-733.001) * (-732.516) [-730.509] (-733.754) (-734.347) -- 0:00:27
630000 -- (-733.456) (-731.497) (-740.495) [-732.896] * (-730.162) (-733.828) (-730.045) [-737.242] -- 0:00:27
Average standard deviation of split frequencies: 0.008362
630500 -- (-735.132) [-729.067] (-730.052) (-733.863) * (-732.625) (-731.752) [-731.650] (-734.551) -- 0:00:28
631000 -- (-731.729) (-735.439) (-738.051) [-731.160] * (-733.538) [-732.191] (-729.117) (-733.364) -- 0:00:28
631500 -- (-732.850) (-731.380) [-731.416] (-734.962) * (-732.979) (-732.358) [-730.296] (-730.577) -- 0:00:28
632000 -- (-734.198) [-733.682] (-734.800) (-736.709) * (-733.765) (-732.932) [-731.491] (-730.965) -- 0:00:27
632500 -- (-734.446) [-730.462] (-739.433) (-732.575) * (-731.841) [-731.128] (-729.823) (-735.192) -- 0:00:27
633000 -- (-733.356) [-731.355] (-732.398) (-729.119) * [-734.241] (-733.435) (-734.001) (-731.530) -- 0:00:27
633500 -- (-732.152) [-733.595] (-731.558) (-730.178) * (-731.318) (-731.137) [-731.177] (-730.912) -- 0:00:27
634000 -- (-731.064) (-731.180) [-734.681] (-729.457) * (-734.517) (-734.406) (-731.022) [-731.609] -- 0:00:27
634500 -- (-733.480) (-733.057) [-731.752] (-730.287) * (-733.197) (-735.036) (-731.461) [-730.509] -- 0:00:27
635000 -- (-736.745) (-730.175) [-729.801] (-730.575) * (-735.362) (-731.616) (-731.029) [-731.461] -- 0:00:27
Average standard deviation of split frequencies: 0.008014
635500 -- [-733.495] (-730.384) (-731.876) (-734.284) * (-730.664) (-729.548) (-731.104) [-731.066] -- 0:00:27
636000 -- (-732.349) [-731.241] (-731.979) (-731.556) * (-731.228) (-733.984) (-729.088) [-730.459] -- 0:00:27
636500 -- (-734.411) [-730.252] (-732.459) (-730.512) * (-732.709) (-734.075) [-730.496] (-731.976) -- 0:00:27
637000 -- [-732.135] (-732.617) (-730.476) (-730.729) * (-732.979) (-731.880) [-730.665] (-729.619) -- 0:00:27
637500 -- [-730.708] (-729.851) (-734.428) (-731.796) * (-733.601) (-732.929) [-732.661] (-734.004) -- 0:00:27
638000 -- (-731.093) (-733.615) [-730.725] (-733.490) * [-730.657] (-734.159) (-729.871) (-734.844) -- 0:00:27
638500 -- (-732.829) [-732.502] (-729.757) (-732.052) * (-735.496) (-730.263) [-730.501] (-736.508) -- 0:00:27
639000 -- (-733.310) [-729.858] (-733.404) (-731.694) * [-735.824] (-733.358) (-734.477) (-732.559) -- 0:00:27
639500 -- (-730.360) (-731.480) [-730.684] (-731.984) * (-735.401) [-730.705] (-730.490) (-731.945) -- 0:00:27
640000 -- (-731.302) [-733.562] (-732.990) (-732.805) * [-730.770] (-732.351) (-732.539) (-733.567) -- 0:00:26
Average standard deviation of split frequencies: 0.007542
640500 -- (-730.454) (-733.363) [-731.172] (-731.988) * (-736.553) [-731.762] (-732.524) (-734.251) -- 0:00:26
641000 -- (-729.699) (-730.520) (-732.495) [-731.515] * (-731.237) (-730.553) (-733.613) [-733.243] -- 0:00:26
641500 -- [-730.117] (-733.302) (-735.228) (-730.683) * (-732.036) (-734.246) [-730.002] (-734.514) -- 0:00:26
642000 -- (-730.442) [-729.388] (-734.170) (-730.330) * (-730.241) (-736.647) [-732.458] (-734.933) -- 0:00:26
642500 -- (-730.214) [-732.345] (-736.413) (-734.051) * (-731.418) [-734.965] (-733.584) (-733.408) -- 0:00:26
643000 -- (-734.061) (-740.478) (-733.615) [-732.324] * [-732.349] (-731.816) (-731.927) (-734.053) -- 0:00:26
643500 -- (-729.207) [-732.520] (-733.235) (-732.901) * (-732.198) [-731.900] (-733.044) (-734.879) -- 0:00:26
644000 -- (-730.688) (-731.993) [-731.139] (-731.498) * [-729.238] (-731.783) (-732.218) (-737.997) -- 0:00:27
644500 -- (-734.186) [-730.227] (-729.676) (-730.251) * (-731.764) (-733.790) (-734.855) [-735.614] -- 0:00:27
645000 -- (-731.801) (-729.795) [-731.792] (-732.700) * [-728.770] (-730.854) (-738.973) (-733.160) -- 0:00:26
Average standard deviation of split frequencies: 0.007024
645500 -- (-732.540) (-731.221) [-730.775] (-730.829) * [-731.624] (-730.699) (-734.200) (-735.146) -- 0:00:26
646000 -- (-732.244) (-729.559) (-737.195) [-730.558] * [-730.493] (-730.270) (-734.301) (-735.864) -- 0:00:26
646500 -- (-734.955) (-730.161) [-731.427] (-728.618) * (-730.984) (-730.676) (-734.747) [-737.112] -- 0:00:26
647000 -- (-732.469) [-729.480] (-733.310) (-730.548) * [-732.472] (-734.993) (-729.486) (-734.835) -- 0:00:26
647500 -- (-731.631) (-731.818) (-733.437) [-730.721] * [-734.181] (-731.562) (-731.975) (-734.779) -- 0:00:26
648000 -- (-733.089) (-733.547) [-733.197] (-732.654) * (-733.749) [-728.150] (-732.459) (-736.176) -- 0:00:26
648500 -- (-733.821) (-730.825) (-737.488) [-729.783] * [-733.822] (-735.460) (-730.801) (-735.544) -- 0:00:26
649000 -- (-732.249) [-731.586] (-734.977) (-732.831) * (-730.129) (-730.934) [-732.830] (-733.266) -- 0:00:26
649500 -- (-733.900) [-732.036] (-733.527) (-735.428) * (-732.652) [-730.792] (-731.168) (-730.458) -- 0:00:26
650000 -- (-731.750) (-732.256) (-731.235) [-734.709] * (-729.910) (-729.038) [-733.832] (-732.111) -- 0:00:26
Average standard deviation of split frequencies: 0.006883
650500 -- [-730.328] (-731.073) (-736.649) (-732.117) * (-731.439) (-729.053) (-732.203) [-734.042] -- 0:00:26
651000 -- [-730.848] (-730.038) (-733.461) (-730.517) * (-732.803) (-729.457) [-734.075] (-729.857) -- 0:00:26
651500 -- (-733.599) (-730.819) [-732.727] (-735.510) * (-730.984) [-733.119] (-739.178) (-735.360) -- 0:00:26
652000 -- (-734.249) [-731.031] (-732.196) (-734.641) * (-730.601) (-733.696) (-737.955) [-730.280] -- 0:00:26
652500 -- (-733.328) (-732.585) (-734.688) [-732.980] * (-737.210) (-734.890) [-738.214] (-732.039) -- 0:00:26
653000 -- [-732.532] (-731.263) (-733.128) (-730.528) * [-733.228] (-731.428) (-732.775) (-733.753) -- 0:00:26
653500 -- (-732.777) (-733.255) (-731.806) [-730.690] * (-734.368) (-733.677) [-733.158] (-733.791) -- 0:00:25
654000 -- [-740.911] (-729.981) (-732.928) (-731.515) * [-730.815] (-732.742) (-738.922) (-731.440) -- 0:00:25
654500 -- (-732.257) (-732.079) [-732.338] (-734.207) * (-731.621) (-734.391) [-731.976] (-739.560) -- 0:00:25
655000 -- (-734.353) (-732.455) (-732.246) [-730.946] * (-733.073) (-732.763) (-730.249) [-734.277] -- 0:00:25
Average standard deviation of split frequencies: 0.007635
655500 -- (-736.733) [-731.646] (-737.349) (-733.808) * (-734.411) (-734.410) [-732.683] (-735.706) -- 0:00:25
656000 -- (-736.314) (-730.154) [-731.281] (-730.475) * (-733.246) (-735.969) (-733.095) [-737.112] -- 0:00:25
656500 -- [-732.217] (-732.531) (-734.756) (-732.174) * (-732.638) (-734.785) (-735.334) [-730.297] -- 0:00:25
657000 -- (-730.944) [-732.720] (-735.461) (-729.835) * [-729.939] (-735.291) (-740.660) (-739.327) -- 0:00:25
657500 -- (-735.437) [-734.146] (-734.247) (-729.808) * (-730.322) [-731.633] (-742.431) (-735.553) -- 0:00:26
658000 -- [-730.722] (-733.754) (-736.284) (-729.823) * [-729.628] (-731.652) (-735.917) (-731.811) -- 0:00:25
658500 -- (-731.816) (-734.571) (-733.755) [-731.516] * (-732.216) (-732.080) (-731.422) [-732.229] -- 0:00:25
659000 -- (-730.656) [-731.166] (-733.195) (-735.180) * (-732.449) (-735.783) (-732.962) [-731.960] -- 0:00:25
659500 -- (-731.122) [-733.431] (-730.925) (-737.189) * (-730.889) (-735.273) (-737.512) [-729.169] -- 0:00:25
660000 -- (-729.983) (-732.938) (-734.245) [-732.980] * (-733.680) (-732.783) (-731.321) [-731.156] -- 0:00:25
Average standard deviation of split frequencies: 0.007001
660500 -- (-733.922) (-735.629) [-734.675] (-733.619) * (-732.653) (-731.021) (-734.766) [-731.590] -- 0:00:25
661000 -- [-731.205] (-733.861) (-736.079) (-736.520) * (-731.952) (-735.765) [-730.591] (-732.672) -- 0:00:25
661500 -- (-732.232) (-733.363) [-730.811] (-732.787) * [-733.851] (-736.106) (-739.270) (-738.279) -- 0:00:25
662000 -- (-732.088) [-732.762] (-732.127) (-732.302) * (-734.384) (-737.423) [-735.803] (-732.772) -- 0:00:25
662500 -- (-732.663) [-732.101] (-732.487) (-731.519) * (-731.205) (-738.125) (-740.518) [-733.450] -- 0:00:25
663000 -- (-732.543) [-730.640] (-734.843) (-732.294) * (-732.086) [-731.484] (-735.700) (-730.627) -- 0:00:25
663500 -- (-733.758) (-731.423) (-734.036) [-732.488] * [-734.278] (-732.244) (-730.835) (-735.521) -- 0:00:25
664000 -- [-730.793] (-733.700) (-734.049) (-732.598) * (-732.592) [-731.848] (-733.909) (-735.378) -- 0:00:25
664500 -- (-731.925) [-732.118] (-730.713) (-732.542) * (-732.548) [-737.011] (-731.262) (-732.780) -- 0:00:25
665000 -- (-732.019) [-728.433] (-732.276) (-734.994) * (-732.873) (-731.980) (-733.769) [-730.323] -- 0:00:25
Average standard deviation of split frequencies: 0.007299
665500 -- (-734.090) (-731.501) (-734.080) [-733.260] * (-734.292) [-731.039] (-730.977) (-735.872) -- 0:00:25
666000 -- (-733.248) [-729.112] (-734.447) (-735.815) * (-736.264) (-736.573) [-732.408] (-735.210) -- 0:00:25
666500 -- [-731.701] (-730.947) (-736.585) (-733.199) * (-733.377) (-732.675) (-738.155) [-732.672] -- 0:00:25
667000 -- (-733.188) [-730.006] (-734.696) (-732.950) * (-733.301) (-739.947) (-730.814) [-729.967] -- 0:00:24
667500 -- (-733.805) (-730.968) (-729.848) [-733.778] * [-732.086] (-744.229) (-731.611) (-729.788) -- 0:00:24
668000 -- (-733.847) [-729.624] (-731.708) (-731.631) * (-731.883) (-737.262) [-736.547] (-730.335) -- 0:00:24
668500 -- (-731.751) [-730.713] (-730.466) (-736.017) * (-735.115) (-735.157) (-732.240) [-730.595] -- 0:00:24
669000 -- (-730.004) (-732.059) (-729.553) [-732.882] * (-735.570) (-733.495) [-730.453] (-729.606) -- 0:00:24
669500 -- (-734.197) (-734.463) [-729.856] (-733.175) * (-735.345) (-733.465) (-731.596) [-731.826] -- 0:00:24
670000 -- (-731.374) (-732.873) (-737.855) [-729.779] * (-734.491) (-735.500) (-729.343) [-731.620] -- 0:00:24
Average standard deviation of split frequencies: 0.006897
670500 -- (-734.368) (-733.388) [-728.758] (-732.686) * (-732.556) [-731.386] (-735.152) (-729.980) -- 0:00:25
671000 -- (-736.967) (-734.004) [-728.974] (-732.183) * [-730.161] (-731.226) (-730.191) (-730.189) -- 0:00:25
671500 -- (-732.037) (-731.913) [-729.941] (-734.093) * (-735.595) [-733.330] (-728.516) (-729.587) -- 0:00:24
672000 -- (-732.100) (-731.638) (-731.814) [-731.676] * (-735.776) (-737.310) [-730.824] (-730.086) -- 0:00:24
672500 -- (-734.313) (-733.607) [-731.847] (-733.644) * (-731.797) (-732.373) (-732.309) [-734.678] -- 0:00:24
673000 -- [-732.816] (-731.100) (-732.323) (-732.294) * (-730.660) (-735.952) [-730.650] (-733.207) -- 0:00:24
673500 -- [-732.877] (-734.719) (-733.963) (-733.249) * (-732.867) (-740.446) (-733.601) [-732.908] -- 0:00:24
674000 -- (-737.341) (-733.818) (-733.092) [-732.511] * [-734.570] (-739.551) (-731.901) (-733.016) -- 0:00:24
674500 -- (-732.623) [-735.794] (-742.171) (-738.573) * (-731.181) (-731.310) [-730.909] (-736.380) -- 0:00:24
675000 -- (-733.152) [-732.125] (-742.123) (-733.749) * (-732.514) (-729.549) [-730.900] (-730.952) -- 0:00:24
Average standard deviation of split frequencies: 0.006886
675500 -- (-732.066) [-730.463] (-729.973) (-735.598) * [-732.655] (-730.831) (-730.945) (-733.175) -- 0:00:24
676000 -- (-731.055) (-730.769) (-733.201) [-735.800] * (-734.736) (-736.126) [-734.762] (-732.381) -- 0:00:24
676500 -- (-731.567) (-734.283) [-732.215] (-732.486) * [-731.123] (-731.097) (-729.209) (-735.056) -- 0:00:24
677000 -- (-734.950) (-729.954) (-732.175) [-732.772] * [-733.062] (-731.799) (-732.500) (-731.280) -- 0:00:24
677500 -- (-731.849) (-734.226) (-734.216) [-732.259] * [-740.226] (-734.124) (-731.338) (-730.121) -- 0:00:24
678000 -- (-732.366) [-733.433] (-731.157) (-732.231) * (-731.432) (-732.836) (-731.337) [-732.080] -- 0:00:24
678500 -- (-731.831) (-735.496) (-733.143) [-733.369] * (-732.814) (-733.021) [-730.106] (-732.846) -- 0:00:24
679000 -- (-731.458) (-734.015) [-731.172] (-732.583) * [-734.548] (-732.730) (-733.577) (-729.924) -- 0:00:24
679500 -- (-730.309) (-732.483) [-731.844] (-729.077) * (-732.586) (-730.588) (-734.937) [-729.356] -- 0:00:24
680000 -- (-734.037) (-733.359) [-733.952] (-732.842) * (-733.546) (-730.336) [-732.459] (-732.393) -- 0:00:23
Average standard deviation of split frequencies: 0.006709
680500 -- (-732.369) [-730.480] (-737.943) (-729.678) * (-732.345) (-734.346) [-733.447] (-730.677) -- 0:00:23
681000 -- (-733.195) (-733.937) [-733.539] (-739.594) * (-734.715) (-739.615) (-732.785) [-731.532] -- 0:00:23
681500 -- (-734.572) (-734.407) [-732.823] (-732.585) * (-734.212) (-731.615) (-730.502) [-732.453] -- 0:00:23
682000 -- [-731.160] (-730.174) (-732.230) (-731.342) * (-732.860) (-737.217) (-734.447) [-731.419] -- 0:00:23
682500 -- (-733.501) (-730.273) (-735.108) [-733.166] * (-732.192) (-733.360) (-734.656) [-735.900] -- 0:00:23
683000 -- (-734.581) [-731.102] (-735.820) (-729.836) * (-730.437) (-731.796) (-734.281) [-737.861] -- 0:00:23
683500 -- (-730.046) (-735.772) (-731.399) [-734.872] * (-734.350) (-733.495) [-733.348] (-735.501) -- 0:00:23
684000 -- (-732.782) (-732.414) (-730.016) [-731.571] * (-732.972) [-731.895] (-732.997) (-731.521) -- 0:00:24
684500 -- [-731.456] (-735.750) (-736.477) (-732.103) * (-740.192) [-731.570] (-731.988) (-734.673) -- 0:00:23
685000 -- (-733.692) (-730.468) (-735.203) [-736.050] * (-733.390) [-730.730] (-732.917) (-732.646) -- 0:00:23
Average standard deviation of split frequencies: 0.006958
685500 -- (-732.613) [-730.976] (-734.486) (-736.642) * [-732.029] (-732.279) (-734.021) (-730.260) -- 0:00:23
686000 -- [-733.763] (-731.158) (-739.395) (-737.780) * (-732.936) (-735.704) [-731.216] (-731.811) -- 0:00:23
686500 -- [-732.369] (-729.724) (-737.859) (-730.947) * (-732.378) [-730.910] (-733.471) (-732.955) -- 0:00:23
687000 -- (-732.024) (-731.682) (-731.444) [-734.396] * (-733.262) (-733.441) (-732.203) [-731.964] -- 0:00:23
687500 -- (-736.134) (-735.233) (-732.793) [-733.761] * (-733.346) (-734.404) (-738.113) [-732.294] -- 0:00:23
688000 -- (-731.916) (-738.951) (-735.699) [-731.600] * (-734.078) (-733.519) (-740.353) [-731.454] -- 0:00:23
688500 -- (-731.083) [-732.879] (-730.994) (-731.391) * (-741.014) (-730.340) (-739.525) [-732.635] -- 0:00:23
689000 -- [-730.766] (-730.718) (-732.810) (-732.987) * (-734.499) [-730.726] (-733.861) (-731.137) -- 0:00:23
689500 -- (-729.592) (-734.063) (-732.515) [-733.881] * (-733.729) (-730.301) (-736.324) [-732.357] -- 0:00:23
690000 -- (-734.859) [-732.086] (-731.308) (-732.192) * (-735.201) (-731.280) (-733.272) [-731.868] -- 0:00:23
Average standard deviation of split frequencies: 0.006996
690500 -- (-734.404) (-731.640) [-731.560] (-731.598) * (-731.575) (-735.437) (-730.403) [-731.388] -- 0:00:23
691000 -- [-731.138] (-735.312) (-736.032) (-730.030) * (-732.094) (-732.892) (-732.854) [-732.329] -- 0:00:23
691500 -- [-732.613] (-734.162) (-730.959) (-733.071) * (-732.441) (-729.895) [-738.019] (-732.169) -- 0:00:23
692000 -- [-730.609] (-733.957) (-731.843) (-732.120) * (-736.560) [-732.163] (-731.616) (-731.428) -- 0:00:23
692500 -- (-736.521) (-732.104) [-733.339] (-731.628) * (-733.245) (-730.281) [-731.519] (-733.720) -- 0:00:23
693000 -- (-730.080) (-732.642) [-733.113] (-731.437) * (-733.304) [-729.698] (-732.885) (-733.116) -- 0:00:23
693500 -- [-731.407] (-736.657) (-729.886) (-731.656) * (-735.483) [-730.177] (-733.494) (-730.114) -- 0:00:22
694000 -- (-731.231) [-731.968] (-730.539) (-731.805) * (-735.201) (-732.902) [-731.491] (-736.478) -- 0:00:22
694500 -- [-731.102] (-735.526) (-731.549) (-737.234) * (-734.827) [-730.952] (-734.258) (-730.362) -- 0:00:22
695000 -- (-730.471) (-734.231) (-734.018) [-734.004] * [-731.852] (-731.264) (-730.562) (-729.342) -- 0:00:22
Average standard deviation of split frequencies: 0.007027
695500 -- (-731.994) (-731.163) [-732.337] (-735.758) * (-736.135) (-732.058) (-732.630) [-731.893] -- 0:00:22
696000 -- (-731.322) (-733.425) [-731.875] (-731.912) * (-732.210) (-735.099) [-733.393] (-730.668) -- 0:00:23
696500 -- (-732.109) (-733.103) (-734.114) [-730.456] * [-732.215] (-734.498) (-736.688) (-735.453) -- 0:00:23
697000 -- [-739.305] (-736.216) (-733.956) (-731.470) * (-731.059) [-734.696] (-731.790) (-733.327) -- 0:00:23
697500 -- [-730.674] (-739.293) (-734.923) (-730.513) * [-730.027] (-732.905) (-733.585) (-735.561) -- 0:00:22
698000 -- [-733.338] (-733.488) (-731.454) (-731.759) * (-734.012) [-730.847] (-732.889) (-735.926) -- 0:00:22
698500 -- (-733.101) [-732.244] (-733.561) (-729.896) * [-729.679] (-732.581) (-735.687) (-732.568) -- 0:00:22
699000 -- (-734.181) (-732.831) (-730.915) [-733.564] * [-733.246] (-735.443) (-733.864) (-734.659) -- 0:00:22
699500 -- (-730.224) (-734.274) (-732.092) [-731.503] * (-734.182) (-741.235) (-733.696) [-733.305] -- 0:00:22
700000 -- (-731.198) [-732.996] (-730.408) (-731.168) * (-732.768) (-737.106) [-731.968] (-731.359) -- 0:00:22
Average standard deviation of split frequencies: 0.006980
700500 -- (-734.706) (-732.687) [-729.376] (-733.265) * (-732.546) (-733.749) [-733.323] (-735.566) -- 0:00:22
701000 -- (-735.569) [-730.993] (-732.588) (-730.913) * (-732.047) [-733.055] (-730.937) (-736.877) -- 0:00:22
701500 -- (-731.591) (-731.354) (-731.652) [-730.064] * [-734.578] (-733.617) (-731.292) (-729.351) -- 0:00:22
702000 -- (-731.724) (-735.679) [-729.900] (-733.921) * (-736.866) (-733.707) (-732.552) [-732.412] -- 0:00:22
702500 -- (-733.718) (-735.557) [-731.300] (-730.996) * (-731.033) (-736.287) (-730.927) [-733.544] -- 0:00:22
703000 -- (-731.480) [-733.262] (-740.772) (-733.841) * (-734.933) (-731.628) [-731.210] (-732.313) -- 0:00:22
703500 -- [-731.824] (-733.488) (-737.910) (-735.288) * (-733.101) (-736.228) (-731.720) [-730.238] -- 0:00:22
704000 -- [-732.570] (-731.893) (-736.195) (-731.974) * (-735.823) (-737.262) [-733.309] (-731.036) -- 0:00:22
704500 -- [-731.367] (-733.580) (-732.450) (-732.554) * (-733.136) [-731.851] (-733.662) (-739.054) -- 0:00:22
705000 -- (-731.378) (-731.547) (-731.601) [-732.336] * (-734.172) (-734.069) [-730.222] (-737.062) -- 0:00:22
Average standard deviation of split frequencies: 0.006594
705500 -- (-731.872) (-732.729) [-731.147] (-735.505) * [-734.919] (-734.300) (-734.007) (-733.983) -- 0:00:22
706000 -- (-735.954) (-737.009) [-731.589] (-734.256) * (-733.207) [-732.459] (-733.489) (-733.415) -- 0:00:22
706500 -- (-737.040) [-732.141] (-737.170) (-731.979) * [-734.151] (-737.065) (-733.939) (-733.935) -- 0:00:22
707000 -- [-734.837] (-734.617) (-732.344) (-730.787) * (-731.512) (-737.808) [-732.105] (-733.025) -- 0:00:21
707500 -- (-731.733) [-731.878] (-730.545) (-731.620) * (-734.216) [-735.598] (-731.228) (-731.915) -- 0:00:21
708000 -- (-728.782) (-736.998) (-731.832) [-730.969] * (-737.174) (-741.824) (-733.704) [-733.927] -- 0:00:21
708500 -- (-730.300) (-732.286) (-730.023) [-731.833] * [-734.079] (-736.974) (-733.946) (-734.773) -- 0:00:21
709000 -- (-731.541) (-734.745) (-731.125) [-733.888] * [-733.187] (-731.796) (-733.312) (-731.485) -- 0:00:21
709500 -- (-735.541) [-732.889] (-734.159) (-731.594) * (-732.999) (-729.372) [-730.799] (-731.736) -- 0:00:22
710000 -- (-735.205) (-731.071) (-731.484) [-734.115] * (-734.046) (-733.490) (-729.992) [-733.350] -- 0:00:22
Average standard deviation of split frequencies: 0.006675
710500 -- (-731.229) [-732.463] (-736.651) (-737.714) * (-732.928) [-733.061] (-737.105) (-730.867) -- 0:00:22
711000 -- (-738.084) [-730.936] (-735.399) (-735.949) * (-734.820) (-732.448) (-733.287) [-732.598] -- 0:00:21
711500 -- [-735.341] (-733.379) (-733.192) (-731.606) * (-733.079) (-732.499) (-735.752) [-731.134] -- 0:00:21
712000 -- (-732.084) [-731.124] (-733.962) (-732.765) * (-736.552) [-733.482] (-732.573) (-733.703) -- 0:00:21
712500 -- [-736.335] (-730.027) (-735.349) (-735.041) * (-735.191) [-730.131] (-736.285) (-734.278) -- 0:00:21
713000 -- (-735.405) (-735.153) (-734.885) [-731.302] * (-731.828) [-729.749] (-731.977) (-737.041) -- 0:00:21
713500 -- (-732.088) (-738.525) (-733.095) [-732.502] * (-733.510) [-732.294] (-735.007) (-731.680) -- 0:00:21
714000 -- (-733.086) (-735.034) [-731.835] (-732.995) * (-735.219) [-732.109] (-735.830) (-731.428) -- 0:00:21
714500 -- (-732.805) (-736.430) (-737.095) [-733.072] * [-731.308] (-730.936) (-730.506) (-737.516) -- 0:00:21
715000 -- [-731.586] (-731.300) (-740.728) (-731.378) * [-735.487] (-731.668) (-735.445) (-734.423) -- 0:00:21
Average standard deviation of split frequencies: 0.006584
715500 -- (-731.837) (-732.313) (-735.702) [-733.736] * (-733.652) [-732.638] (-734.254) (-732.216) -- 0:00:21
716000 -- (-736.391) [-735.583] (-732.035) (-731.927) * [-734.804] (-733.787) (-730.741) (-733.466) -- 0:00:21
716500 -- (-732.819) (-732.083) (-733.774) [-731.094] * (-734.153) (-730.037) [-732.065] (-731.978) -- 0:00:21
717000 -- (-733.261) (-731.954) [-730.830] (-730.219) * (-730.807) (-732.189) [-734.142] (-735.119) -- 0:00:21
717500 -- [-733.075] (-729.167) (-733.472) (-731.144) * [-732.851] (-735.452) (-732.463) (-736.638) -- 0:00:21
718000 -- (-733.700) [-730.594] (-734.992) (-730.712) * [-733.114] (-732.866) (-734.197) (-732.427) -- 0:00:21
718500 -- (-732.803) [-733.833] (-738.107) (-729.945) * (-732.943) (-731.881) (-733.386) [-734.100] -- 0:00:21
719000 -- [-730.663] (-733.776) (-733.428) (-729.437) * (-729.847) (-731.190) (-735.282) [-734.145] -- 0:00:21
719500 -- [-730.229] (-735.226) (-732.818) (-730.416) * (-729.221) (-732.379) [-736.063] (-733.582) -- 0:00:21
720000 -- [-731.201] (-737.300) (-736.320) (-731.031) * (-733.915) [-731.317] (-732.237) (-731.134) -- 0:00:20
Average standard deviation of split frequencies: 0.006459
720500 -- [-730.333] (-735.065) (-733.886) (-733.315) * (-732.781) (-732.733) (-732.198) [-731.329] -- 0:00:20
721000 -- (-731.881) [-732.960] (-729.934) (-731.382) * [-731.271] (-732.650) (-735.348) (-734.440) -- 0:00:20
721500 -- (-731.697) [-732.295] (-730.359) (-732.287) * (-733.784) [-732.659] (-732.764) (-731.902) -- 0:00:20
722000 -- (-731.081) (-732.916) (-730.493) [-737.142] * [-729.598] (-731.230) (-729.430) (-732.910) -- 0:00:20
722500 -- (-730.896) (-733.467) [-731.229] (-731.066) * (-731.420) (-733.025) (-734.171) [-733.387] -- 0:00:20
723000 -- (-733.583) [-731.143] (-733.685) (-734.346) * (-732.366) (-731.513) [-731.362] (-730.363) -- 0:00:21
723500 -- (-737.336) (-735.119) [-729.585] (-731.395) * [-731.714] (-735.124) (-731.742) (-737.499) -- 0:00:21
724000 -- [-730.224] (-732.201) (-731.886) (-731.319) * (-732.983) [-730.490] (-730.853) (-731.011) -- 0:00:20
724500 -- (-732.192) (-731.291) (-735.111) [-730.028] * (-735.118) (-733.711) (-732.171) [-734.285] -- 0:00:20
725000 -- (-735.309) [-731.126] (-735.538) (-728.733) * (-734.131) [-731.937] (-730.547) (-732.166) -- 0:00:20
Average standard deviation of split frequencies: 0.005884
725500 -- (-729.628) (-731.224) [-731.622] (-731.140) * (-731.904) (-732.583) (-733.027) [-732.668] -- 0:00:20
726000 -- (-732.302) (-731.507) [-733.658] (-732.716) * (-734.453) (-734.124) [-734.870] (-733.128) -- 0:00:20
726500 -- (-730.129) (-730.288) (-734.937) [-731.451] * (-733.537) (-736.726) [-732.598] (-732.875) -- 0:00:20
727000 -- [-732.101] (-732.636) (-732.884) (-730.045) * (-730.448) [-734.423] (-732.274) (-733.195) -- 0:00:20
727500 -- (-732.082) (-730.864) [-731.109] (-729.863) * (-733.835) (-732.712) [-735.114] (-736.519) -- 0:00:20
728000 -- (-729.699) (-734.791) [-731.397] (-731.519) * [-731.585] (-734.919) (-732.416) (-733.574) -- 0:00:20
728500 -- (-741.244) (-734.995) [-730.594] (-730.020) * (-734.896) [-733.447] (-736.199) (-736.415) -- 0:00:20
729000 -- (-734.339) [-736.253] (-734.163) (-729.279) * [-731.089] (-732.861) (-735.222) (-730.328) -- 0:00:20
729500 -- (-734.477) (-731.427) [-729.228] (-732.280) * [-729.242] (-735.321) (-735.745) (-735.670) -- 0:00:20
730000 -- (-731.861) (-730.163) (-732.058) [-732.883] * (-733.785) (-735.839) (-735.573) [-735.305] -- 0:00:20
Average standard deviation of split frequencies: 0.006072
730500 -- (-733.620) (-732.096) (-732.522) [-729.828] * (-733.233) [-732.162] (-731.678) (-732.181) -- 0:00:20
731000 -- (-728.485) (-735.199) (-735.851) [-729.494] * (-733.173) (-739.232) (-732.745) [-730.352] -- 0:00:20
731500 -- (-730.541) (-733.477) [-733.545] (-730.582) * (-731.033) (-735.348) [-731.924] (-730.690) -- 0:00:20
732000 -- (-734.669) (-731.725) (-731.282) [-729.342] * (-732.655) [-732.305] (-733.703) (-731.653) -- 0:00:20
732500 -- (-736.002) [-730.398] (-735.485) (-732.623) * (-735.195) [-731.014] (-732.301) (-731.335) -- 0:00:20
733000 -- (-731.835) [-730.445] (-733.077) (-733.506) * (-734.146) [-734.707] (-735.200) (-736.895) -- 0:00:20
733500 -- (-732.827) (-733.646) [-731.266] (-734.880) * [-732.653] (-735.070) (-737.209) (-731.337) -- 0:00:19
734000 -- (-733.271) (-731.377) [-731.066] (-729.727) * (-732.656) (-732.015) (-735.792) [-730.721] -- 0:00:19
734500 -- [-732.423] (-736.337) (-734.175) (-732.978) * [-732.087] (-733.452) (-732.869) (-731.219) -- 0:00:19
735000 -- (-735.416) (-731.982) (-734.224) [-731.161] * [-731.459] (-731.696) (-736.525) (-730.172) -- 0:00:19
Average standard deviation of split frequencies: 0.006234
735500 -- (-736.019) (-733.836) [-733.918] (-729.827) * (-731.650) (-734.337) [-730.972] (-732.063) -- 0:00:19
736000 -- (-735.070) (-733.854) (-733.774) [-730.076] * (-731.676) (-730.590) [-732.215] (-733.066) -- 0:00:19
736500 -- (-730.368) (-733.981) (-733.017) [-733.183] * (-731.685) [-733.728] (-731.267) (-732.372) -- 0:00:20
737000 -- (-730.451) (-742.142) [-731.507] (-735.526) * (-730.123) [-733.360] (-730.186) (-733.058) -- 0:00:19
737500 -- [-731.275] (-742.285) (-733.447) (-736.249) * (-731.124) (-732.378) [-730.938] (-733.381) -- 0:00:19
738000 -- (-733.863) (-734.847) (-733.441) [-732.314] * [-732.230] (-736.681) (-730.649) (-730.997) -- 0:00:19
738500 -- [-733.851] (-731.324) (-731.985) (-730.802) * (-730.178) (-729.961) (-732.921) [-731.010] -- 0:00:19
739000 -- [-731.867] (-731.245) (-735.685) (-731.876) * [-732.246] (-729.722) (-730.577) (-735.699) -- 0:00:19
739500 -- [-730.173] (-734.227) (-731.721) (-731.791) * [-729.830] (-736.789) (-733.923) (-730.228) -- 0:00:19
740000 -- (-733.389) (-732.633) (-733.684) [-734.471] * (-732.053) (-736.024) (-732.890) [-734.259] -- 0:00:19
Average standard deviation of split frequencies: 0.006152
740500 -- (-735.285) (-731.635) [-732.566] (-735.628) * (-733.915) (-735.271) (-732.017) [-732.419] -- 0:00:19
741000 -- (-733.681) (-731.752) (-736.009) [-734.121] * [-733.812] (-734.178) (-736.425) (-730.879) -- 0:00:19
741500 -- (-733.127) [-734.741] (-736.707) (-732.638) * (-731.450) (-734.328) [-734.069] (-733.847) -- 0:00:19
742000 -- (-734.458) (-733.524) (-731.204) [-731.076] * [-730.489] (-732.571) (-731.824) (-730.621) -- 0:00:19
742500 -- (-729.350) (-733.045) (-731.684) [-732.651] * [-729.210] (-731.571) (-732.326) (-729.818) -- 0:00:19
743000 -- [-733.807] (-731.062) (-731.725) (-732.787) * (-731.619) [-730.451] (-733.519) (-731.578) -- 0:00:19
743500 -- [-730.968] (-732.866) (-737.883) (-731.389) * (-734.394) (-731.513) (-740.401) [-730.110] -- 0:00:19
744000 -- [-731.411] (-732.687) (-736.561) (-733.664) * (-732.626) (-733.291) (-738.315) [-731.937] -- 0:00:19
744500 -- (-732.135) (-734.662) (-737.928) [-732.259] * [-733.847] (-736.602) (-731.103) (-730.236) -- 0:00:19
745000 -- (-731.991) [-735.241] (-735.246) (-731.852) * (-731.904) [-736.544] (-734.428) (-730.728) -- 0:00:19
Average standard deviation of split frequencies: 0.005645
745500 -- [-732.474] (-731.695) (-732.700) (-736.041) * (-733.911) (-735.200) (-731.134) [-735.446] -- 0:00:19
746000 -- (-730.467) [-731.618] (-734.364) (-740.295) * (-730.686) [-734.012] (-732.406) (-730.702) -- 0:00:19
746500 -- [-735.644] (-729.243) (-734.272) (-732.735) * (-737.866) (-729.474) (-737.276) [-731.235] -- 0:00:19
747000 -- (-734.199) (-735.339) [-735.552] (-736.505) * [-733.684] (-735.628) (-729.904) (-732.541) -- 0:00:18
747500 -- (-731.587) (-732.050) [-733.054] (-731.245) * (-732.152) (-731.061) [-730.726] (-734.974) -- 0:00:18
748000 -- (-730.620) (-730.959) [-730.937] (-732.385) * (-733.516) (-734.712) (-730.612) [-736.439] -- 0:00:18
748500 -- (-731.230) (-730.516) [-730.999] (-730.027) * (-732.108) (-734.587) [-731.812] (-732.132) -- 0:00:18
749000 -- (-736.271) (-731.748) (-732.547) [-730.565] * (-729.500) (-732.495) [-735.461] (-731.925) -- 0:00:18
749500 -- [-733.930] (-735.424) (-730.161) (-732.438) * (-733.019) [-734.680] (-730.963) (-731.866) -- 0:00:19
750000 -- [-733.069] (-734.314) (-733.121) (-734.686) * [-729.954] (-736.880) (-734.492) (-730.726) -- 0:00:19
Average standard deviation of split frequencies: 0.006465
750500 -- (-734.721) (-735.621) [-734.782] (-735.074) * (-730.879) [-733.488] (-732.279) (-732.165) -- 0:00:18
751000 -- (-732.876) (-734.635) (-738.780) [-730.546] * (-733.819) (-732.565) (-729.914) [-731.503] -- 0:00:18
751500 -- (-734.254) [-735.054] (-736.146) (-732.909) * (-730.680) (-734.676) [-728.872] (-730.224) -- 0:00:18
752000 -- (-731.889) (-731.348) (-735.450) [-730.764] * (-732.352) [-734.007] (-732.790) (-732.515) -- 0:00:18
752500 -- (-736.043) (-735.216) [-731.891] (-729.927) * (-733.522) (-732.979) [-729.997] (-731.806) -- 0:00:18
753000 -- (-734.650) (-729.904) [-730.908] (-731.592) * (-735.158) (-731.969) [-731.188] (-729.672) -- 0:00:18
753500 -- (-737.529) (-732.798) (-730.908) [-731.380] * [-733.615] (-733.300) (-731.083) (-730.748) -- 0:00:18
754000 -- (-730.442) (-733.145) (-732.161) [-733.005] * (-731.012) (-734.375) (-730.801) [-729.258] -- 0:00:18
754500 -- (-732.575) [-730.245] (-735.242) (-730.134) * [-733.301] (-732.142) (-733.989) (-735.278) -- 0:00:18
755000 -- (-732.496) (-731.133) (-733.185) [-730.250] * (-731.157) [-731.854] (-737.424) (-731.977) -- 0:00:18
Average standard deviation of split frequencies: 0.006274
755500 -- [-731.696] (-733.418) (-731.978) (-733.320) * (-731.623) [-732.201] (-735.041) (-734.560) -- 0:00:18
756000 -- (-734.445) (-734.697) (-736.511) [-729.953] * [-734.718] (-731.473) (-735.361) (-733.101) -- 0:00:18
756500 -- (-732.191) (-734.601) [-733.049] (-736.429) * (-732.222) (-731.727) (-729.886) [-730.766] -- 0:00:18
757000 -- (-731.680) (-735.433) (-735.246) [-730.723] * (-732.735) [-731.006] (-735.136) (-735.049) -- 0:00:18
757500 -- (-733.523) (-729.965) [-732.213] (-732.960) * [-730.866] (-733.056) (-732.599) (-729.268) -- 0:00:18
758000 -- (-731.001) (-731.855) [-730.961] (-733.539) * (-732.087) (-733.811) (-732.638) [-733.853] -- 0:00:18
758500 -- (-731.611) (-729.675) (-730.185) [-729.373] * [-729.651] (-734.715) (-731.689) (-739.784) -- 0:00:18
759000 -- (-733.546) (-733.175) [-730.017] (-730.612) * (-733.966) (-733.452) [-732.431] (-734.905) -- 0:00:18
759500 -- [-734.419] (-736.425) (-730.237) (-731.488) * (-733.471) (-733.793) (-734.396) [-732.886] -- 0:00:18
760000 -- (-732.314) (-734.216) (-731.537) [-729.704] * (-732.395) (-731.355) (-729.948) [-735.423] -- 0:00:18
Average standard deviation of split frequencies: 0.006430
760500 -- [-730.084] (-735.556) (-729.738) (-731.844) * [-733.386] (-731.280) (-737.328) (-732.600) -- 0:00:17
761000 -- (-734.842) [-732.359] (-733.007) (-733.530) * (-732.952) (-732.631) (-734.278) [-731.866] -- 0:00:17
761500 -- (-733.354) (-735.671) (-730.569) [-729.933] * [-730.488] (-732.811) (-735.834) (-732.781) -- 0:00:17
762000 -- (-734.668) (-732.571) [-732.012] (-730.566) * (-731.700) [-735.330] (-732.828) (-732.045) -- 0:00:17
762500 -- (-734.568) (-728.419) [-730.049] (-732.260) * (-730.634) (-732.694) [-733.074] (-737.307) -- 0:00:17
763000 -- [-735.912] (-734.486) (-731.432) (-730.277) * (-733.315) (-733.263) (-732.401) [-732.748] -- 0:00:18
763500 -- [-736.571] (-733.032) (-736.453) (-733.364) * [-730.607] (-733.307) (-733.091) (-731.681) -- 0:00:17
764000 -- [-730.617] (-736.564) (-735.465) (-732.869) * (-735.018) (-729.531) (-735.084) [-729.661] -- 0:00:17
764500 -- (-731.451) [-738.429] (-734.078) (-730.379) * [-735.253] (-733.248) (-735.255) (-733.643) -- 0:00:17
765000 -- (-731.339) (-733.676) (-733.354) [-731.732] * (-732.673) [-731.487] (-734.447) (-733.361) -- 0:00:17
Average standard deviation of split frequencies: 0.006539
765500 -- (-731.770) (-738.346) [-729.884] (-730.382) * (-738.138) (-732.507) (-731.616) [-730.870] -- 0:00:17
766000 -- (-733.458) (-734.145) (-735.559) [-731.559] * (-731.126) (-732.821) (-734.477) [-728.747] -- 0:00:17
766500 -- (-734.928) [-730.855] (-731.944) (-735.590) * (-731.057) (-732.934) [-731.499] (-730.807) -- 0:00:17
767000 -- (-731.493) (-732.905) [-732.760] (-732.586) * (-735.135) (-730.139) (-733.526) [-731.394] -- 0:00:17
767500 -- [-732.155] (-732.794) (-729.892) (-734.875) * (-735.156) (-732.253) [-730.106] (-731.777) -- 0:00:17
768000 -- (-732.316) (-731.608) [-731.897] (-735.385) * (-733.528) (-735.564) (-730.513) [-733.428] -- 0:00:17
768500 -- [-731.031] (-732.156) (-732.429) (-730.940) * (-738.342) (-736.874) (-731.262) [-731.977] -- 0:00:17
769000 -- (-733.686) [-731.647] (-731.036) (-730.924) * (-733.597) (-734.128) (-736.568) [-730.676] -- 0:00:17
769500 -- (-734.821) [-730.743] (-733.747) (-733.531) * (-730.747) [-731.767] (-730.759) (-736.058) -- 0:00:17
770000 -- [-731.056] (-733.795) (-732.956) (-732.635) * (-734.150) (-734.333) [-731.531] (-732.961) -- 0:00:17
Average standard deviation of split frequencies: 0.006346
770500 -- (-735.298) (-731.096) [-730.819] (-732.851) * [-733.867] (-731.637) (-743.045) (-729.468) -- 0:00:17
771000 -- (-731.560) [-731.257] (-733.051) (-732.309) * [-729.869] (-729.773) (-740.613) (-732.666) -- 0:00:17
771500 -- [-730.936] (-733.005) (-736.062) (-733.246) * (-735.093) [-729.939] (-731.132) (-734.285) -- 0:00:17
772000 -- [-732.304] (-732.903) (-733.083) (-734.020) * (-729.466) [-733.021] (-730.275) (-732.065) -- 0:00:17
772500 -- (-732.184) (-730.086) (-738.426) [-732.042] * (-732.559) (-733.149) [-731.530] (-737.822) -- 0:00:17
773000 -- [-731.395] (-734.076) (-734.242) (-733.971) * (-732.937) (-734.543) (-731.910) [-739.812] -- 0:00:17
773500 -- (-730.281) [-730.152] (-737.765) (-735.910) * (-736.543) (-735.651) [-731.580] (-736.119) -- 0:00:16
774000 -- (-729.157) (-732.725) (-733.230) [-731.560] * (-730.537) (-733.306) (-732.569) [-730.570] -- 0:00:16
774500 -- (-728.695) [-732.041] (-732.612) (-735.602) * [-733.052] (-731.472) (-731.473) (-731.574) -- 0:00:16
775000 -- (-731.925) (-734.079) [-734.403] (-732.900) * (-732.445) [-733.102] (-733.087) (-733.072) -- 0:00:16
Average standard deviation of split frequencies: 0.006379
775500 -- (-731.253) [-735.025] (-735.265) (-732.183) * [-733.278] (-729.393) (-731.896) (-730.972) -- 0:00:16
776000 -- (-733.917) (-730.827) (-734.273) [-731.957] * (-731.859) [-730.058] (-734.870) (-739.785) -- 0:00:16
776500 -- (-732.414) (-732.971) (-731.694) [-733.552] * (-731.593) [-730.814] (-732.519) (-732.550) -- 0:00:16
777000 -- (-733.498) (-731.114) (-731.256) [-730.985] * (-731.245) [-730.916] (-731.581) (-733.297) -- 0:00:16
777500 -- (-730.641) [-731.566] (-729.829) (-732.430) * (-732.390) (-732.279) [-733.339] (-731.871) -- 0:00:16
778000 -- (-731.015) [-729.916] (-732.086) (-734.950) * [-731.354] (-730.597) (-735.752) (-733.850) -- 0:00:16
778500 -- (-730.560) (-730.039) (-735.200) [-733.354] * (-731.910) (-731.764) (-731.679) [-730.955] -- 0:00:16
779000 -- [-730.914] (-730.851) (-732.857) (-732.334) * (-736.034) (-732.996) [-739.118] (-736.089) -- 0:00:16
779500 -- (-728.979) [-729.892] (-734.946) (-734.619) * (-732.709) [-732.854] (-731.540) (-733.225) -- 0:00:16
780000 -- [-731.753] (-733.701) (-734.360) (-730.884) * (-733.791) (-733.148) [-731.509] (-732.852) -- 0:00:16
Average standard deviation of split frequencies: 0.006378
780500 -- [-734.745] (-730.797) (-730.782) (-735.023) * (-732.968) [-730.063] (-731.840) (-734.282) -- 0:00:16
781000 -- (-737.513) [-731.596] (-732.940) (-729.877) * (-734.039) [-730.715] (-732.875) (-734.512) -- 0:00:16
781500 -- (-734.022) [-732.060] (-731.630) (-732.140) * (-733.320) [-731.825] (-731.828) (-734.478) -- 0:00:16
782000 -- [-732.281] (-731.097) (-729.594) (-733.222) * [-731.139] (-731.222) (-732.363) (-732.964) -- 0:00:16
782500 -- (-738.638) (-732.727) [-731.627] (-732.030) * (-733.507) (-733.360) (-731.722) [-733.572] -- 0:00:16
783000 -- (-736.092) (-729.433) (-731.353) [-731.617] * [-733.723] (-732.449) (-730.503) (-733.485) -- 0:00:16
783500 -- (-733.943) (-733.495) [-733.517] (-732.795) * [-732.526] (-731.517) (-732.527) (-733.492) -- 0:00:16
784000 -- (-734.268) (-737.214) (-732.954) [-731.566] * (-731.716) (-730.834) [-735.322] (-734.386) -- 0:00:16
784500 -- [-734.541] (-737.775) (-729.882) (-732.103) * (-732.347) (-733.209) [-732.992] (-735.546) -- 0:00:16
785000 -- (-730.936) (-731.712) (-731.864) [-734.398] * (-732.580) [-730.847] (-729.580) (-730.322) -- 0:00:16
Average standard deviation of split frequencies: 0.006350
785500 -- (-732.526) (-730.485) [-730.477] (-736.527) * [-731.483] (-731.582) (-734.031) (-731.467) -- 0:00:16
786000 -- (-732.910) (-732.259) (-728.920) [-738.427] * (-735.033) (-735.492) (-731.795) [-731.970] -- 0:00:16
786500 -- (-736.589) (-730.166) (-731.115) [-733.837] * (-735.974) (-734.677) (-732.162) [-733.792] -- 0:00:16
787000 -- [-733.922] (-731.016) (-732.533) (-733.347) * (-731.010) (-732.855) (-730.504) [-731.455] -- 0:00:15
787500 -- [-730.582] (-736.774) (-731.036) (-732.875) * (-731.153) (-733.924) (-731.826) [-733.874] -- 0:00:15
788000 -- [-731.271] (-732.749) (-729.276) (-731.680) * (-735.369) [-731.566] (-735.135) (-734.194) -- 0:00:15
788500 -- (-733.744) [-736.315] (-734.146) (-732.428) * (-731.838) (-731.314) (-734.891) [-735.474] -- 0:00:15
789000 -- (-738.153) [-732.308] (-733.232) (-733.075) * (-730.959) (-731.390) (-733.272) [-734.889] -- 0:00:15
789500 -- (-731.583) (-732.773) [-730.553] (-731.031) * [-737.087] (-736.615) (-732.654) (-732.459) -- 0:00:15
790000 -- (-730.955) [-732.216] (-734.007) (-734.730) * (-732.645) (-733.132) (-731.259) [-732.091] -- 0:00:15
Average standard deviation of split frequencies: 0.006208
790500 -- [-731.210] (-734.054) (-733.704) (-731.347) * (-732.436) (-730.565) [-730.907] (-734.182) -- 0:00:15
791000 -- (-730.999) [-735.480] (-735.678) (-733.894) * (-732.225) (-730.891) [-731.054] (-737.748) -- 0:00:15
791500 -- [-729.739] (-734.100) (-737.044) (-732.768) * (-735.629) (-733.510) [-730.569] (-735.944) -- 0:00:15
792000 -- (-731.851) [-734.129] (-735.607) (-733.450) * (-736.192) (-733.857) (-730.169) [-730.990] -- 0:00:15
792500 -- (-731.737) (-732.079) (-733.157) [-734.019] * (-736.389) [-728.970] (-730.331) (-729.375) -- 0:00:15
793000 -- (-729.755) (-730.499) [-734.609] (-729.788) * (-741.638) (-730.930) (-733.701) [-731.459] -- 0:00:15
793500 -- (-729.077) [-730.840] (-732.561) (-732.784) * (-732.598) [-734.337] (-733.439) (-735.594) -- 0:00:15
794000 -- (-728.998) (-732.810) (-734.246) [-735.922] * [-739.046] (-735.032) (-734.413) (-734.484) -- 0:00:15
794500 -- (-729.478) (-733.630) [-732.936] (-730.746) * (-733.184) (-733.762) (-733.583) [-732.104] -- 0:00:15
795000 -- [-731.214] (-731.157) (-733.053) (-736.000) * (-734.849) [-731.531] (-735.904) (-732.602) -- 0:00:15
Average standard deviation of split frequencies: 0.006410
795500 -- (-732.700) (-732.353) (-733.380) [-734.091] * (-736.303) (-733.073) (-733.928) [-730.052] -- 0:00:15
796000 -- [-729.331] (-734.268) (-734.453) (-733.555) * (-734.792) (-732.953) [-734.951] (-732.550) -- 0:00:15
796500 -- (-729.996) [-733.489] (-733.811) (-734.338) * (-736.844) [-731.252] (-732.120) (-734.403) -- 0:00:15
797000 -- (-730.159) [-730.394] (-738.266) (-732.422) * (-730.462) [-729.467] (-732.419) (-735.490) -- 0:00:15
797500 -- (-731.433) (-736.030) (-732.576) [-730.441] * (-735.498) (-730.273) [-735.554] (-729.812) -- 0:00:15
798000 -- (-732.037) (-732.739) (-734.912) [-733.851] * (-732.875) (-731.310) (-731.233) [-729.404] -- 0:00:15
798500 -- (-730.503) [-733.840] (-733.388) (-729.464) * (-730.398) [-729.640] (-730.762) (-734.052) -- 0:00:15
799000 -- (-732.439) (-731.962) (-734.533) [-730.807] * (-729.420) (-732.109) [-733.111] (-730.009) -- 0:00:15
799500 -- (-733.743) [-734.416] (-731.003) (-733.173) * (-733.130) (-732.204) [-732.639] (-733.706) -- 0:00:15
800000 -- (-732.591) [-731.835] (-731.669) (-735.299) * (-735.801) (-734.049) (-737.746) [-731.484] -- 0:00:14
Average standard deviation of split frequencies: 0.006199
800500 -- [-732.135] (-734.668) (-732.990) (-731.892) * (-730.614) (-734.620) [-730.075] (-732.882) -- 0:00:14
801000 -- (-731.273) (-732.970) [-731.974] (-733.157) * (-732.144) [-731.361] (-735.773) (-731.223) -- 0:00:14
801500 -- (-731.100) [-731.223] (-732.196) (-730.834) * (-732.143) (-731.966) [-733.268] (-733.498) -- 0:00:14
802000 -- (-731.738) [-737.275] (-735.862) (-733.100) * (-729.159) [-731.883] (-732.306) (-738.266) -- 0:00:14
802500 -- (-733.778) [-729.725] (-736.083) (-734.963) * (-732.806) (-735.777) (-731.794) [-735.691] -- 0:00:14
803000 -- (-737.502) (-730.422) [-735.545] (-728.628) * [-729.639] (-731.708) (-732.154) (-730.513) -- 0:00:14
803500 -- (-730.308) (-730.627) [-733.678] (-735.024) * (-731.170) (-732.295) [-728.980] (-730.548) -- 0:00:14
804000 -- (-735.442) [-731.005] (-730.871) (-729.936) * (-734.339) (-733.390) (-731.083) [-731.462] -- 0:00:14
804500 -- (-738.180) [-730.435] (-733.787) (-729.861) * (-730.309) (-736.205) (-731.028) [-732.740] -- 0:00:14
805000 -- [-731.816] (-732.572) (-731.649) (-732.410) * (-732.824) [-736.150] (-733.258) (-736.214) -- 0:00:14
Average standard deviation of split frequencies: 0.006640
805500 -- (-732.052) (-732.693) (-733.907) [-733.458] * (-733.562) [-732.675] (-734.854) (-730.523) -- 0:00:14
806000 -- (-734.521) [-732.469] (-734.907) (-732.171) * (-732.907) (-733.287) [-729.630] (-730.278) -- 0:00:14
806500 -- [-733.005] (-732.525) (-734.203) (-731.624) * (-735.760) (-735.396) [-735.241] (-731.844) -- 0:00:14
807000 -- (-731.446) [-730.925] (-736.534) (-734.078) * (-734.692) (-732.202) [-729.247] (-733.058) -- 0:00:14
807500 -- [-736.399] (-731.147) (-731.899) (-730.613) * (-733.525) (-735.226) [-730.843] (-731.240) -- 0:00:14
808000 -- (-733.599) (-731.908) (-730.741) [-730.976] * [-730.339] (-734.843) (-738.148) (-730.344) -- 0:00:14
808500 -- (-732.816) [-732.669] (-734.616) (-731.897) * (-737.527) (-737.481) [-730.654] (-731.551) -- 0:00:14
809000 -- (-730.664) (-731.796) (-731.253) [-728.286] * [-730.918] (-734.173) (-737.161) (-730.206) -- 0:00:14
809500 -- [-732.469] (-732.310) (-730.649) (-733.633) * (-737.256) (-734.564) [-741.288] (-730.762) -- 0:00:14
810000 -- (-735.360) (-733.565) [-730.175] (-731.213) * (-732.774) [-733.614] (-740.332) (-738.067) -- 0:00:14
Average standard deviation of split frequencies: 0.007252
810500 -- (-731.365) [-733.560] (-732.528) (-733.628) * [-730.726] (-734.055) (-732.498) (-735.262) -- 0:00:14
811000 -- (-732.370) (-735.264) (-736.571) [-730.949] * (-730.286) (-736.648) [-734.077] (-732.503) -- 0:00:14
811500 -- [-729.169] (-739.074) (-733.848) (-733.561) * (-732.209) (-730.471) (-734.634) [-732.820] -- 0:00:14
812000 -- [-730.502] (-731.985) (-741.901) (-733.666) * (-729.579) (-732.780) (-730.737) [-734.855] -- 0:00:14
812500 -- (-733.854) [-734.323] (-737.085) (-730.440) * (-733.995) [-729.143] (-732.984) (-730.725) -- 0:00:14
813000 -- (-732.195) [-730.886] (-729.638) (-728.277) * (-732.770) [-729.240] (-732.027) (-734.646) -- 0:00:14
813500 -- [-733.067] (-732.273) (-730.388) (-731.526) * [-733.575] (-730.020) (-734.199) (-734.099) -- 0:00:13
814000 -- (-733.776) (-732.304) [-734.930] (-732.831) * (-730.279) (-731.404) [-730.237] (-731.428) -- 0:00:13
814500 -- (-731.422) (-737.129) [-730.800] (-729.917) * [-731.066] (-737.221) (-735.929) (-729.809) -- 0:00:13
815000 -- (-734.430) (-731.484) (-730.713) [-730.998] * [-731.300] (-733.992) (-733.251) (-731.507) -- 0:00:13
Average standard deviation of split frequencies: 0.007136
815500 -- (-731.888) (-731.096) [-731.910] (-731.199) * (-731.238) (-731.425) [-733.866] (-730.636) -- 0:00:13
816000 -- (-736.065) (-731.103) [-733.018] (-732.171) * [-731.252] (-729.634) (-737.260) (-731.994) -- 0:00:13
816500 -- [-733.153] (-732.633) (-733.490) (-733.644) * (-730.880) (-731.481) (-732.794) [-731.251] -- 0:00:13
817000 -- (-732.401) (-729.613) [-734.071] (-731.631) * (-733.980) (-733.424) [-729.975] (-733.067) -- 0:00:13
817500 -- (-733.294) (-736.194) [-734.131] (-731.619) * [-730.836] (-735.124) (-729.349) (-731.409) -- 0:00:13
818000 -- (-731.624) [-731.636] (-733.779) (-735.555) * (-731.894) (-731.394) (-732.541) [-731.425] -- 0:00:13
818500 -- (-735.852) (-736.369) [-734.645] (-740.761) * (-731.701) (-735.940) [-736.007] (-731.330) -- 0:00:13
819000 -- (-735.674) (-734.387) [-736.490] (-731.247) * [-735.012] (-732.298) (-735.085) (-730.188) -- 0:00:13
819500 -- (-736.521) (-735.338) [-733.244] (-729.797) * (-732.377) [-730.671] (-731.709) (-733.751) -- 0:00:13
820000 -- (-732.628) (-731.870) (-731.630) [-732.614] * (-732.124) (-730.647) [-732.057] (-733.059) -- 0:00:13
Average standard deviation of split frequencies: 0.007199
820500 -- (-733.067) (-730.924) [-730.866] (-731.140) * (-733.956) [-732.479] (-731.659) (-731.912) -- 0:00:13
821000 -- (-732.076) [-730.492] (-730.943) (-732.349) * (-735.088) (-731.807) [-729.101] (-732.291) -- 0:00:13
821500 -- (-733.396) (-732.962) [-733.730] (-732.895) * (-732.293) (-733.277) [-729.721] (-731.275) -- 0:00:13
822000 -- (-730.116) (-734.875) [-738.047] (-732.538) * (-734.039) (-733.531) [-730.955] (-734.191) -- 0:00:13
822500 -- [-733.160] (-732.932) (-734.398) (-735.109) * (-732.412) (-735.383) (-733.940) [-731.549] -- 0:00:13
823000 -- (-732.733) (-728.715) (-741.475) [-734.363] * (-738.901) (-735.702) [-733.898] (-734.215) -- 0:00:13
823500 -- (-730.423) [-728.271] (-740.909) (-733.610) * (-732.421) (-732.085) [-731.651] (-731.786) -- 0:00:13
824000 -- [-735.202] (-729.516) (-743.432) (-734.262) * (-730.561) [-732.401] (-731.191) (-730.125) -- 0:00:13
824500 -- (-730.305) [-729.779] (-737.021) (-736.812) * (-729.560) [-730.632] (-732.150) (-729.948) -- 0:00:13
825000 -- (-737.240) (-730.941) (-731.958) [-733.745] * (-733.372) [-730.815] (-731.103) (-731.187) -- 0:00:13
Average standard deviation of split frequencies: 0.007453
825500 -- (-734.305) (-730.029) [-734.701] (-733.514) * (-731.619) (-730.720) (-734.094) [-729.956] -- 0:00:13
826000 -- (-733.899) [-729.260] (-733.387) (-733.621) * [-732.269] (-731.724) (-730.317) (-730.103) -- 0:00:13
826500 -- [-733.111] (-732.639) (-732.032) (-731.138) * [-732.554] (-733.497) (-733.999) (-733.119) -- 0:00:13
827000 -- (-736.873) [-731.590] (-735.157) (-732.672) * (-731.075) (-731.393) [-732.302] (-730.629) -- 0:00:12
827500 -- (-733.775) (-731.880) [-732.251] (-731.619) * (-731.170) [-735.874] (-732.978) (-730.692) -- 0:00:12
828000 -- (-734.234) [-731.850] (-737.633) (-731.240) * [-734.619] (-734.606) (-730.379) (-731.584) -- 0:00:12
828500 -- (-731.602) (-731.653) (-733.110) [-730.729] * (-733.933) [-732.537] (-735.316) (-731.449) -- 0:00:12
829000 -- (-731.827) (-729.693) [-731.920] (-732.990) * (-734.414) [-734.017] (-736.508) (-732.338) -- 0:00:12
829500 -- (-731.648) (-732.666) [-730.383] (-733.509) * [-730.166] (-732.641) (-735.707) (-731.523) -- 0:00:12
830000 -- (-733.908) [-731.125] (-733.766) (-733.357) * [-731.858] (-734.203) (-732.024) (-730.919) -- 0:00:12
Average standard deviation of split frequencies: 0.006845
830500 -- (-731.938) [-735.610] (-732.434) (-735.218) * (-733.545) [-733.313] (-731.003) (-732.258) -- 0:00:12
831000 -- (-731.027) (-734.467) (-731.822) [-735.167] * [-731.207] (-734.078) (-732.084) (-733.920) -- 0:00:12
831500 -- (-729.428) (-735.314) [-732.551] (-731.944) * (-733.702) (-731.708) (-733.245) [-734.433] -- 0:00:12
832000 -- [-731.121] (-735.117) (-730.753) (-733.707) * [-730.960] (-730.901) (-730.734) (-735.496) -- 0:00:12
832500 -- [-731.194] (-731.731) (-731.271) (-735.252) * (-731.748) [-733.504] (-728.389) (-733.865) -- 0:00:12
833000 -- (-736.198) (-731.590) [-730.356] (-731.848) * (-735.697) (-730.251) [-731.470] (-732.757) -- 0:00:12
833500 -- (-730.175) [-730.174] (-729.483) (-736.156) * [-728.152] (-730.021) (-731.675) (-732.180) -- 0:00:12
834000 -- [-731.357] (-734.218) (-732.309) (-734.750) * (-728.724) (-730.426) (-734.797) [-731.100] -- 0:00:12
834500 -- (-734.807) (-731.397) (-729.123) [-735.095] * [-731.237] (-733.385) (-732.624) (-735.546) -- 0:00:12
835000 -- (-737.176) (-738.866) [-732.728] (-736.393) * (-734.562) [-737.690] (-732.738) (-732.310) -- 0:00:12
Average standard deviation of split frequencies: 0.006767
835500 -- (-736.829) [-732.693] (-735.237) (-731.950) * [-734.539] (-732.822) (-730.037) (-732.615) -- 0:00:12
836000 -- (-731.798) (-730.752) (-733.360) [-731.871] * (-732.959) [-731.649] (-731.505) (-731.878) -- 0:00:12
836500 -- (-731.011) [-732.329] (-732.076) (-733.318) * (-732.761) (-734.660) [-730.424] (-733.953) -- 0:00:12
837000 -- (-734.011) [-732.521] (-731.033) (-732.431) * (-733.990) [-732.976] (-730.614) (-730.009) -- 0:00:12
837500 -- (-734.314) [-731.849] (-730.781) (-733.638) * (-731.283) (-729.121) (-731.816) [-733.297] -- 0:00:12
838000 -- (-732.187) [-732.549] (-731.657) (-728.376) * [-730.389] (-735.369) (-729.775) (-733.784) -- 0:00:12
838500 -- (-731.373) (-731.086) [-732.059] (-731.552) * [-733.047] (-733.257) (-730.666) (-731.057) -- 0:00:12
839000 -- [-730.705] (-730.499) (-730.782) (-731.226) * [-732.740] (-735.726) (-734.360) (-730.580) -- 0:00:12
839500 -- (-728.671) (-729.189) [-733.641] (-730.759) * (-729.363) (-736.648) [-731.294] (-729.180) -- 0:00:12
840000 -- (-729.474) [-735.146] (-733.038) (-730.443) * [-731.754] (-735.350) (-731.649) (-731.846) -- 0:00:11
Average standard deviation of split frequencies: 0.006692
840500 -- (-736.074) [-733.608] (-730.952) (-735.360) * (-732.044) [-733.818] (-735.161) (-731.619) -- 0:00:11
841000 -- (-732.881) (-733.272) [-731.786] (-732.080) * (-733.831) (-730.863) (-732.651) [-733.762] -- 0:00:11
841500 -- (-730.807) [-733.907] (-732.402) (-731.403) * [-731.366] (-732.253) (-732.902) (-732.153) -- 0:00:11
842000 -- (-738.629) [-731.891] (-734.023) (-731.003) * (-738.177) (-733.930) [-730.748] (-732.524) -- 0:00:11
842500 -- (-735.962) (-731.831) (-734.300) [-732.688] * [-730.116] (-732.655) (-735.215) (-732.254) -- 0:00:11
843000 -- (-733.946) (-734.059) [-730.740] (-732.809) * (-733.436) [-736.588] (-734.190) (-732.952) -- 0:00:11
843500 -- [-731.854] (-734.314) (-733.566) (-733.881) * (-736.732) (-732.633) [-732.085] (-736.297) -- 0:00:11
844000 -- [-729.138] (-737.821) (-735.478) (-733.853) * [-733.125] (-732.144) (-731.908) (-737.733) -- 0:00:11
844500 -- (-734.123) [-733.596] (-734.130) (-731.651) * (-732.685) (-735.446) (-731.966) [-736.241] -- 0:00:11
845000 -- (-729.668) (-731.703) (-732.624) [-735.015] * (-734.945) [-732.271] (-737.742) (-735.243) -- 0:00:11
Average standard deviation of split frequencies: 0.006241
845500 -- (-732.715) (-733.032) (-739.083) [-731.194] * (-734.548) (-736.164) [-731.544] (-731.902) -- 0:00:11
846000 -- (-732.293) (-735.480) (-734.039) [-730.532] * [-732.635] (-730.400) (-730.586) (-733.721) -- 0:00:11
846500 -- (-733.032) [-731.775] (-733.452) (-730.767) * (-737.454) (-730.197) [-735.860] (-736.102) -- 0:00:11
847000 -- (-733.732) (-732.217) [-730.526] (-731.647) * [-732.333] (-731.710) (-735.812) (-736.598) -- 0:00:11
847500 -- (-738.759) (-731.944) (-733.254) [-730.284] * (-732.460) (-732.265) (-735.919) [-731.381] -- 0:00:11
848000 -- (-739.904) [-732.923] (-732.191) (-732.954) * (-730.189) (-733.690) [-732.730] (-734.611) -- 0:00:11
848500 -- (-733.187) [-733.181] (-732.270) (-730.517) * (-736.890) [-730.043] (-732.365) (-732.400) -- 0:00:11
849000 -- [-728.823] (-733.159) (-732.622) (-732.736) * (-737.556) (-730.698) [-732.334] (-731.742) -- 0:00:11
849500 -- (-729.599) (-732.828) (-732.787) [-730.153] * (-734.720) (-732.977) (-731.081) [-732.551] -- 0:00:11
850000 -- (-729.553) [-730.984] (-733.789) (-736.444) * (-731.063) (-731.076) [-733.026] (-739.137) -- 0:00:11
Average standard deviation of split frequencies: 0.006022
850500 -- [-731.198] (-729.867) (-731.800) (-731.235) * [-731.620] (-729.104) (-733.605) (-734.380) -- 0:00:11
851000 -- (-729.146) [-729.020] (-732.408) (-729.937) * (-732.477) [-730.860] (-735.664) (-734.198) -- 0:00:11
851500 -- [-730.260] (-735.762) (-736.833) (-732.102) * (-734.604) (-730.906) [-732.271] (-730.783) -- 0:00:11
852000 -- (-731.793) (-731.313) (-730.659) [-730.663] * (-734.401) (-744.195) [-732.867] (-732.590) -- 0:00:11
852500 -- (-731.746) (-730.924) (-734.878) [-733.838] * (-730.820) (-738.376) (-734.382) [-732.136] -- 0:00:11
853000 -- (-734.934) (-731.771) (-735.326) [-732.901] * (-733.900) [-737.121] (-731.458) (-737.490) -- 0:00:11
853500 -- (-735.076) [-732.940] (-735.767) (-734.157) * [-734.670] (-730.334) (-735.514) (-735.262) -- 0:00:10
854000 -- (-732.051) (-732.004) [-734.016] (-731.668) * (-730.706) [-729.550] (-732.332) (-736.280) -- 0:00:10
854500 -- (-733.646) (-732.666) [-732.206] (-732.658) * [-731.545] (-729.824) (-731.058) (-736.647) -- 0:00:10
855000 -- (-733.014) (-731.744) [-733.083] (-733.967) * (-732.582) (-734.920) (-733.190) [-732.083] -- 0:00:10
Average standard deviation of split frequencies: 0.006608
855500 -- (-734.918) (-729.966) (-736.410) [-731.480] * [-733.768] (-732.986) (-730.511) (-732.300) -- 0:00:10
856000 -- (-731.387) (-731.168) (-733.706) [-728.881] * (-730.920) (-736.276) [-729.894] (-735.715) -- 0:00:10
856500 -- (-730.742) [-730.851] (-732.192) (-729.408) * (-731.226) (-732.820) [-731.700] (-732.785) -- 0:00:10
857000 -- [-731.256] (-731.626) (-734.118) (-732.084) * (-730.814) (-734.551) (-732.978) [-730.913] -- 0:00:10
857500 -- (-729.981) [-735.111] (-732.652) (-729.919) * (-733.956) (-734.253) [-731.540] (-734.450) -- 0:00:10
858000 -- (-731.618) (-734.682) [-732.352] (-732.428) * [-731.273] (-731.556) (-732.144) (-732.158) -- 0:00:10
858500 -- (-732.833) (-733.693) (-731.303) [-732.999] * [-731.577] (-733.365) (-731.912) (-732.847) -- 0:00:10
859000 -- (-732.965) (-731.736) (-735.120) [-731.897] * (-730.217) [-731.014] (-729.480) (-730.196) -- 0:00:10
859500 -- (-735.764) (-731.370) [-734.073] (-738.743) * (-733.518) [-732.250] (-738.665) (-731.644) -- 0:00:10
860000 -- [-735.109] (-732.423) (-732.859) (-732.554) * [-729.180] (-731.433) (-739.366) (-733.075) -- 0:00:10
Average standard deviation of split frequencies: 0.006536
860500 -- (-733.596) (-734.858) [-740.911] (-731.401) * [-729.927] (-731.018) (-738.874) (-730.307) -- 0:00:10
861000 -- (-730.764) [-729.330] (-731.593) (-734.032) * [-728.616] (-731.341) (-738.396) (-731.661) -- 0:00:10
861500 -- (-732.896) [-732.832] (-735.747) (-731.226) * (-731.949) (-731.469) [-730.053] (-734.982) -- 0:00:10
862000 -- [-730.497] (-731.781) (-731.537) (-736.335) * (-737.901) [-731.173] (-731.928) (-731.991) -- 0:00:10
862500 -- (-735.464) (-734.520) [-732.654] (-731.416) * (-734.495) (-731.062) [-733.084] (-731.995) -- 0:00:10
863000 -- (-735.371) (-729.227) (-733.821) [-733.522] * (-732.117) (-731.159) [-731.977] (-731.969) -- 0:00:10
863500 -- [-730.780] (-731.238) (-736.799) (-732.798) * (-735.225) [-733.974] (-732.433) (-732.861) -- 0:00:10
864000 -- (-731.681) (-730.515) [-734.417] (-733.500) * (-731.315) [-730.080] (-741.404) (-732.849) -- 0:00:10
864500 -- [-731.617] (-731.420) (-739.177) (-734.787) * (-732.212) [-729.353] (-731.256) (-733.470) -- 0:00:10
865000 -- (-731.432) (-736.611) (-732.905) [-735.793] * [-732.016] (-733.173) (-731.637) (-729.907) -- 0:00:10
Average standard deviation of split frequencies: 0.006820
865500 -- (-730.504) (-731.073) [-732.423] (-738.435) * (-733.082) [-730.792] (-738.006) (-731.350) -- 0:00:10
866000 -- (-732.530) (-731.155) [-734.525] (-735.459) * [-731.555] (-731.687) (-738.281) (-733.473) -- 0:00:10
866500 -- (-734.343) (-731.577) [-729.414] (-730.330) * [-733.026] (-732.160) (-735.018) (-729.259) -- 0:00:10
867000 -- [-736.517] (-734.339) (-732.912) (-731.620) * [-729.897] (-732.464) (-737.116) (-728.867) -- 0:00:09
867500 -- (-732.268) (-730.975) [-735.872] (-735.670) * (-737.404) [-736.456] (-732.285) (-733.751) -- 0:00:09
868000 -- (-732.286) (-735.315) (-734.036) [-730.929] * (-730.869) [-735.688] (-733.319) (-730.631) -- 0:00:09
868500 -- [-732.254] (-735.463) (-735.440) (-731.585) * (-736.017) [-733.311] (-733.230) (-730.752) -- 0:00:09
869000 -- (-731.996) (-734.119) [-730.361] (-732.635) * (-735.061) [-730.544] (-731.284) (-731.592) -- 0:00:09
869500 -- (-736.685) (-735.460) [-731.467] (-731.385) * (-733.044) [-732.136] (-734.432) (-732.362) -- 0:00:09
870000 -- [-729.531] (-734.609) (-736.933) (-734.021) * (-733.119) (-729.777) (-732.479) [-729.518] -- 0:00:09
Average standard deviation of split frequencies: 0.006625
870500 -- (-730.934) (-735.966) [-735.225] (-737.688) * (-731.365) (-731.968) [-734.921] (-729.432) -- 0:00:09
871000 -- (-730.860) [-732.223] (-731.487) (-733.327) * (-731.812) (-735.114) (-733.499) [-728.902] -- 0:00:09
871500 -- [-730.354] (-732.556) (-738.098) (-733.969) * (-730.443) [-732.754] (-736.141) (-734.174) -- 0:00:09
872000 -- [-734.946] (-734.332) (-734.566) (-734.496) * (-733.643) [-732.305] (-729.913) (-735.774) -- 0:00:09
872500 -- (-731.443) (-730.479) [-732.129] (-738.099) * (-736.078) (-732.271) [-731.374] (-729.983) -- 0:00:09
873000 -- (-729.741) [-734.248] (-735.240) (-735.160) * [-735.586] (-730.979) (-732.657) (-731.539) -- 0:00:09
873500 -- (-733.841) [-732.071] (-730.175) (-733.270) * [-734.056] (-730.566) (-731.149) (-733.239) -- 0:00:09
874000 -- (-733.164) [-732.798] (-732.408) (-734.696) * (-734.011) [-731.487] (-736.313) (-732.189) -- 0:00:09
874500 -- (-734.164) (-731.121) [-737.338] (-733.785) * (-737.012) [-729.918] (-736.230) (-734.063) -- 0:00:09
875000 -- (-731.107) (-732.590) [-735.172] (-731.574) * (-735.282) [-734.870] (-734.313) (-735.288) -- 0:00:09
Average standard deviation of split frequencies: 0.006727
875500 -- (-732.664) (-730.738) [-733.762] (-731.374) * (-734.476) (-735.719) (-735.076) [-731.907] -- 0:00:09
876000 -- (-732.366) [-734.947] (-731.545) (-737.320) * (-729.319) (-735.193) (-733.939) [-731.464] -- 0:00:09
876500 -- (-734.081) [-734.100] (-736.153) (-735.800) * [-730.076] (-735.724) (-733.897) (-733.788) -- 0:00:09
877000 -- (-734.672) (-731.205) [-733.814] (-732.415) * [-733.426] (-739.338) (-733.236) (-729.851) -- 0:00:09
877500 -- [-736.509] (-731.630) (-736.421) (-731.311) * (-731.448) (-734.885) [-731.784] (-731.182) -- 0:00:09
878000 -- (-736.353) (-736.429) (-735.406) [-738.245] * [-733.959] (-732.682) (-735.207) (-732.137) -- 0:00:09
878500 -- (-732.974) (-732.894) [-732.974] (-732.223) * (-731.016) (-731.728) (-732.069) [-733.274] -- 0:00:09
879000 -- (-730.870) [-734.047] (-733.002) (-735.881) * (-732.513) (-735.549) [-733.476] (-730.443) -- 0:00:09
879500 -- (-732.261) [-732.370] (-734.847) (-732.267) * (-733.696) (-735.587) (-733.693) [-731.286] -- 0:00:09
880000 -- [-731.488] (-732.777) (-734.721) (-734.092) * (-743.702) [-735.165] (-730.786) (-731.797) -- 0:00:09
Average standard deviation of split frequencies: 0.006323
880500 -- (-731.715) (-730.260) [-732.965] (-731.075) * (-733.323) [-733.477] (-728.978) (-731.080) -- 0:00:08
881000 -- [-732.572] (-732.255) (-738.623) (-731.673) * (-741.379) (-732.372) [-730.109] (-734.366) -- 0:00:08
881500 -- [-729.625] (-736.245) (-740.100) (-734.589) * (-733.988) [-732.150] (-731.406) (-733.744) -- 0:00:08
882000 -- (-730.848) (-729.523) [-737.709] (-736.974) * (-733.554) (-732.606) (-729.945) [-731.231] -- 0:00:08
882500 -- (-732.793) [-731.280] (-736.105) (-735.483) * (-732.352) (-733.553) [-730.415] (-731.224) -- 0:00:08
883000 -- [-730.740] (-732.320) (-736.933) (-733.883) * (-730.745) [-732.449] (-730.688) (-736.715) -- 0:00:08
883500 -- (-731.689) [-730.668] (-736.648) (-732.202) * (-732.345) (-731.080) (-731.588) [-732.392] -- 0:00:08
884000 -- (-734.812) (-729.524) [-733.857] (-730.766) * (-736.184) (-732.612) [-737.238] (-732.358) -- 0:00:08
884500 -- (-730.394) (-730.087) (-733.664) [-734.408] * (-731.364) (-732.878) [-731.694] (-731.326) -- 0:00:08
885000 -- (-731.565) (-731.980) (-732.525) [-731.532] * [-732.555] (-735.314) (-732.524) (-736.024) -- 0:00:08
Average standard deviation of split frequencies: 0.006416
885500 -- (-731.813) [-730.520] (-733.416) (-734.405) * (-734.646) [-732.263] (-734.010) (-736.366) -- 0:00:08
886000 -- [-730.919] (-730.992) (-732.662) (-731.505) * [-733.772] (-733.777) (-734.962) (-734.001) -- 0:00:08
886500 -- (-732.841) (-733.607) (-731.860) [-732.035] * (-731.244) [-735.574] (-737.221) (-731.565) -- 0:00:08
887000 -- (-729.850) (-732.137) (-734.028) [-731.521] * (-731.632) [-733.107] (-732.419) (-736.310) -- 0:00:08
887500 -- (-732.284) [-731.256] (-737.461) (-733.797) * (-730.932) (-736.591) [-731.655] (-734.138) -- 0:00:08
888000 -- (-732.969) (-732.560) (-730.945) [-730.575] * [-731.283] (-738.803) (-732.148) (-730.733) -- 0:00:08
888500 -- (-737.317) (-731.908) [-735.335] (-732.792) * (-734.617) (-733.729) (-733.782) [-729.517] -- 0:00:08
889000 -- (-729.999) [-730.091] (-735.105) (-730.557) * (-734.825) (-736.722) (-734.724) [-731.557] -- 0:00:08
889500 -- (-730.481) [-729.818] (-735.980) (-734.461) * [-734.906] (-737.704) (-731.421) (-733.397) -- 0:00:08
890000 -- (-729.508) (-733.542) [-732.151] (-730.966) * (-736.726) (-741.344) (-730.438) [-732.698] -- 0:00:08
Average standard deviation of split frequencies: 0.006781
890500 -- (-730.426) (-733.701) (-733.524) [-729.826] * [-732.383] (-733.824) (-730.855) (-733.828) -- 0:00:08
891000 -- (-734.385) (-732.439) [-731.483] (-728.941) * (-734.308) [-731.762] (-735.452) (-732.354) -- 0:00:08
891500 -- (-730.565) [-729.522] (-730.698) (-734.690) * (-735.184) (-733.094) [-735.145] (-731.926) -- 0:00:08
892000 -- (-732.015) (-729.438) (-732.905) [-730.679] * (-731.986) (-732.896) [-730.762] (-730.823) -- 0:00:08
892500 -- (-734.389) (-739.112) (-732.584) [-733.960] * (-730.734) [-732.935] (-732.478) (-733.587) -- 0:00:08
893000 -- [-734.250] (-736.713) (-731.312) (-734.463) * (-735.198) (-732.108) [-730.748] (-733.560) -- 0:00:08
893500 -- [-732.917] (-735.721) (-733.028) (-733.303) * (-732.219) (-730.679) (-734.688) [-732.104] -- 0:00:07
894000 -- (-731.761) (-731.864) [-730.287] (-736.534) * (-731.723) [-730.856] (-736.753) (-735.528) -- 0:00:07
894500 -- (-732.070) (-731.123) [-729.491] (-732.574) * (-734.823) (-729.866) (-737.098) [-731.207] -- 0:00:07
895000 -- [-729.055] (-734.038) (-731.742) (-731.785) * (-732.537) (-731.505) (-732.764) [-730.117] -- 0:00:07
Average standard deviation of split frequencies: 0.007168
895500 -- [-730.050] (-734.997) (-730.875) (-731.496) * (-734.613) [-730.855] (-733.168) (-731.170) -- 0:00:07
896000 -- [-730.397] (-731.961) (-731.410) (-732.211) * (-732.639) (-729.954) (-730.436) [-732.541] -- 0:00:07
896500 -- (-732.327) (-732.434) [-732.343] (-729.475) * (-733.157) (-729.783) (-733.123) [-731.425] -- 0:00:07
897000 -- (-730.273) [-732.243] (-730.443) (-737.070) * [-728.986] (-731.393) (-729.049) (-731.210) -- 0:00:07
897500 -- [-733.639] (-737.391) (-732.730) (-734.573) * (-735.459) (-734.395) [-736.845] (-733.722) -- 0:00:07
898000 -- (-732.742) (-732.765) [-731.004] (-737.497) * (-731.786) (-734.728) [-734.819] (-733.946) -- 0:00:07
898500 -- (-737.066) (-733.319) [-730.732] (-735.536) * (-732.488) (-732.841) [-731.212] (-737.540) -- 0:00:07
899000 -- [-732.971] (-735.288) (-731.516) (-732.665) * (-730.751) (-732.504) [-732.047] (-732.579) -- 0:00:07
899500 -- (-734.268) [-732.246] (-736.840) (-732.072) * (-729.946) (-732.804) [-732.276] (-731.064) -- 0:00:07
900000 -- (-733.541) (-732.418) (-733.632) [-731.157] * (-735.677) (-732.263) (-729.004) [-733.521] -- 0:00:07
Average standard deviation of split frequencies: 0.007491
900500 -- [-732.467] (-733.884) (-732.209) (-732.464) * (-730.928) [-729.932] (-731.350) (-734.971) -- 0:00:07
901000 -- [-730.004] (-732.683) (-732.372) (-735.890) * (-734.130) (-732.123) (-734.563) [-731.714] -- 0:00:07
901500 -- [-732.252] (-731.912) (-731.775) (-731.576) * (-733.028) [-729.089] (-734.416) (-735.255) -- 0:00:07
902000 -- (-731.095) [-734.515] (-733.949) (-730.176) * [-732.339] (-731.681) (-731.727) (-732.128) -- 0:00:07
902500 -- (-730.968) [-732.143] (-731.195) (-735.143) * [-730.543] (-731.124) (-730.096) (-735.705) -- 0:00:07
903000 -- (-734.245) [-733.220] (-732.181) (-733.334) * [-732.170] (-730.911) (-737.241) (-738.084) -- 0:00:07
903500 -- (-734.580) (-734.873) [-730.942] (-731.653) * (-733.337) (-733.777) [-735.630] (-732.602) -- 0:00:07
904000 -- (-733.856) (-730.397) [-730.704] (-730.500) * [-733.610] (-732.037) (-732.003) (-734.627) -- 0:00:07
904500 -- (-733.003) (-734.466) [-730.186] (-730.905) * (-732.304) [-730.987] (-736.644) (-731.560) -- 0:00:07
905000 -- (-733.744) [-735.063] (-731.057) (-730.794) * (-731.230) (-733.106) [-731.663] (-732.177) -- 0:00:07
Average standard deviation of split frequencies: 0.007317
905500 -- (-732.997) [-733.009] (-735.724) (-733.427) * [-733.415] (-737.387) (-732.871) (-735.350) -- 0:00:07
906000 -- [-732.686] (-736.449) (-732.947) (-729.684) * [-734.445] (-731.926) (-736.333) (-730.958) -- 0:00:07
906500 -- (-731.855) [-731.581] (-736.186) (-733.041) * (-733.746) [-731.091] (-730.814) (-732.056) -- 0:00:07
907000 -- (-735.684) (-732.142) (-731.972) [-732.024] * (-731.939) [-734.483] (-731.285) (-733.271) -- 0:00:06
907500 -- (-734.493) (-735.047) [-736.627] (-730.671) * (-730.516) (-734.878) (-732.379) [-730.661] -- 0:00:06
908000 -- (-731.895) [-730.778] (-730.773) (-730.085) * (-728.906) (-731.631) (-736.026) [-731.711] -- 0:00:06
908500 -- (-731.714) (-737.503) (-733.015) [-731.270] * (-733.378) (-731.602) (-733.554) [-729.362] -- 0:00:06
909000 -- (-732.522) [-731.837] (-738.858) (-730.308) * (-735.856) (-733.055) (-730.673) [-729.738] -- 0:00:06
909500 -- [-735.905] (-734.738) (-736.306) (-730.433) * (-735.968) (-732.542) (-732.989) [-729.453] -- 0:00:06
910000 -- [-738.180] (-735.076) (-733.583) (-732.194) * [-735.080] (-730.662) (-734.204) (-729.555) -- 0:00:06
Average standard deviation of split frequencies: 0.007247
910500 -- (-730.647) (-730.670) [-737.036] (-731.868) * (-731.013) (-737.265) (-734.658) [-731.493] -- 0:00:06
911000 -- (-734.232) (-733.627) (-734.928) [-731.473] * (-731.235) (-735.324) (-731.703) [-734.278] -- 0:00:06
911500 -- (-734.076) [-730.158] (-735.117) (-729.022) * [-734.181] (-736.972) (-732.171) (-734.880) -- 0:00:06
912000 -- (-730.892) (-730.023) [-735.524] (-730.880) * (-730.625) [-733.123] (-734.320) (-730.399) -- 0:00:06
912500 -- [-734.200] (-731.974) (-736.206) (-729.650) * [-732.138] (-738.132) (-732.104) (-735.082) -- 0:00:06
913000 -- (-732.280) (-733.464) (-732.640) [-729.525] * [-732.666] (-741.799) (-734.396) (-734.479) -- 0:00:06
913500 -- (-732.342) [-731.538] (-733.299) (-731.639) * (-733.317) (-735.098) [-733.090] (-732.659) -- 0:00:06
914000 -- (-733.389) (-736.353) (-732.606) [-731.451] * (-733.411) (-732.612) [-732.762] (-731.155) -- 0:00:06
914500 -- (-731.896) (-738.963) (-734.131) [-731.867] * (-730.843) [-734.015] (-733.031) (-734.832) -- 0:00:06
915000 -- (-732.608) (-733.251) [-734.375] (-733.768) * (-733.255) [-735.019] (-733.581) (-731.787) -- 0:00:06
Average standard deviation of split frequencies: 0.007205
915500 -- (-738.199) [-729.155] (-735.996) (-732.979) * (-731.790) (-734.059) [-734.235] (-732.936) -- 0:00:06
916000 -- (-732.077) (-731.255) (-731.775) [-729.712] * (-732.268) (-736.141) (-733.594) [-731.213] -- 0:00:06
916500 -- (-732.111) (-729.544) [-731.454] (-730.923) * (-730.424) [-732.304] (-739.056) (-732.818) -- 0:00:06
917000 -- (-730.449) (-730.969) [-731.989] (-733.107) * (-731.588) (-730.328) [-733.745] (-730.830) -- 0:00:06
917500 -- [-730.952] (-732.692) (-735.096) (-735.182) * [-731.660] (-730.996) (-732.447) (-731.396) -- 0:00:06
918000 -- (-732.490) (-730.085) [-732.240] (-735.785) * (-732.720) (-732.037) [-732.887] (-733.814) -- 0:00:06
918500 -- (-735.425) (-733.149) (-734.777) [-729.245] * (-730.478) [-729.663] (-731.875) (-737.356) -- 0:00:06
919000 -- (-734.661) (-735.485) (-733.994) [-732.549] * (-734.501) (-732.826) (-731.943) [-731.367] -- 0:00:06
919500 -- (-731.603) [-733.109] (-732.549) (-730.948) * (-731.586) (-731.534) (-733.916) [-729.562] -- 0:00:06
920000 -- (-732.655) (-731.623) (-731.984) [-732.665] * (-733.491) (-734.413) [-735.295] (-732.830) -- 0:00:05
Average standard deviation of split frequencies: 0.007136
920500 -- (-735.636) [-731.515] (-732.873) (-730.317) * (-731.782) (-733.793) [-732.498] (-732.867) -- 0:00:05
921000 -- (-733.470) (-732.305) (-732.346) [-731.484] * (-732.431) [-732.853] (-729.361) (-733.581) -- 0:00:05
921500 -- (-736.738) (-731.097) [-735.180] (-731.422) * (-732.890) [-732.617] (-729.683) (-732.008) -- 0:00:05
922000 -- (-731.864) (-731.650) [-734.024] (-732.786) * (-733.582) [-735.833] (-729.346) (-733.297) -- 0:00:05
922500 -- (-731.692) (-736.338) (-730.840) [-736.914] * (-732.030) (-733.418) [-729.990] (-733.822) -- 0:00:05
923000 -- (-732.736) (-733.162) (-734.621) [-732.536] * (-729.464) [-732.339] (-731.177) (-729.589) -- 0:00:05
923500 -- (-735.223) (-732.994) [-731.208] (-731.904) * (-731.236) [-730.076] (-730.787) (-732.213) -- 0:00:05
924000 -- (-732.614) [-733.527] (-733.414) (-730.428) * (-732.621) [-734.278] (-738.571) (-736.207) -- 0:00:05
924500 -- (-735.836) [-733.905] (-733.347) (-733.219) * (-731.473) [-737.023] (-735.738) (-734.032) -- 0:00:05
925000 -- (-731.487) (-734.882) (-733.334) [-734.062] * (-733.001) (-731.683) [-732.083] (-733.014) -- 0:00:05
Average standard deviation of split frequencies: 0.007254
925500 -- (-731.526) (-731.337) (-732.727) [-732.957] * (-738.365) (-732.996) [-729.683] (-736.079) -- 0:00:05
926000 -- (-736.535) (-732.592) (-729.859) [-734.173] * [-732.270] (-729.067) (-732.626) (-735.663) -- 0:00:05
926500 -- [-734.407] (-732.200) (-731.503) (-732.383) * [-730.068] (-731.376) (-732.348) (-733.335) -- 0:00:05
927000 -- (-733.779) (-730.769) [-733.328] (-733.176) * (-736.382) [-731.782] (-734.692) (-736.096) -- 0:00:05
927500 -- (-734.530) (-730.681) (-734.806) [-730.540] * (-733.154) (-730.905) (-733.007) [-733.581] -- 0:00:05
928000 -- (-734.827) (-730.489) [-732.378] (-734.788) * (-732.220) (-739.586) [-731.124] (-734.356) -- 0:00:05
928500 -- (-732.474) (-736.024) [-731.190] (-736.151) * (-730.833) (-735.519) (-729.494) [-733.118] -- 0:00:05
929000 -- (-735.967) [-733.050] (-730.373) (-732.029) * [-730.188] (-728.587) (-730.942) (-731.472) -- 0:00:05
929500 -- (-733.765) (-732.258) (-734.532) [-731.251] * [-731.246] (-729.832) (-733.130) (-729.642) -- 0:00:05
930000 -- [-734.502] (-732.245) (-729.878) (-732.189) * (-730.878) (-733.655) [-731.759] (-729.504) -- 0:00:05
Average standard deviation of split frequencies: 0.006965
930500 -- (-730.574) (-736.414) (-733.498) [-734.225] * [-734.948] (-734.291) (-731.823) (-733.523) -- 0:00:05
931000 -- [-733.008] (-732.880) (-730.137) (-732.458) * (-733.088) (-730.275) (-730.536) [-738.034] -- 0:00:05
931500 -- (-732.304) (-731.581) [-731.627] (-733.165) * (-731.716) (-731.282) [-730.557] (-731.691) -- 0:00:05
932000 -- (-733.116) (-730.029) (-731.938) [-733.322] * [-731.438] (-732.619) (-733.793) (-731.053) -- 0:00:05
932500 -- [-734.006] (-734.530) (-731.679) (-733.448) * [-731.475] (-733.465) (-733.419) (-734.757) -- 0:00:05
933000 -- (-734.976) (-734.584) [-730.353] (-733.735) * (-732.403) (-734.165) (-734.548) [-730.628] -- 0:00:05
933500 -- [-732.226] (-732.784) (-734.470) (-731.054) * (-740.737) (-738.965) (-739.012) [-731.693] -- 0:00:04
934000 -- [-732.639] (-734.767) (-732.844) (-730.517) * (-737.996) (-731.985) [-729.912] (-730.415) -- 0:00:04
934500 -- (-734.763) (-731.285) (-732.776) [-732.213] * [-731.814] (-731.703) (-734.110) (-731.304) -- 0:00:04
935000 -- (-733.807) [-732.056] (-732.298) (-731.196) * (-731.227) [-733.158] (-735.094) (-729.913) -- 0:00:04
Average standard deviation of split frequencies: 0.006768
935500 -- [-733.961] (-733.321) (-734.758) (-731.270) * (-734.204) (-732.061) (-733.977) [-729.548] -- 0:00:04
936000 -- (-732.581) (-729.974) [-732.528] (-736.445) * [-732.582] (-734.233) (-731.878) (-730.582) -- 0:00:04
936500 -- (-738.476) [-731.688] (-733.077) (-734.695) * (-731.199) (-739.307) (-732.008) [-732.917] -- 0:00:04
937000 -- (-731.958) [-728.785] (-734.325) (-733.166) * (-732.150) (-735.916) [-732.373] (-730.429) -- 0:00:04
937500 -- (-733.087) (-732.153) [-731.618] (-733.228) * [-732.407] (-732.825) (-730.882) (-733.432) -- 0:00:04
938000 -- (-739.623) (-734.786) (-730.836) [-732.263] * (-731.538) [-731.138] (-736.046) (-733.465) -- 0:00:04
938500 -- [-732.136] (-732.869) (-730.390) (-733.241) * (-731.945) (-735.839) [-731.624] (-737.292) -- 0:00:04
939000 -- (-731.862) [-734.915] (-734.125) (-731.415) * (-733.813) [-737.374] (-731.189) (-732.477) -- 0:00:04
939500 -- (-731.772) [-730.684] (-731.289) (-730.634) * (-731.382) (-732.147) [-730.940] (-732.763) -- 0:00:04
940000 -- (-735.546) [-732.768] (-734.684) (-736.910) * (-733.282) (-731.732) [-732.962] (-740.640) -- 0:00:04
Average standard deviation of split frequencies: 0.006953
940500 -- (-731.968) (-733.041) (-731.050) [-733.321] * (-733.184) [-732.694] (-730.843) (-732.515) -- 0:00:04
941000 -- (-735.394) (-737.721) (-731.046) [-730.656] * (-729.491) (-736.900) [-730.388] (-732.762) -- 0:00:04
941500 -- (-733.259) (-731.595) [-731.321] (-732.326) * (-732.454) [-731.459] (-731.026) (-732.044) -- 0:00:04
942000 -- (-739.230) [-732.141] (-730.319) (-731.808) * [-733.547] (-735.356) (-734.275) (-732.873) -- 0:00:04
942500 -- [-735.398] (-733.694) (-732.752) (-730.451) * (-731.196) (-738.099) (-733.891) [-732.813] -- 0:00:04
943000 -- [-731.986] (-731.240) (-739.365) (-729.856) * (-733.560) (-735.520) (-735.006) [-729.899] -- 0:00:04
943500 -- [-732.791] (-733.636) (-734.881) (-733.878) * (-730.416) (-733.803) [-731.779] (-730.730) -- 0:00:04
944000 -- [-730.858] (-735.567) (-731.958) (-733.414) * (-733.218) (-732.747) (-734.388) [-732.647] -- 0:00:04
944500 -- [-731.559] (-735.213) (-732.369) (-733.837) * [-733.135] (-732.136) (-734.271) (-730.818) -- 0:00:04
945000 -- (-733.251) [-733.325] (-731.077) (-732.428) * (-731.775) [-730.978] (-732.739) (-733.063) -- 0:00:04
Average standard deviation of split frequencies: 0.006634
945500 -- (-731.858) [-732.305] (-731.673) (-729.922) * (-732.091) [-731.583] (-732.986) (-733.602) -- 0:00:04
946000 -- (-732.535) (-731.501) [-733.488] (-731.911) * (-731.685) [-735.638] (-732.237) (-732.299) -- 0:00:04
946500 -- [-728.403] (-734.756) (-731.575) (-733.012) * (-730.847) (-736.897) [-730.649] (-732.644) -- 0:00:04
947000 -- (-733.453) (-733.779) [-730.204] (-736.582) * (-738.892) [-741.798] (-733.998) (-733.294) -- 0:00:03
947500 -- [-731.259] (-734.236) (-732.205) (-736.285) * (-735.382) (-738.676) (-731.891) [-730.347] -- 0:00:03
948000 -- (-733.645) (-736.563) [-733.928] (-734.791) * (-735.364) (-737.117) [-734.210] (-733.754) -- 0:00:03
948500 -- (-735.750) [-731.589] (-729.908) (-734.326) * (-731.046) (-730.834) [-731.288] (-732.033) -- 0:00:03
949000 -- (-731.757) (-732.355) [-731.985] (-735.644) * [-735.337] (-732.519) (-729.169) (-731.233) -- 0:00:03
949500 -- (-733.931) (-731.845) [-731.738] (-732.231) * (-730.964) (-731.928) [-731.685] (-733.431) -- 0:00:03
950000 -- (-734.505) (-733.112) [-732.205] (-731.020) * (-731.627) (-733.073) [-730.503] (-733.190) -- 0:00:03
Average standard deviation of split frequencies: 0.006787
950500 -- (-733.256) [-732.186] (-732.126) (-731.151) * (-736.003) (-730.325) (-735.179) [-730.683] -- 0:00:03
951000 -- [-731.830] (-730.697) (-729.995) (-736.873) * (-731.662) [-730.933] (-730.704) (-731.664) -- 0:00:03
951500 -- (-735.652) (-732.270) [-730.036] (-731.392) * (-732.686) (-729.911) (-730.720) [-734.856] -- 0:00:03
952000 -- [-732.085] (-733.221) (-734.354) (-729.950) * (-730.877) (-734.902) (-736.210) [-730.681] -- 0:00:03
952500 -- (-733.234) (-735.366) [-731.408] (-731.079) * (-732.684) (-733.677) [-732.195] (-732.216) -- 0:00:03
953000 -- (-735.534) (-730.882) (-733.037) [-731.210] * (-736.168) (-732.110) (-730.952) [-731.143] -- 0:00:03
953500 -- [-728.166] (-734.187) (-731.425) (-734.877) * (-731.829) (-731.194) (-730.022) [-731.262] -- 0:00:03
954000 -- (-729.660) (-733.667) [-733.881] (-729.312) * [-735.466] (-730.860) (-730.127) (-735.357) -- 0:00:03
954500 -- (-735.609) (-733.915) [-729.363] (-729.993) * (-734.319) (-732.037) (-731.635) [-732.334] -- 0:00:03
955000 -- [-730.893] (-733.837) (-731.892) (-730.714) * (-731.569) (-734.041) [-732.260] (-737.116) -- 0:00:03
Average standard deviation of split frequencies: 0.006595
955500 -- (-732.507) (-735.619) [-731.184] (-731.513) * (-733.610) (-738.306) [-731.088] (-731.622) -- 0:00:03
956000 -- (-731.129) (-733.662) [-732.132] (-734.689) * [-732.142] (-732.592) (-732.053) (-738.912) -- 0:00:03
956500 -- (-730.180) (-734.711) [-734.540] (-731.263) * [-731.605] (-730.477) (-730.846) (-733.392) -- 0:00:03
957000 -- (-730.252) [-732.301] (-734.496) (-740.972) * (-731.668) [-732.772] (-728.927) (-729.653) -- 0:00:03
957500 -- [-730.484] (-731.638) (-735.904) (-729.695) * (-736.130) [-729.321] (-736.491) (-729.769) -- 0:00:03
958000 -- [-731.429] (-730.564) (-731.406) (-736.876) * (-733.665) [-730.269] (-737.400) (-732.424) -- 0:00:03
958500 -- (-732.761) [-730.381] (-733.753) (-736.188) * (-732.043) (-731.507) (-733.837) [-730.764] -- 0:00:03
959000 -- [-732.820] (-731.284) (-734.537) (-738.224) * (-729.856) (-734.175) [-733.976] (-732.248) -- 0:00:03
959500 -- (-734.785) (-731.830) [-734.836] (-738.385) * (-733.450) [-731.675] (-734.255) (-734.033) -- 0:00:03
960000 -- (-732.998) [-731.702] (-733.760) (-731.787) * (-736.218) (-730.228) [-732.785] (-733.669) -- 0:00:02
Average standard deviation of split frequencies: 0.006502
960500 -- [-730.367] (-730.522) (-734.658) (-730.065) * (-734.237) (-730.167) [-729.725] (-734.724) -- 0:00:02
961000 -- (-730.522) (-729.647) [-735.301] (-736.071) * (-730.310) (-735.295) (-731.268) [-732.703] -- 0:00:02
961500 -- (-732.593) (-730.318) (-731.380) [-732.347] * (-731.052) (-737.213) [-732.488] (-731.617) -- 0:00:02
962000 -- [-734.322] (-735.390) (-731.377) (-730.202) * (-732.321) (-730.768) [-731.775] (-732.225) -- 0:00:02
962500 -- (-729.257) [-731.799] (-731.763) (-732.263) * (-733.187) (-733.541) [-731.797] (-736.751) -- 0:00:02
963000 -- (-734.633) (-730.676) [-732.488] (-729.679) * [-730.020] (-732.692) (-728.889) (-734.141) -- 0:00:02
963500 -- [-733.896] (-731.419) (-729.761) (-730.950) * (-732.033) [-736.483] (-734.635) (-736.989) -- 0:00:02
964000 -- (-738.142) [-731.461] (-730.733) (-731.965) * [-732.714] (-734.873) (-732.771) (-737.184) -- 0:00:02
964500 -- (-732.568) (-732.809) [-732.453] (-730.303) * (-732.106) (-734.088) (-731.621) [-735.680] -- 0:00:02
965000 -- (-734.591) [-730.681] (-730.807) (-730.778) * (-733.396) (-733.320) [-732.522] (-731.987) -- 0:00:02
Average standard deviation of split frequencies: 0.006984
965500 -- (-732.468) (-734.352) (-732.018) [-730.142] * [-734.026] (-730.416) (-737.197) (-732.379) -- 0:00:02
966000 -- (-733.439) (-735.998) (-734.916) [-732.738] * [-732.552] (-736.664) (-730.948) (-735.042) -- 0:00:02
966500 -- [-731.992] (-733.144) (-736.818) (-733.640) * [-734.320] (-734.648) (-734.670) (-730.679) -- 0:00:02
967000 -- (-733.517) (-731.490) [-729.846] (-732.495) * (-735.263) [-732.641] (-731.565) (-735.882) -- 0:00:02
967500 -- (-730.319) (-736.605) [-733.587] (-731.719) * [-732.574] (-732.968) (-733.650) (-733.743) -- 0:00:02
968000 -- [-733.868] (-732.324) (-736.521) (-734.401) * (-732.715) (-735.298) (-730.104) [-730.976] -- 0:00:02
968500 -- (-733.367) (-729.511) [-731.649] (-732.401) * (-735.921) [-736.817] (-733.242) (-729.734) -- 0:00:02
969000 -- (-733.409) [-732.027] (-731.849) (-734.157) * (-732.124) (-733.612) [-734.161] (-728.701) -- 0:00:02
969500 -- (-734.802) [-733.936] (-730.587) (-732.501) * (-737.240) (-735.331) [-730.420] (-730.404) -- 0:00:02
970000 -- (-734.625) (-731.846) [-729.362] (-733.375) * (-732.902) [-732.871] (-730.891) (-734.301) -- 0:00:02
Average standard deviation of split frequencies: 0.007315
970500 -- (-731.319) (-731.189) (-733.020) [-733.230] * (-733.024) (-731.941) [-733.267] (-733.428) -- 0:00:02
971000 -- (-737.018) (-731.901) (-733.793) [-730.957] * (-735.964) (-736.475) [-730.678] (-732.493) -- 0:00:02
971500 -- (-733.070) [-731.054] (-733.430) (-733.060) * [-733.160] (-735.250) (-732.178) (-733.497) -- 0:00:02
972000 -- (-734.877) (-732.851) (-737.513) [-731.268] * [-731.193] (-731.740) (-730.866) (-733.611) -- 0:00:02
972500 -- [-731.469] (-731.942) (-731.115) (-733.182) * (-732.704) [-730.365] (-733.073) (-733.740) -- 0:00:02
973000 -- [-734.287] (-732.922) (-731.104) (-730.195) * (-739.434) [-731.589] (-735.529) (-733.526) -- 0:00:02
973500 -- (-734.757) (-733.375) (-738.970) [-732.035] * [-729.755] (-737.997) (-731.898) (-734.260) -- 0:00:01
974000 -- (-730.054) (-732.040) [-732.020] (-732.458) * (-732.527) [-731.000] (-733.457) (-733.860) -- 0:00:01
974500 -- (-736.021) [-732.871] (-735.436) (-734.383) * [-732.371] (-743.160) (-731.483) (-734.409) -- 0:00:01
975000 -- (-734.527) (-737.795) [-732.687] (-738.624) * (-732.932) [-731.903] (-730.370) (-733.774) -- 0:00:01
Average standard deviation of split frequencies: 0.007668
975500 -- (-732.079) (-734.132) [-731.017] (-733.737) * (-729.839) [-730.759] (-736.769) (-736.229) -- 0:00:01
976000 -- (-732.143) (-730.910) [-734.957] (-731.826) * (-734.112) [-731.269] (-733.795) (-732.958) -- 0:00:01
976500 -- (-733.245) (-732.912) [-730.605] (-732.397) * (-730.851) (-730.698) [-735.468] (-731.498) -- 0:00:01
977000 -- (-735.763) [-736.221] (-732.730) (-732.477) * [-730.874] (-732.268) (-735.477) (-731.765) -- 0:00:01
977500 -- (-732.819) [-733.232] (-730.347) (-732.418) * (-732.386) (-731.754) (-732.448) [-729.844] -- 0:00:01
978000 -- (-731.379) (-732.351) (-731.780) [-732.627] * (-731.884) (-730.507) (-733.969) [-735.293] -- 0:00:01
978500 -- (-733.371) (-732.397) (-734.758) [-732.452] * (-733.359) (-731.534) (-734.807) [-729.519] -- 0:00:01
979000 -- (-732.501) (-733.270) (-732.341) [-731.975] * (-731.618) [-731.465] (-731.379) (-731.784) -- 0:00:01
979500 -- (-736.153) [-732.485] (-731.196) (-736.601) * (-732.854) [-730.758] (-731.730) (-731.779) -- 0:00:01
980000 -- (-736.197) (-730.080) (-737.140) [-730.232] * [-731.256] (-732.032) (-732.066) (-730.737) -- 0:00:01
Average standard deviation of split frequencies: 0.007871
980500 -- (-731.333) [-733.559] (-732.760) (-735.151) * (-731.188) [-731.154] (-730.379) (-732.553) -- 0:00:01
981000 -- (-731.321) [-732.612] (-732.280) (-734.998) * (-729.765) (-735.720) (-734.202) [-731.888] -- 0:00:01
981500 -- [-734.516] (-732.893) (-735.201) (-730.263) * [-733.117] (-733.627) (-734.288) (-733.239) -- 0:00:01
982000 -- (-734.434) [-732.021] (-731.394) (-731.640) * (-732.172) (-733.326) [-734.783] (-732.555) -- 0:00:01
982500 -- (-733.814) [-731.497] (-733.654) (-732.628) * (-735.007) (-733.085) (-734.163) [-733.622] -- 0:00:01
983000 -- (-731.609) (-731.150) [-730.585] (-730.673) * [-731.968] (-733.529) (-734.743) (-731.841) -- 0:00:01
983500 -- (-731.881) [-737.546] (-733.365) (-730.720) * [-731.684] (-732.455) (-730.960) (-734.005) -- 0:00:01
984000 -- [-732.433] (-730.202) (-729.841) (-732.427) * (-731.588) (-730.874) [-734.194] (-735.067) -- 0:00:01
984500 -- [-730.694] (-734.913) (-729.154) (-736.337) * (-731.814) (-730.312) [-733.264] (-731.359) -- 0:00:01
985000 -- (-731.386) (-735.474) (-733.525) [-735.026] * (-735.901) [-732.228] (-731.989) (-733.494) -- 0:00:01
Average standard deviation of split frequencies: 0.007679
985500 -- [-730.109] (-733.313) (-730.642) (-735.176) * (-737.595) [-730.405] (-737.365) (-732.837) -- 0:00:01
986000 -- (-734.565) (-733.931) [-731.379] (-733.472) * (-731.381) (-739.225) [-732.820] (-735.152) -- 0:00:01
986500 -- [-730.598] (-736.685) (-734.237) (-737.024) * (-734.952) (-731.684) [-729.493] (-731.687) -- 0:00:01
987000 -- (-732.455) (-735.800) (-732.721) [-732.195] * (-732.296) (-735.054) (-733.023) [-733.712] -- 0:00:00
987500 -- (-732.580) (-733.398) (-733.494) [-732.668] * (-731.214) (-731.518) [-729.817] (-736.586) -- 0:00:00
988000 -- (-732.245) (-733.274) (-733.323) [-732.770] * (-733.908) [-729.979] (-736.002) (-731.860) -- 0:00:00
988500 -- [-733.163] (-731.661) (-730.933) (-732.119) * (-736.292) [-730.030] (-730.784) (-732.842) -- 0:00:00
989000 -- (-731.157) (-731.493) (-731.093) [-732.998] * (-730.319) [-729.445] (-730.772) (-734.547) -- 0:00:00
989500 -- (-732.523) (-733.737) (-732.662) [-730.721] * (-729.470) [-730.565] (-731.556) (-731.082) -- 0:00:00
990000 -- (-734.378) (-730.739) (-733.049) [-734.511] * (-730.107) (-733.592) (-731.060) [-732.068] -- 0:00:00
Average standard deviation of split frequencies: 0.007673
990500 -- (-732.438) [-729.794] (-734.696) (-733.681) * (-731.115) (-737.424) [-731.857] (-730.706) -- 0:00:00
991000 -- (-730.967) (-733.763) [-733.192] (-737.651) * [-734.504] (-732.924) (-732.174) (-733.371) -- 0:00:00
991500 -- (-730.504) (-730.805) (-733.079) [-732.866] * (-734.646) (-739.313) [-732.139] (-733.037) -- 0:00:00
992000 -- (-730.129) (-732.517) (-736.725) [-734.731] * (-733.542) [-730.376] (-731.520) (-740.139) -- 0:00:00
992500 -- [-732.013] (-735.985) (-733.796) (-738.375) * (-731.756) (-730.939) [-733.810] (-741.805) -- 0:00:00
993000 -- (-737.388) [-730.895] (-733.946) (-731.288) * (-730.157) [-729.214] (-732.744) (-735.313) -- 0:00:00
993500 -- [-733.681] (-733.373) (-731.962) (-735.154) * (-730.758) (-730.130) (-730.433) [-733.602] -- 0:00:00
994000 -- (-735.188) (-732.729) [-731.335] (-730.040) * (-730.736) [-731.346] (-732.027) (-735.337) -- 0:00:00
994500 -- (-731.989) (-735.328) [-730.695] (-732.033) * [-733.597] (-730.704) (-731.828) (-733.995) -- 0:00:00
995000 -- (-734.971) (-731.763) [-731.845] (-733.279) * (-731.402) (-731.140) (-733.053) [-730.900] -- 0:00:00
Average standard deviation of split frequencies: 0.007425
995500 -- (-732.793) (-733.223) [-732.654] (-731.286) * (-736.286) (-732.143) [-732.415] (-731.674) -- 0:00:00
996000 -- (-732.302) (-733.490) (-731.227) [-731.345] * (-735.385) (-732.562) [-732.189] (-731.552) -- 0:00:00
996500 -- (-732.125) (-731.809) (-731.864) [-733.611] * (-734.604) (-734.182) [-731.058] (-733.728) -- 0:00:00
997000 -- (-731.458) [-732.205] (-731.120) (-734.471) * [-733.200] (-733.110) (-731.978) (-736.453) -- 0:00:00
997500 -- (-731.611) (-736.316) [-731.038] (-733.327) * (-740.282) [-733.444] (-730.642) (-733.956) -- 0:00:00
998000 -- [-729.672] (-730.850) (-731.283) (-734.504) * (-734.870) [-730.675] (-731.196) (-733.100) -- 0:00:00
998500 -- (-730.637) (-730.097) (-730.675) [-733.651] * (-733.291) (-735.504) [-732.235] (-738.184) -- 0:00:00
999000 -- (-732.889) (-728.448) (-736.284) [-732.837] * (-733.033) (-735.298) (-737.144) [-740.104] -- 0:00:00
999500 -- (-731.466) (-733.179) (-729.851) [-733.502] * (-730.222) (-736.717) (-736.696) [-734.646] -- 0:00:00
1000000 -- (-733.701) [-729.695] (-733.294) (-733.957) * [-729.986] (-737.513) (-733.071) (-737.497) -- 0:00:00
Average standard deviation of split frequencies: 0.007272
Analysis completed in 1 mins 15 seconds
Analysis used 74.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -727.46
Likelihood of best state for "cold" chain of run 2 was -727.62
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.0 % ( 68 %) Dirichlet(Revmat{all})
97.2 % ( 95 %) Slider(Revmat{all})
30.2 % ( 33 %) Dirichlet(Pi{all})
31.7 % ( 17 %) Slider(Pi{all})
57.6 % ( 26 %) Multiplier(Alpha{1,2})
79.2 % ( 47 %) Multiplier(Alpha{3})
26.6 % ( 32 %) Slider(Pinvar{all})
97.7 % ( 98 %) ExtSPR(Tau{all},V{all})
69.4 % ( 79 %) ExtTBR(Tau{all},V{all})
98.7 % ( 97 %) NNI(Tau{all},V{all})
88.2 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
93.7 % ( 92 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 70 %) Dirichlet(Revmat{all})
97.3 % ( 94 %) Slider(Revmat{all})
30.7 % ( 21 %) Dirichlet(Pi{all})
31.5 % ( 30 %) Slider(Pi{all})
58.3 % ( 32 %) Multiplier(Alpha{1,2})
79.7 % ( 51 %) Multiplier(Alpha{3})
28.4 % ( 31 %) Slider(Pinvar{all})
97.7 % ( 99 %) ExtSPR(Tau{all},V{all})
69.3 % ( 73 %) ExtTBR(Tau{all},V{all})
98.8 % (100 %) NNI(Tau{all},V{all})
88.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 18 %) Multiplier(V{all})
93.6 % ( 95 %) Nodeslider(V{all})
30.1 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166354 0.82 0.66
3 | 167702 166631 0.83
4 | 166064 166691 166558
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167534 0.82 0.66
3 | 166822 167006 0.83
4 | 166302 166392 165944
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -731.21
| 1 1 |
| 1 1 1 2 1 |
| 1 2 |
| 12 1 * 2 2 * |
| 1 1 2 2 2 211 21 1 1 22 1 122|
| 2 11 1 1 2 11 2 1 2 1 1|
|* 1 22 1 1 2 2 * 2 2 1 1 22 222 2 1 1 |
| * 1 1 2 1 21 2 * * 11 2 1 2 |
| 2 2 2 122 * * 2 2 12 2 |
| 2 2 1 1 1 1 |
| *1 1 1 |
| 2 2 2 |
| |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -734.05
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -731.10 -735.40
2 -731.17 -735.87
--------------------------------------
TOTAL -731.13 -735.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.870990 0.089372 0.347670 1.461903 0.844034 1252.11 1351.44 1.000
r(A<->C){all} 0.157256 0.018994 0.000078 0.439896 0.116745 251.91 318.59 1.000
r(A<->G){all} 0.160243 0.019437 0.000035 0.438150 0.120644 154.34 216.28 1.007
r(A<->T){all} 0.141613 0.016733 0.000041 0.405341 0.101782 163.10 194.55 1.000
r(C<->G){all} 0.183228 0.023474 0.000093 0.494800 0.139948 167.74 206.11 1.001
r(C<->T){all} 0.139749 0.015465 0.000001 0.397261 0.103614 161.80 188.61 1.004
r(G<->T){all} 0.217912 0.024328 0.000158 0.526889 0.185560 244.71 250.08 1.000
pi(A){all} 0.239050 0.000340 0.202029 0.275504 0.238671 1111.73 1198.92 1.000
pi(C){all} 0.311589 0.000391 0.272694 0.350206 0.311045 1343.26 1361.59 1.000
pi(G){all} 0.307341 0.000404 0.267475 0.346043 0.306628 1244.65 1249.45 1.000
pi(T){all} 0.142019 0.000224 0.113364 0.170568 0.141741 1083.90 1217.92 1.000
alpha{1,2} 0.217740 0.058340 0.003730 0.532483 0.158979 1244.40 1305.49 1.000
alpha{3} 0.392032 0.206914 0.000108 1.300563 0.236662 1230.69 1296.38 1.000
pinvar{all} 0.992728 0.000030 0.981441 0.999756 0.994138 981.53 1200.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .****.
9 -- ..*.*.
10 -- ..**..
11 -- .**...
12 -- ..****
13 -- .**.**
14 -- ..*..*
15 -- .*...*
16 -- .*.*..
17 -- .*.***
18 -- ...*.*
19 -- ....**
20 -- .***.*
21 -- ...**.
22 -- .*..**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.016959 0.142572 0.166556 2
8 449 0.149567 0.006124 0.145237 0.153897 2
9 443 0.147568 0.009893 0.140573 0.154564 2
10 442 0.147235 0.007537 0.141905 0.152565 2
11 435 0.144903 0.002355 0.143238 0.146569 2
12 433 0.144237 0.002355 0.142572 0.145903 2
13 426 0.141905 0.006595 0.137242 0.146569 2
14 424 0.141239 0.013191 0.131912 0.150566 2
15 423 0.140906 0.000471 0.140573 0.141239 2
16 423 0.140906 0.006124 0.136576 0.145237 2
17 420 0.139907 0.011306 0.131912 0.147901 2
18 418 0.139241 0.000942 0.138574 0.139907 2
19 416 0.138574 0.008480 0.132578 0.144570 2
20 414 0.137908 0.009422 0.131246 0.144570 2
21 408 0.135909 0.001884 0.134577 0.137242 2
22 279 0.092938 0.012719 0.083944 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.087318 0.008151 0.000012 0.261448 0.059955 1.000 2
length{all}[2] 0.088375 0.007784 0.000002 0.262369 0.060715 1.000 2
length{all}[3] 0.085073 0.007386 0.000009 0.256148 0.058389 1.000 2
length{all}[4] 0.087795 0.008194 0.000102 0.267020 0.058526 1.000 2
length{all}[5] 0.085347 0.007532 0.000081 0.254650 0.058455 1.000 2
length{all}[6] 0.175790 0.017922 0.001045 0.440516 0.143228 1.000 2
length{all}[7] 0.084728 0.009093 0.000204 0.252490 0.057236 0.999 2
length{all}[8] 0.092660 0.008102 0.000005 0.292917 0.065623 1.007 2
length{all}[9] 0.083333 0.008269 0.000070 0.250902 0.055035 0.998 2
length{all}[10] 0.087925 0.008562 0.000219 0.254874 0.056733 0.998 2
length{all}[11] 0.082695 0.006812 0.000037 0.241913 0.056704 0.998 2
length{all}[12] 0.081735 0.007168 0.000169 0.247613 0.052781 0.998 2
length{all}[13] 0.083767 0.007344 0.000137 0.237114 0.059192 0.998 2
length{all}[14] 0.094229 0.009870 0.000181 0.294457 0.063508 0.999 2
length{all}[15] 0.088828 0.009415 0.000357 0.292032 0.057809 1.000 2
length{all}[16] 0.085440 0.008062 0.000018 0.264079 0.060392 1.001 2
length{all}[17] 0.088476 0.007220 0.000018 0.232227 0.064799 0.999 2
length{all}[18] 0.084940 0.006774 0.000478 0.244908 0.058184 1.001 2
length{all}[19] 0.092202 0.009048 0.000173 0.262829 0.064268 1.000 2
length{all}[20] 0.080875 0.007556 0.000223 0.234206 0.054808 0.999 2
length{all}[21] 0.086645 0.007150 0.000205 0.257593 0.061034 1.001 2
length{all}[22] 0.083602 0.006998 0.000230 0.248906 0.059484 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007272
Maximum standard deviation of split frequencies = 0.016959
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------ C1 (1)
|
|------------------------------- C2 (2)
|
|----------------------------- C3 (3)
+
|----------------------------- C4 (4)
|
|----------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 546
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
24 ambiguity characters in seq. 1
24 ambiguity characters in seq. 2
24 ambiguity characters in seq. 3
24 ambiguity characters in seq. 4
12 ambiguity characters in seq. 5
12 ambiguity characters in seq. 6
8 sites are removed. 1 2 3 4 179 180 181 182
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 174 / 174 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 174 / 174 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.072143 0.052953 0.010212 0.051987 0.102343 0.035905 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -731.226920
Iterating by ming2
Initial: fx= 731.226920
x= 0.07214 0.05295 0.01021 0.05199 0.10234 0.03590 0.30000 1.30000
1 h-m-p 0.0000 0.0001 407.1644 ++ 721.410893 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3512.8241 ++ 692.026571 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 67.9451 ++ 691.494798 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0002 127.1861 ++ 684.819911 m 0.0002 46 | 4/8
5 h-m-p 0.0001 0.0005 129.9031 ++ 678.870120 m 0.0005 57 | 5/8
6 h-m-p 0.0992 0.4960 0.4885 +YCYCCC 678.250703 5 0.3025 77 | 5/8
7 h-m-p 0.0519 0.2597 0.4784 ++ 678.196519 m 0.2597 91 | 6/8
8 h-m-p 0.0580 8.0000 0.3655 ++CYC 678.173442 2 1.2047 110 | 6/8
9 h-m-p 0.9876 8.0000 0.4458 YC 678.130387 1 2.2592 124 | 6/8
10 h-m-p 1.6000 8.0000 0.4615 YCCC 678.107882 3 3.0698 142 | 6/8
11 h-m-p 1.6000 8.0000 0.6718 YC 678.090761 1 3.0530 156 | 6/8
12 h-m-p 1.6000 8.0000 0.9319 YCCC 678.079873 3 3.6523 174 | 6/8
13 h-m-p 1.6000 8.0000 1.4838 YC 678.072565 1 2.9433 188 | 6/8
14 h-m-p 1.6000 8.0000 2.0347 YC 678.067613 1 3.8449 200 | 6/8
15 h-m-p 1.6000 8.0000 3.1893 YC 678.064470 1 2.7394 212 | 6/8
16 h-m-p 1.6000 8.0000 4.4878 +YC 678.062080 1 4.2729 225 | 6/8
17 h-m-p 1.6000 8.0000 7.1350 CC 678.060723 1 2.5026 238 | 6/8
18 h-m-p 1.6000 8.0000 9.7187 +YC 678.059601 1 4.7786 251 | 6/8
19 h-m-p 1.6000 8.0000 16.0655 CC 678.059017 1 2.3250 264 | 6/8
20 h-m-p 1.6000 8.0000 21.3062 +YC 678.058498 1 5.2988 277 | 6/8
21 h-m-p 1.6000 8.0000 36.6228 CC 678.058249 1 2.1895 290 | 6/8
22 h-m-p 1.6000 8.0000 47.4394 +C 678.058014 0 5.9281 302 | 6/8
23 h-m-p 0.9115 4.5574 81.9048 YC 678.057909 1 2.0205 314 | 6/8
24 h-m-p 0.3855 1.9274 107.8059 ++ 678.057850 m 1.9274 325 | 7/8
25 h-m-p 1.6000 8.0000 0.0000 Y 678.057850 0 1.0427 336 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 ---Y 678.057850 0 0.0044 351
Out..
lnL = -678.057850
352 lfun, 352 eigenQcodon, 2112 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.013674 0.052739 0.037680 0.017732 0.028273 0.014549 0.000100 0.582025 0.315073
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.628295
np = 9
lnL0 = -703.828192
Iterating by ming2
Initial: fx= 703.828192
x= 0.01367 0.05274 0.03768 0.01773 0.02827 0.01455 0.00011 0.58202 0.31507
1 h-m-p 0.0000 0.0000 376.8971 ++ 703.215784 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 82170.3582 ++ 692.174127 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 574.8756 ++ 689.427755 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 394.2762 ++ 684.097645 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 1310.2466 ++ 680.924053 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 230.7191 ++ 678.372966 m 0.0001 74 | 6/9
7 h-m-p 0.0205 3.7079 0.2004 ++++ 678.242169 m 3.7079 88 | 7/9
8 h-m-p 1.6000 8.0000 0.0418 YC 678.238862 1 0.6456 104 | 7/9
9 h-m-p 1.6000 8.0000 0.0003 Y 678.238861 0 1.1172 118 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ----Y 678.238861 0 0.0016 136 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 ---Y 678.238861 0 0.0001 153
Out..
lnL = -678.238861
154 lfun, 462 eigenQcodon, 1848 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.085936 0.010443 0.012443 0.023418 0.081250 0.076426 0.000100 1.747956 0.284809 0.167037 1093.371319
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.081023
np = 11
lnL0 = -696.126675
Iterating by ming2
Initial: fx= 696.126675
x= 0.08594 0.01044 0.01244 0.02342 0.08125 0.07643 0.00011 1.74796 0.28481 0.16704 951.42857
1 h-m-p 0.0000 0.0000 66.1003 ++ 696.108062 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0063 16.7828 +++++ 694.553876 m 0.0063 33 | 2/11
3 h-m-p 0.0000 0.0002 31.8475 ++ 694.303172 m 0.0002 47 | 3/11
4 h-m-p 0.0001 0.0012 128.4652 +++ 692.252951 m 0.0012 62 | 4/11
5 h-m-p 0.0009 0.0043 37.1704 ++ 684.155838 m 0.0043 76 | 5/11
6 h-m-p 0.0043 0.0215 17.0760 +YYYYYYCCCC 682.069336 10 0.0177 104 | 5/11
7 h-m-p 0.0085 0.0425 10.8874 ++ 678.680725 m 0.0425 118 | 6/11
8 h-m-p 0.0527 0.2633 2.6234 ++ 678.147790 m 0.2633 132 | 6/11
9 h-m-p 1.6000 8.0000 0.1451 YC 678.141756 1 0.8012 147 | 6/11
10 h-m-p 0.6464 8.0000 0.1799 ++ 678.087460 m 8.0000 166 | 6/11
11 h-m-p 1.6000 8.0000 0.3792 CYC 678.077050 2 1.1499 188 | 6/11
12 h-m-p 1.3135 8.0000 0.3319 +YC 678.071047 1 3.3935 209 | 6/11
13 h-m-p 1.6000 8.0000 0.1011 CC 678.070632 1 1.3924 230 | 6/11
14 h-m-p 1.6000 8.0000 0.0644 +YC 678.070453 1 4.2788 251 | 6/11
15 h-m-p 1.6000 8.0000 0.0166 ++ 678.069367 m 8.0000 270 | 6/11
16 h-m-p 0.1077 2.2106 1.2334 +++ 678.059831 m 2.2106 290 | 7/11
17 h-m-p 1.6000 8.0000 0.4837 CC 678.058822 1 2.2121 306 | 7/11
18 h-m-p 1.6000 8.0000 0.3883 +YC 678.058195 1 4.1338 326 | 7/11
19 h-m-p 1.6000 8.0000 0.5168 CC 678.057998 1 2.0991 346 | 7/11
20 h-m-p 1.6000 8.0000 0.4971 YC 678.057907 1 3.4927 365 | 7/11
21 h-m-p 1.6000 8.0000 0.4972 C 678.057880 0 2.0138 383 | 7/11
22 h-m-p 1.6000 8.0000 0.4656 Y 678.057867 0 3.4293 401 | 7/11
23 h-m-p 1.6000 8.0000 0.5009 C 678.057863 0 2.0878 419 | 7/11
24 h-m-p 1.6000 8.0000 0.4709 Y 678.057861 0 3.1104 437 | 7/11
25 h-m-p 1.6000 8.0000 0.5100 C 678.057860 0 2.3007 455 | 7/11
26 h-m-p 1.6000 8.0000 0.4618 Y 678.057860 0 2.5695 473 | 7/11
27 h-m-p 1.6000 8.0000 0.5412 Y 678.057860 0 3.0502 491 | 7/11
28 h-m-p 1.6000 8.0000 0.4149 C 678.057860 0 1.6954 509 | 7/11
29 h-m-p 1.2232 8.0000 0.5751 ++ 678.057859 m 8.0000 527 | 7/11
30 h-m-p 1.6000 8.0000 0.2188 ---Y 678.057859 0 0.0063 548 | 7/11
31 h-m-p 0.0160 8.0000 0.9087 ++C 678.057859 0 0.2668 568 | 7/11
32 h-m-p 0.1444 8.0000 1.6786 C 678.057859 0 0.1958 586 | 7/11
33 h-m-p 1.6000 8.0000 0.1702 +Y 678.057859 0 4.5401 601 | 7/11
34 h-m-p 1.6000 8.0000 0.1693 Y 678.057859 0 0.2183 619 | 7/11
35 h-m-p 0.2301 8.0000 0.1606 Y 678.057859 0 0.1629 637 | 7/11
36 h-m-p 0.0481 8.0000 0.5440 C 678.057859 0 0.0622 655 | 7/11
37 h-m-p 0.0673 8.0000 0.5028 Y 678.057859 0 0.0348 673 | 7/11
38 h-m-p 0.2356 8.0000 0.0742 ----C 678.057859 0 0.0002 695 | 7/11
39 h-m-p 0.0160 8.0000 0.0048 --Y 678.057859 0 0.0003 715 | 7/11
40 h-m-p 0.0160 8.0000 0.0217 ----C 678.057859 0 0.0000 737 | 7/11
41 h-m-p 0.0160 8.0000 0.0001 --Y 678.057859 0 0.0003 757 | 7/11
42 h-m-p 0.0160 8.0000 0.0011 ----Y 678.057859 0 0.0000 779 | 7/11
43 h-m-p 0.0160 8.0000 0.0005 -----C 678.057859 0 0.0000 802 | 7/11
44 h-m-p 0.0160 8.0000 0.0002 --------Y 678.057859 0 0.0000 828
Out..
lnL = -678.057859
829 lfun, 3316 eigenQcodon, 14922 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -682.999331 S = -681.560486 -2.367407
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:06
did 20 / 49 patterns 0:06
did 30 / 49 patterns 0:06
did 40 / 49 patterns 0:06
did 49 / 49 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.038644 0.044226 0.054640 0.036348 0.026783 0.109926 0.000100 1.044536 1.262447
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.192416
np = 9
lnL0 = -724.888378
Iterating by ming2
Initial: fx= 724.888378
x= 0.03864 0.04423 0.05464 0.03635 0.02678 0.10993 0.00011 1.04454 1.26245
1 h-m-p 0.0000 0.0000 380.0603 ++ 724.595638 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0023 70.3072 +++YCYYYYCCCC 717.087433 10 0.0021 44 | 1/9
3 h-m-p 0.0017 0.0101 86.2036 ++ 686.649648 m 0.0101 56 | 2/9
4 h-m-p 0.0000 0.0002 63.1207 ++ 682.913595 m 0.0002 68 | 3/9
5 h-m-p 0.0017 0.0181 5.9722 ------------.. | 3/9
6 h-m-p 0.0000 0.0000 288.2717 ++ 682.118334 m 0.0000 102 | 4/9
7 h-m-p 0.0000 0.0000 4164.2113 ++ 680.900479 m 0.0000 114 | 5/9
8 h-m-p 0.0000 0.0000 9971.8691 ++ 679.718787 m 0.0000 126 | 6/9
9 h-m-p 0.0002 0.0542 8.6402 ++++YYCCCC 678.791312 5 0.0313 150 | 6/9
10 h-m-p 1.3012 8.0000 0.2075 YYCC 678.708022 3 0.5269 166 | 6/9
11 h-m-p 0.3599 4.7749 0.3039 ++ 678.239296 m 4.7749 181
QuantileBeta(0.85, 0.65936, 0.00494) = 1.000000e+00 2000 rounds
| 7/9
12 h-m-p 1.6000 8.0000 0.0024 YC 678.238862 1 0.9775 197 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 Y 678.238862 0 1.1678 211 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 -----C 678.238862 0 0.0004 230
Out..
lnL = -678.238862
231 lfun, 2541 eigenQcodon, 13860 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.104707 0.013298 0.031663 0.049776 0.032825 0.025731 0.000100 0.900000 0.365940 1.286557 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.100359
np = 11
lnL0 = -693.975850
Iterating by ming2
Initial: fx= 693.975850
x= 0.10471 0.01330 0.03166 0.04978 0.03283 0.02573 0.00011 0.90000 0.36594 1.28656 951.42857
1 h-m-p 0.0000 0.0000 116.2396 ++ 693.919807 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 361.7578 ++YCYYCYYYCY 683.295339 10 0.0003 44 | 1/11
3 h-m-p 0.0000 0.0001 103.5952 YYCC 683.231918 3 0.0000 62 | 1/11
4 h-m-p 0.0001 0.0003 15.4855 ++ 683.155542 m 0.0003 76 | 2/11
5 h-m-p 0.0009 0.0090 4.5062 ++ 682.662326 m 0.0090 90 | 3/11
6 h-m-p 0.0019 0.0093 4.2160 ++ 682.321472 m 0.0093 104 | 4/11
7 h-m-p 0.0057 0.0577 2.6345 ++ 679.144736 m 0.0577 118 | 5/11
8 h-m-p 0.0002 0.0011 21.2181 ++ 679.039561 m 0.0011 132 | 6/11
9 h-m-p 0.0484 0.2422 0.2218 +YYYYYYC 678.414158 6 0.1915 153 | 6/11
10 h-m-p 1.6000 8.0000 0.0223 CCCC 678.374537 3 2.7705 178 | 6/11
11 h-m-p 0.0380 1.1707 1.6295 +YYCCC 678.228801 4 0.2099 204 | 6/11
12 h-m-p 1.6000 8.0000 0.0552 +YCCC 678.163621 3 5.3859 224 | 6/11
13 h-m-p 1.6000 8.0000 0.1332 YCCC 678.133768 3 3.1468 248 | 6/11
14 h-m-p 0.5862 2.9312 0.2471 ++ 678.106290 m 2.9312 267 | 7/11
15 h-m-p 1.6000 8.0000 0.1945
QuantileBeta(0.85, 2.96388, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.18878, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.57633, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14592, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
C 678.093724 2 2.1751 289
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14260, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14236, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14248, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 1.2804 8.0000 0.3305
QuantileBeta(0.85, 2.56535, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.83397, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 4.78460, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.61369, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.08952, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
C 678.078556 1 4.4314 310
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60619, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60588, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.60603, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
17 h-m-p 1.6000 8.0000 0.4748
QuantileBeta(0.85, 4.36522, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.64278, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.71546, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 5.67912, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.62647, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
C 678.072244 2 2.1357 331
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.61942, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
18 h-m-p 1.5260 8.0000 0.6645
QuantileBeta(0.85, 5.63281, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.67295, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 9.93198, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.87443, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
C 678.065787 1 4.8650 351
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85036, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.84988, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.85012, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
19 h-m-p 1.6000 8.0000 1.0403
QuantileBeta(0.85, 9.51371, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.50448, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.37428, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 12.43938, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.21949, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 9.86660, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
C 678.062858 2 2.2610 373
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.20102, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
20 h-m-p 1.5943 8.0000 1.4754
QuantileBeta(0.85, 12.55191, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.60458, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 21.99754, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.57451, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
C 678.060033 1 4.9525 389
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50377, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.50376, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
21 h-m-p 1.0352 5.1762 2.3406
QuantileBeta(0.85, 19.92547, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 27.19058, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.96959, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
C 678.058710 1 2.3178 404
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92578, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.92577, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
22 h-m-p 0.4152 2.0761 3.2207
QuantileBeta(0.85, 24.26228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 28.27181, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
+ 678.057860 m 2.0761 418
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.60832, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
23 h-m-p 1.6000 8.0000 0.3993
QuantileBeta(0.85, 30.24723, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 32.16397, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.9047 432
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.97016, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96904, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96960, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
24 h-m-p 1.6000 8.0000 0.0119
QuantileBeta(0.85, 29.95055, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96484, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96841, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96936, 0.00500) = 1.000000e+00 2000 rounds
C 678.057860 0 0.0250 451
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96986, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96874, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
25 h-m-p 0.0235 8.0000 0.0126
QuantileBeta(0.85, 29.96900, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96923, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96930, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0015 469
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
26 h-m-p 0.0160 8.0000 0.0128
QuantileBeta(0.85, 29.96908, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96923, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96927, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0000 492
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
27 h-m-p 0.0160 8.0000 0.0084
QuantileBeta(0.85, 29.96915, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96925, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96927, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
C 678.057860 0 0.0003 511
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
28 h-m-p 0.0160 8.0000 0.0056
QuantileBeta(0.85, 29.96919, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96926, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0000 538
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
29 h-m-p 0.0160 8.0000 0.0018
QuantileBeta(0.85, 29.96925, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96927, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0000 565
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
30 h-m-p 0.0160 8.0000 0.0053
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0000 592
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
31 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
C 678.057860 0 0.0000 615
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96984, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96872, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
| 8/11
32 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Y 678.057860 0 0.0000 643
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -678.057860
644 lfun, 7728 eigenQcodon, 42504 P(t)
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -682.738163 S = -681.560415 -1.981221
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:23
did 20 / 49 patterns 0:23
did 30 / 49 patterns 0:23
did 40 / 49 patterns 0:24
did 49 / 49 patterns 0:24
QuantileBeta(0.85, 29.96928, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:24
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=182
NC_011896_1_WP_010907536_1_117_MLBR_RS00565 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
NC_002677_1_NP_301211_1_83_ML0115 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 MVFGLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 MVFGLNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKV
************** *******************************
NC_011896_1_WP_010907536_1_117_MLBR_RS00565 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
NC_002677_1_NP_301211_1_83_ML0115 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL
**************************************************
NC_011896_1_WP_010907536_1_117_MLBR_RS00565 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
NC_002677_1_NP_301211_1_83_ML0115 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ
**************************************************
NC_011896_1_WP_010907536_1_117_MLBR_RS00565 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
NC_002677_1_NP_301211_1_83_ML0115 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 LEQMRHSALPPGMGKPGQAGGQGTGQYLoooo
NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 LEQMRHSALPPGMGKPGQAGGQGTGQYL----
NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 LEQMRHSALPPGMGKPGQAGGQGTGQYL----
****************************
>NC_011896_1_WP_010907536_1_117_MLBR_RS00565 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------ >NC_002677_1_NP_301211_1_83_ML0115 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------ >NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------ >NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 ------------TTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------ >NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGTCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------ >NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 ATGGTGTTTGGATTGAATAACGACAACGACGACAGCATCGAGATCATCGG CGGGGGCGATCCGCGGACCATGGCGACCCGCGGCGAGGATGAAAGCAGGG ACTCCGACGAACCTTCCCTAACCGACCTGGTCGAGCAGCCCGCCAAGGTG ATGCGAATAGGCACCATGATAAAGCAACTGCTCGAGGAAGTGCGTGCCGC GCCTCTAGACGAAGCCAGCCGCAACCAGCTGCGCGAGATCCACGCCACCA GCATCCGGGAGCTTGAGGACGGCCTGGCGCCCGAACTACGCGAGGAACTC GACCGGCTCACCCTGCCATTCAACGAGAGTACAGCACCGTCGAATGCCGA GTTGCGCATCGCGCAGGCTCAGCTGGTCGGCTGGCTGGAAGGACTGTTCC ACGGCATCCAGACCGCACTGTTCGCTCAACAGATGGCCGCACGTGCACAG CTGGAGCAAATGCGCCACAGCGCATTGCCACCGGGCATGGGCAAACCAGG ACAAGCCGGCGGTCAAGGTACTGGACAGTACCTG------------
>NC_011896_1_WP_010907536_1_117_MLBR_RS00565 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL >NC_002677_1_NP_301211_1_83_ML0115 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL >NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL >NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090 ----LNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL >NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595 MVFGLNNDNDDSIEIIGGVDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL >NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610 MVFGLNNDNDDSIEIIGGGDPRTMATRGEDESRDSDEPSLTDLVEQPAKV MRIGTMIKQLLEEVRAAPLDEASRNQLREIHATSIRELEDGLAPELREEL DRLTLPFNESTAPSNAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQ LEQMRHSALPPGMGKPGQAGGQGTGQYL
#NEXUS
[ID: 0001374684]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907536_1_117_MLBR_RS00565
NC_002677_1_NP_301211_1_83_ML0115
NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585
NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090
NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595
NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907536_1_117_MLBR_RS00565,
2 NC_002677_1_NP_301211_1_83_ML0115,
3 NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585,
4 NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090,
5 NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595,
6 NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05995526,2:0.06071471,3:0.05838891,4:0.05852593,5:0.05845541,6:0.1432282);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05995526,2:0.06071471,3:0.05838891,4:0.05852593,5:0.05845541,6:0.1432282);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -731.10 -735.40
2 -731.17 -735.87
--------------------------------------
TOTAL -731.13 -735.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0115/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.870990 0.089372 0.347670 1.461903 0.844034 1252.11 1351.44 1.000
r(A<->C){all} 0.157256 0.018994 0.000078 0.439896 0.116745 251.91 318.59 1.000
r(A<->G){all} 0.160243 0.019437 0.000035 0.438150 0.120644 154.34 216.28 1.007
r(A<->T){all} 0.141613 0.016733 0.000041 0.405341 0.101782 163.10 194.55 1.000
r(C<->G){all} 0.183228 0.023474 0.000093 0.494800 0.139948 167.74 206.11 1.001
r(C<->T){all} 0.139749 0.015465 0.000001 0.397261 0.103614 161.80 188.61 1.004
r(G<->T){all} 0.217912 0.024328 0.000158 0.526889 0.185560 244.71 250.08 1.000
pi(A){all} 0.239050 0.000340 0.202029 0.275504 0.238671 1111.73 1198.92 1.000
pi(C){all} 0.311589 0.000391 0.272694 0.350206 0.311045 1343.26 1361.59 1.000
pi(G){all} 0.307341 0.000404 0.267475 0.346043 0.306628 1244.65 1249.45 1.000
pi(T){all} 0.142019 0.000224 0.113364 0.170568 0.141741 1083.90 1217.92 1.000
alpha{1,2} 0.217740 0.058340 0.003730 0.532483 0.158979 1244.40 1305.49 1.000
alpha{3} 0.392032 0.206914 0.000108 1.300563 0.236662 1230.69 1296.38 1.000
pinvar{all} 0.992728 0.000030 0.981441 0.999756 0.994138 981.53 1200.11 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0115/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 174
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 6 6 6 6 6 6
CTA 3 3 3 3 3 3 | CCA 3 3 3 3 3 3 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1
CTG 11 11 11 11 11 11 | CCG 3 3 3 3 3 3 | CAG 8 8 8 8 8 8 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 7 7 7 7 7 7 | AAC 4 4 4 4 4 4 | AGC 5 5 5 5 5 5
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 2 2 2 2 2 2 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 2 | GCC 7 7 7 7 7 7 | GAC 9 9 9 9 9 9 | GGC 9 9 9 9 9 10
GTA 0 0 0 0 0 0 | GCA 5 5 5 5 5 5 | Glu GAA 7 7 7 7 7 7 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 4 4 4 4 4 4 | GAG 11 11 11 11 11 11 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907536_1_117_MLBR_RS00565
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25287 C:0.22989 A:0.31609 G:0.20115
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13410 C:0.31992 A:0.24138 G:0.30460
#2: NC_002677_1_NP_301211_1_83_ML0115
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25287 C:0.22989 A:0.31609 G:0.20115
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13410 C:0.31992 A:0.24138 G:0.30460
#3: NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25287 C:0.22989 A:0.31609 G:0.20115
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13410 C:0.31992 A:0.24138 G:0.30460
#4: NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25287 C:0.22989 A:0.31609 G:0.20115
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13410 C:0.31992 A:0.24138 G:0.30460
#5: NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25287 C:0.22989 A:0.31609 G:0.20115
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13410 C:0.31992 A:0.24138 G:0.30460
#6: NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.24713 C:0.22989 A:0.31609 G:0.20690
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13218 C:0.31992 A:0.24138 G:0.30651
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 12
CTC 18 | CCC 12 | CAC 18 | CGC 36
CTA 18 | CCA 18 | Gln Q CAA 30 | CGA 6
CTG 66 | CCG 18 | CAG 48 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 42 | ACC 42 | AAC 24 | AGC 30
ATA 12 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 36 | ACG 0 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 12 | Gly G GGT 12
GTC 17 | GCC 42 | GAC 54 | GGC 55
GTA 0 | GCA 30 | Glu E GAA 42 | GGA 18
GTG 12 | GCG 24 | GAG 66 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06322 C:0.32184 A:0.22989 G:0.38506
position 2: T:0.25192 C:0.22989 A:0.31609 G:0.20211
position 3: T:0.08621 C:0.40805 A:0.17816 G:0.32759
Average T:0.13378 C:0.31992 A:0.24138 G:0.30492
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -678.057850 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005730 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005750
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005730);
(NC_011896_1_WP_010907536_1_117_MLBR_RS00565: 0.000004, NC_002677_1_NP_301211_1_83_ML0115: 0.000004, NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585: 0.000004, NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090: 0.000004, NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595: 0.000004, NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610: 0.005730);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 426.7 95.3 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 426.7 95.3 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 426.7 95.3 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 426.7 95.3 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 426.7 95.3 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 426.7 95.3 999.0000 0.0023 0.0000 1.0 0.0
tree length for dN: 0.0023
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -678.238861 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005847 0.000100 0.000010 0.729908
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005867
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005847);
(NC_011896_1_WP_010907536_1_117_MLBR_RS00565: 0.000004, NC_002677_1_NP_301211_1_83_ML0115: 0.000004, NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585: 0.000004, NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090: 0.000004, NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595: 0.000004, NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610: 0.005847);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.72991 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 426.7 95.3 1.0000 0.0019 0.0019 0.8 0.2
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -678.057859 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005730 0.000100 0.000000 0.000000 1.000000 951.434287
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005750
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005730);
(NC_011896_1_WP_010907536_1_117_MLBR_RS00565: 0.000004, NC_002677_1_NP_301211_1_83_ML0115: 0.000004, NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585: 0.000004, NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090: 0.000004, NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595: 0.000004, NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610: 0.005730);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.43429
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 426.7 95.3 951.4341 0.0000 0.0000 0.0 0.0
7..2 0.000 426.7 95.3 951.4341 0.0000 0.0000 0.0 0.0
7..3 0.000 426.7 95.3 951.4341 0.0000 0.0000 0.0 0.0
7..4 0.000 426.7 95.3 951.4341 0.0000 0.0000 0.0 0.0
7..5 0.000 426.7 95.3 951.4341 0.0000 0.0000 0.0 0.0
7..6 0.006 426.7 95.3 951.4341 0.0023 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907536_1_117_MLBR_RS00565)
Pr(w>1) post mean +- SE for w
1 L 1.000** 951.434
2 N 1.000** 951.434
3 N 1.000** 951.434
4 D 1.000** 951.434
5 N 1.000** 951.434
6 D 1.000** 951.434
7 D 1.000** 951.434
8 S 1.000** 951.434
9 I 1.000** 951.434
10 E 1.000** 951.434
11 I 1.000** 951.434
12 I 1.000** 951.434
13 G 1.000** 951.434
14 G 1.000** 951.434
15 V 1.000** 951.434
16 D 1.000** 951.434
17 P 1.000** 951.434
18 R 1.000** 951.434
19 T 1.000** 951.434
20 M 1.000** 951.434
21 A 1.000** 951.434
22 T 1.000** 951.434
23 R 1.000** 951.434
24 G 1.000** 951.434
25 E 1.000** 951.434
26 D 1.000** 951.434
27 E 1.000** 951.434
28 S 1.000** 951.434
29 R 1.000** 951.434
30 D 1.000** 951.434
31 S 1.000** 951.434
32 D 1.000** 951.434
33 E 1.000** 951.434
34 P 1.000** 951.434
35 S 1.000** 951.434
36 L 1.000** 951.434
37 T 1.000** 951.434
38 D 1.000** 951.434
39 L 1.000** 951.434
40 V 1.000** 951.434
41 E 1.000** 951.434
42 Q 1.000** 951.434
43 P 1.000** 951.434
44 A 1.000** 951.434
45 K 1.000** 951.434
46 V 1.000** 951.434
47 M 1.000** 951.434
48 R 1.000** 951.434
49 I 1.000** 951.434
50 G 1.000** 951.434
51 T 1.000** 951.434
52 M 1.000** 951.434
53 I 1.000** 951.434
54 K 1.000** 951.434
55 Q 1.000** 951.434
56 L 1.000** 951.434
57 L 1.000** 951.434
58 E 1.000** 951.434
59 E 1.000** 951.434
60 V 1.000** 951.434
61 R 1.000** 951.434
62 A 1.000** 951.434
63 A 1.000** 951.434
64 P 1.000** 951.434
65 L 1.000** 951.434
66 D 1.000** 951.434
67 E 1.000** 951.434
68 A 1.000** 951.434
69 S 1.000** 951.434
70 R 1.000** 951.434
71 N 1.000** 951.434
72 Q 1.000** 951.434
73 L 1.000** 951.434
74 R 1.000** 951.434
75 E 1.000** 951.434
76 I 1.000** 951.434
77 H 1.000** 951.434
78 A 1.000** 951.434
79 T 1.000** 951.434
80 S 1.000** 951.434
81 I 1.000** 951.434
82 R 1.000** 951.434
83 E 1.000** 951.434
84 L 1.000** 951.434
85 E 1.000** 951.434
86 D 1.000** 951.434
87 G 1.000** 951.434
88 L 1.000** 951.434
89 A 1.000** 951.434
90 P 1.000** 951.434
91 E 1.000** 951.434
92 L 1.000** 951.434
93 R 1.000** 951.434
94 E 1.000** 951.434
95 E 1.000** 951.434
96 L 1.000** 951.434
97 D 1.000** 951.434
98 R 1.000** 951.434
99 L 1.000** 951.434
100 T 1.000** 951.434
101 L 1.000** 951.434
102 P 1.000** 951.434
103 F 1.000** 951.434
104 N 1.000** 951.434
105 E 1.000** 951.434
106 S 1.000** 951.434
107 T 1.000** 951.434
108 A 1.000** 951.434
109 P 1.000** 951.434
110 S 1.000** 951.434
111 N 1.000** 951.434
112 A 1.000** 951.434
113 E 1.000** 951.434
114 L 1.000** 951.434
115 R 1.000** 951.434
116 I 1.000** 951.434
117 A 1.000** 951.434
118 Q 1.000** 951.434
119 A 1.000** 951.434
120 Q 1.000** 951.434
121 L 1.000** 951.434
122 V 1.000** 951.434
123 G 1.000** 951.434
124 W 1.000** 951.434
125 L 1.000** 951.434
126 E 1.000** 951.434
127 G 1.000** 951.434
128 L 1.000** 951.434
129 F 1.000** 951.434
130 H 1.000** 951.434
131 G 1.000** 951.434
132 I 1.000** 951.434
133 Q 1.000** 951.434
134 T 1.000** 951.434
135 A 1.000** 951.434
136 L 1.000** 951.434
137 F 1.000** 951.434
138 A 1.000** 951.434
139 Q 1.000** 951.434
140 Q 1.000** 951.434
141 M 1.000** 951.434
142 A 1.000** 951.434
143 A 1.000** 951.434
144 R 1.000** 951.434
145 A 1.000** 951.434
146 Q 1.000** 951.434
147 L 1.000** 951.434
148 E 1.000** 951.434
149 Q 1.000** 951.434
150 M 1.000** 951.434
151 R 1.000** 951.434
152 H 1.000** 951.434
153 S 1.000** 951.434
154 A 1.000** 951.434
155 L 1.000** 951.434
156 P 1.000** 951.434
157 P 1.000** 951.434
158 G 1.000** 951.434
159 M 1.000** 951.434
160 G 1.000** 951.434
161 K 1.000** 951.434
162 P 1.000** 951.434
163 G 1.000** 951.434
164 Q 1.000** 951.434
165 A 1.000** 951.434
166 G 1.000** 951.434
167 G 1.000** 951.434
168 Q 1.000** 951.434
169 G 1.000** 951.434
170 T 1.000** 951.434
171 G 1.000** 951.434
172 Q 1.000** 951.434
173 Y 1.000** 951.434
174 L 1.000** 951.434
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907536_1_117_MLBR_RS00565)
Pr(w>1) post mean +- SE for w
15 V 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -678.238862 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005847 0.000100 0.661697 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005867
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005847);
(NC_011896_1_WP_010907536_1_117_MLBR_RS00565: 0.000004, NC_002677_1_NP_301211_1_83_ML0115: 0.000004, NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585: 0.000004, NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090: 0.000004, NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595: 0.000004, NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610: 0.005847);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.66170 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99993 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 426.7 95.3 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.006 426.7 95.3 1.0000 0.0019 0.0019 0.8 0.2
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -678.057860 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.005730 0.000100 0.000010 29.969281 0.005000 951.371957
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.005750
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.005730);
(NC_011896_1_WP_010907536_1_117_MLBR_RS00565: 0.000004, NC_002677_1_NP_301211_1_83_ML0115: 0.000004, NZ_LVXE01000022_1_WP_010907536_1_951_A3216_RS07585: 0.000004, NZ_LYPH01000026_1_WP_010907536_1_1068_A8144_RS05090: 0.000004, NZ_CP029543_1_WP_041322286_1_116_DIJ64_RS00595: 0.000004, NZ_AP014567_1_WP_119607861_1_119_JK2ML_RS00610: 0.005730);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 29.96928 q = 0.00500
(p1 = 0.99999) w = 951.37196
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.37196
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 426.7 95.3 951.3625 0.0000 0.0000 0.0 0.0
7..2 0.000 426.7 95.3 951.3625 0.0000 0.0000 0.0 0.0
7..3 0.000 426.7 95.3 951.3625 0.0000 0.0000 0.0 0.0
7..4 0.000 426.7 95.3 951.3625 0.0000 0.0000 0.0 0.0
7..5 0.000 426.7 95.3 951.3625 0.0000 0.0000 0.0 0.0
7..6 0.006 426.7 95.3 951.3625 0.0023 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907536_1_117_MLBR_RS00565)
Pr(w>1) post mean +- SE for w
1 L 1.000** 951.362
2 N 1.000** 951.362
3 N 1.000** 951.362
4 D 1.000** 951.362
5 N 1.000** 951.362
6 D 1.000** 951.362
7 D 1.000** 951.362
8 S 1.000** 951.362
9 I 1.000** 951.362
10 E 1.000** 951.362
11 I 1.000** 951.362
12 I 1.000** 951.362
13 G 1.000** 951.362
14 G 1.000** 951.362
15 V 1.000** 951.372
16 D 1.000** 951.362
17 P 1.000** 951.362
18 R 1.000** 951.362
19 T 1.000** 951.362
20 M 1.000** 951.362
21 A 1.000** 951.362
22 T 1.000** 951.362
23 R 1.000** 951.362
24 G 1.000** 951.362
25 E 1.000** 951.362
26 D 1.000** 951.362
27 E 1.000** 951.362
28 S 1.000** 951.362
29 R 1.000** 951.362
30 D 1.000** 951.362
31 S 1.000** 951.362
32 D 1.000** 951.362
33 E 1.000** 951.362
34 P 1.000** 951.362
35 S 1.000** 951.362
36 L 1.000** 951.362
37 T 1.000** 951.362
38 D 1.000** 951.362
39 L 1.000** 951.362
40 V 1.000** 951.362
41 E 1.000** 951.362
42 Q 1.000** 951.362
43 P 1.000** 951.362
44 A 1.000** 951.362
45 K 1.000** 951.362
46 V 1.000** 951.362
47 M 1.000** 951.362
48 R 1.000** 951.362
49 I 1.000** 951.362
50 G 1.000** 951.362
51 T 1.000** 951.362
52 M 1.000** 951.362
53 I 1.000** 951.362
54 K 1.000** 951.362
55 Q 1.000** 951.362
56 L 1.000** 951.362
57 L 1.000** 951.362
58 E 1.000** 951.362
59 E 1.000** 951.362
60 V 1.000** 951.362
61 R 1.000** 951.362
62 A 1.000** 951.362
63 A 1.000** 951.362
64 P 1.000** 951.362
65 L 1.000** 951.362
66 D 1.000** 951.362
67 E 1.000** 951.362
68 A 1.000** 951.362
69 S 1.000** 951.362
70 R 1.000** 951.362
71 N 1.000** 951.362
72 Q 1.000** 951.362
73 L 1.000** 951.362
74 R 1.000** 951.362
75 E 1.000** 951.362
76 I 1.000** 951.362
77 H 1.000** 951.362
78 A 1.000** 951.362
79 T 1.000** 951.362
80 S 1.000** 951.362
81 I 1.000** 951.362
82 R 1.000** 951.362
83 E 1.000** 951.362
84 L 1.000** 951.362
85 E 1.000** 951.362
86 D 1.000** 951.362
87 G 1.000** 951.362
88 L 1.000** 951.362
89 A 1.000** 951.362
90 P 1.000** 951.362
91 E 1.000** 951.362
92 L 1.000** 951.362
93 R 1.000** 951.362
94 E 1.000** 951.362
95 E 1.000** 951.362
96 L 1.000** 951.362
97 D 1.000** 951.362
98 R 1.000** 951.362
99 L 1.000** 951.362
100 T 1.000** 951.362
101 L 1.000** 951.362
102 P 1.000** 951.362
103 F 1.000** 951.362
104 N 1.000** 951.362
105 E 1.000** 951.362
106 S 1.000** 951.362
107 T 1.000** 951.362
108 A 1.000** 951.362
109 P 1.000** 951.362
110 S 1.000** 951.362
111 N 1.000** 951.362
112 A 1.000** 951.362
113 E 1.000** 951.362
114 L 1.000** 951.362
115 R 1.000** 951.362
116 I 1.000** 951.362
117 A 1.000** 951.362
118 Q 1.000** 951.362
119 A 1.000** 951.362
120 Q 1.000** 951.362
121 L 1.000** 951.362
122 V 1.000** 951.362
123 G 1.000** 951.362
124 W 1.000** 951.362
125 L 1.000** 951.362
126 E 1.000** 951.362
127 G 1.000** 951.362
128 L 1.000** 951.362
129 F 1.000** 951.362
130 H 1.000** 951.362
131 G 1.000** 951.362
132 I 1.000** 951.362
133 Q 1.000** 951.362
134 T 1.000** 951.362
135 A 1.000** 951.362
136 L 1.000** 951.362
137 F 1.000** 951.362
138 A 1.000** 951.362
139 Q 1.000** 951.362
140 Q 1.000** 951.362
141 M 1.000** 951.362
142 A 1.000** 951.362
143 A 1.000** 951.362
144 R 1.000** 951.362
145 A 1.000** 951.362
146 Q 1.000** 951.362
147 L 1.000** 951.362
148 E 1.000** 951.362
149 Q 1.000** 951.362
150 M 1.000** 951.362
151 R 1.000** 951.362
152 H 1.000** 951.362
153 S 1.000** 951.362
154 A 1.000** 951.362
155 L 1.000** 951.362
156 P 1.000** 951.362
157 P 1.000** 951.362
158 G 1.000** 951.362
159 M 1.000** 951.362
160 G 1.000** 951.362
161 K 1.000** 951.362
162 P 1.000** 951.362
163 G 1.000** 951.362
164 Q 1.000** 951.362
165 A 1.000** 951.362
166 G 1.000** 951.362
167 G 1.000** 951.362
168 Q 1.000** 951.362
169 G 1.000** 951.362
170 T 1.000** 951.362
171 G 1.000** 951.362
172 Q 1.000** 951.362
173 Y 1.000** 951.362
174 L 1.000** 951.362
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907536_1_117_MLBR_RS00565)
Pr(w>1) post mean +- SE for w
1 L 0.639 4.860 +- 3.856
2 N 0.639 4.860 +- 3.856
3 N 0.639 4.860 +- 3.856
4 D 0.639 4.860 +- 3.856
5 N 0.639 4.860 +- 3.856
6 D 0.639 4.860 +- 3.856
7 D 0.639 4.860 +- 3.856
8 S 0.639 4.860 +- 3.856
9 I 0.639 4.860 +- 3.856
10 E 0.639 4.860 +- 3.856
11 I 0.639 4.860 +- 3.856
12 I 0.639 4.860 +- 3.856
13 G 0.639 4.860 +- 3.856
14 G 0.639 4.860 +- 3.856
15 V 0.923 6.858 +- 3.003
16 D 0.639 4.860 +- 3.856
17 P 0.639 4.860 +- 3.856
18 R 0.639 4.860 +- 3.856
19 T 0.639 4.860 +- 3.856
20 M 0.639 4.860 +- 3.856
21 A 0.639 4.860 +- 3.856
22 T 0.639 4.860 +- 3.856
23 R 0.639 4.860 +- 3.856
24 G 0.639 4.860 +- 3.856
25 E 0.639 4.860 +- 3.856
26 D 0.639 4.860 +- 3.856
27 E 0.639 4.860 +- 3.856
28 S 0.639 4.860 +- 3.856
29 R 0.639 4.860 +- 3.856
30 D 0.639 4.860 +- 3.856
31 S 0.639 4.860 +- 3.856
32 D 0.639 4.860 +- 3.856
33 E 0.639 4.860 +- 3.856
34 P 0.639 4.860 +- 3.856
35 S 0.639 4.860 +- 3.856
36 L 0.639 4.860 +- 3.856
37 T 0.639 4.860 +- 3.856
38 D 0.639 4.860 +- 3.856
39 L 0.639 4.860 +- 3.856
40 V 0.639 4.860 +- 3.856
41 E 0.639 4.860 +- 3.856
42 Q 0.639 4.860 +- 3.856
43 P 0.639 4.860 +- 3.856
44 A 0.639 4.860 +- 3.856
45 K 0.639 4.860 +- 3.856
46 V 0.639 4.860 +- 3.856
47 M 0.639 4.860 +- 3.856
48 R 0.639 4.860 +- 3.856
49 I 0.639 4.860 +- 3.856
50 G 0.639 4.860 +- 3.856
51 T 0.639 4.860 +- 3.856
52 M 0.639 4.860 +- 3.856
53 I 0.639 4.860 +- 3.856
54 K 0.639 4.860 +- 3.856
55 Q 0.639 4.860 +- 3.856
56 L 0.639 4.860 +- 3.856
57 L 0.639 4.860 +- 3.856
58 E 0.639 4.860 +- 3.856
59 E 0.639 4.860 +- 3.856
60 V 0.639 4.860 +- 3.856
61 R 0.639 4.860 +- 3.856
62 A 0.639 4.860 +- 3.856
63 A 0.639 4.860 +- 3.856
64 P 0.639 4.860 +- 3.856
65 L 0.639 4.860 +- 3.856
66 D 0.639 4.860 +- 3.856
67 E 0.639 4.860 +- 3.856
68 A 0.639 4.860 +- 3.856
69 S 0.639 4.860 +- 3.856
70 R 0.639 4.860 +- 3.856
71 N 0.639 4.860 +- 3.856
72 Q 0.639 4.860 +- 3.856
73 L 0.639 4.860 +- 3.856
74 R 0.639 4.860 +- 3.856
75 E 0.639 4.860 +- 3.856
76 I 0.639 4.860 +- 3.856
77 H 0.639 4.860 +- 3.856
78 A 0.639 4.860 +- 3.856
79 T 0.639 4.860 +- 3.856
80 S 0.639 4.860 +- 3.856
81 I 0.639 4.860 +- 3.856
82 R 0.639 4.860 +- 3.856
83 E 0.639 4.860 +- 3.856
84 L 0.639 4.860 +- 3.856
85 E 0.639 4.860 +- 3.856
86 D 0.639 4.860 +- 3.856
87 G 0.639 4.860 +- 3.856
88 L 0.639 4.860 +- 3.856
89 A 0.639 4.860 +- 3.856
90 P 0.639 4.860 +- 3.856
91 E 0.639 4.860 +- 3.856
92 L 0.639 4.860 +- 3.856
93 R 0.639 4.860 +- 3.856
94 E 0.639 4.860 +- 3.856
95 E 0.639 4.860 +- 3.856
96 L 0.639 4.860 +- 3.856
97 D 0.639 4.860 +- 3.856
98 R 0.639 4.860 +- 3.856
99 L 0.639 4.860 +- 3.856
100 T 0.639 4.860 +- 3.856
101 L 0.639 4.860 +- 3.856
102 P 0.639 4.860 +- 3.856
103 F 0.639 4.860 +- 3.856
104 N 0.639 4.860 +- 3.856
105 E 0.639 4.860 +- 3.856
106 S 0.639 4.860 +- 3.856
107 T 0.639 4.860 +- 3.856
108 A 0.639 4.860 +- 3.856
109 P 0.639 4.860 +- 3.856
110 S 0.639 4.860 +- 3.856
111 N 0.639 4.860 +- 3.856
112 A 0.639 4.860 +- 3.856
113 E 0.639 4.860 +- 3.856
114 L 0.639 4.860 +- 3.856
115 R 0.639 4.860 +- 3.856
116 I 0.639 4.860 +- 3.856
117 A 0.639 4.860 +- 3.856
118 Q 0.639 4.860 +- 3.856
119 A 0.639 4.860 +- 3.856
120 Q 0.639 4.860 +- 3.856
121 L 0.639 4.860 +- 3.856
122 V 0.639 4.860 +- 3.856
123 G 0.639 4.860 +- 3.856
124 W 0.639 4.860 +- 3.856
125 L 0.639 4.860 +- 3.856
126 E 0.639 4.860 +- 3.856
127 G 0.639 4.860 +- 3.856
128 L 0.639 4.860 +- 3.856
129 F 0.639 4.860 +- 3.856
130 H 0.639 4.860 +- 3.856
131 G 0.639 4.860 +- 3.856
132 I 0.639 4.860 +- 3.856
133 Q 0.639 4.860 +- 3.856
134 T 0.639 4.860 +- 3.856
135 A 0.639 4.860 +- 3.856
136 L 0.639 4.860 +- 3.856
137 F 0.639 4.860 +- 3.856
138 A 0.639 4.860 +- 3.856
139 Q 0.639 4.860 +- 3.856
140 Q 0.639 4.860 +- 3.856
141 M 0.639 4.860 +- 3.856
142 A 0.639 4.860 +- 3.856
143 A 0.639 4.860 +- 3.856
144 R 0.639 4.860 +- 3.856
145 A 0.639 4.860 +- 3.856
146 Q 0.639 4.860 +- 3.856
147 L 0.639 4.860 +- 3.856
148 E 0.639 4.860 +- 3.856
149 Q 0.639 4.860 +- 3.856
150 M 0.639 4.860 +- 3.856
151 R 0.639 4.860 +- 3.856
152 H 0.639 4.860 +- 3.856
153 S 0.639 4.860 +- 3.856
154 A 0.639 4.860 +- 3.856
155 L 0.639 4.860 +- 3.856
156 P 0.639 4.860 +- 3.856
157 P 0.639 4.860 +- 3.856
158 G 0.639 4.860 +- 3.856
159 M 0.639 4.860 +- 3.856
160 G 0.639 4.860 +- 3.856
161 K 0.639 4.860 +- 3.856
162 P 0.639 4.860 +- 3.856
163 G 0.639 4.860 +- 3.856
164 Q 0.639 4.860 +- 3.856
165 A 0.639 4.860 +- 3.856
166 G 0.639 4.860 +- 3.856
167 G 0.639 4.860 +- 3.856
168 Q 0.639 4.860 +- 3.856
169 G 0.639 4.860 +- 3.856
170 T 0.639 4.860 +- 3.856
171 G 0.639 4.860 +- 3.856
172 Q 0.639 4.860 +- 3.856
173 Y 0.639 4.860 +- 3.856
174 L 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:24
Model 1: NearlyNeutral -678.238861 Model 2: PositiveSelection -678.057859 Model 0: one-ratio -678.05785 Model 7: beta -678.238862 Model 8: beta&w>1 -678.05786 Model 0 vs 1 0.3620220000000245 Model 2 vs 1 0.36200400000006994 Model 8 vs 7 0.36200400000006994
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
