>C1
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C2
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C3
LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
LHTVSQNPPPTSLARQKRPLRFGooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooo
>C4
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo
>C5
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=653
C1 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C2 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C3 --------------------------------------------------
C4 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C5 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C1 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C2 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C3 --------------------------------------------------
C4 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C5 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C1 RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C2 RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C3 --------------------------------------------------
C4 RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C5 RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C1 RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C2 RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C3 --------------------------------------------------
C4 RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C5 RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C1 LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C2 LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C3 ---------------LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C4 LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C5 LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
***********************************
C1 WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C2 WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C3 WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C4 WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C5 WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
**************************************************
C1 VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C2 VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C3 VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C4 VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C5 VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
**************************************************
C1 QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C2 QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C3 QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C4 QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C5 QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
**************************************************
C1 LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
C2 LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
C3 LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFGoooooooooooo
C4 LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo------------
C5 LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
******************************
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 oooooooooooooooooooooooooooooooooooooooooooooooooo
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 oooooooooooooooooooooooooooooooooooooooooooooooooo
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 oooooooooooooooooooooooooooooooooooooooooooooooooo
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 oooooooooooooooooooooooooooooooooooooooooooooooooo
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 ---
C2 ---
C3 ooo
C4 ---
C5 ---
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 438 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 438 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [19272]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [19272]--->[14924]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.517 Mb, Max= 31.087 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C2 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C3 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C4 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C5 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
**************************************************
C1 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C2 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C3 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C4 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C5 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
**************************************************
C1 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C2 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C3 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C4 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C5 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
**************************************************
C1 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C2 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C3 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C4 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C5 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
**************************************************
C1 LHTVSQNPPPTSLARQKRPLRFG
C2 LHTVSQNPPPTSLARQKRPLRFG
C3 LHTVSQNPPPTSLARQKRPLRFG
C4 LHTVSQNPPPTSLARoooooooo
C5 LHTVSQNPPPTSLARQKRPLRFG
***************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:73 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 98.17 C1 C4 98.17
TOP 3 0 98.17 C4 C1 98.17
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 98.17 C2 C4 98.17
TOP 3 1 98.17 C4 C2 98.17
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 2 3 96.41 C3 C4 96.41
TOP 3 2 96.41 C4 C3 96.41
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 3 4 98.17 C4 C5 98.17
TOP 4 3 98.17 C5 C4 98.17
AVG 0 C1 * 99.54
AVG 1 C2 * 99.54
AVG 2 C3 * 99.10
AVG 3 C4 * 97.73
AVG 4 C5 * 99.54
TOT TOT * 99.09
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C2 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C3 --------------------------------------------------
C4 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C5 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C1 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C2 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C3 --------------------------------------------------
C4 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C5 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C1 CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C2 CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C3 --------------------------------------------------
C4 CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C5 CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C1 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C2 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C3 --------------------------------------------------
C4 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C5 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C1 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C2 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C3 --------------------------------------------------
C4 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C5 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C1 TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C2 TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C3 --------------------------------------------------
C4 TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C5 TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C1 CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C2 CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C3 --------------------------------------------------
C4 CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C5 CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C1 CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C2 CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C3 --------------------------------------------------
C4 CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C5 CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C1 CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C2 CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C3 --------------------------------------------------
C4 CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C5 CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C1 CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C2 CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C3 --------------------------------------------------
C4 CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C5 CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C1 CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C2 CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C3 --------------------------------------------------
C4 CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C5 CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C1 TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C2 TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C3 --------------------------------------------------
C4 TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C5 TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C1 CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
C2 CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
C3 ---------------------------------------------CTTTA
C4 CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACCCTTTA
C5 CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
*****
C1 TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C2 TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C3 TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C4 TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C5 TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
**************************************************
C1 AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C2 AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C3 AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C4 AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C5 AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
**************************************************
C1 TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C2 TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C3 TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C4 TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C5 TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
**************************************************
C1 TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C2 TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C3 TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C4 TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C5 TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
**************************************************
C1 TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C2 TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C3 TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C4 TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C5 TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
**************************************************
C1 GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C2 GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C3 GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C4 GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C5 GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
**************************************************
C1 AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C2 AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C3 AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C4 AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C5 AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
**************************************************
C1 AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C2 AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C3 AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C4 AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C5 AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
**************************************************
C1 CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C2 CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C3 CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C4 CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C5 CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
**************************************************
C1 GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C2 GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C3 GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C4 GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C5 GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
**************************************************
C1 TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C2 TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C3 TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C4 TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C5 TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
**************************************************
C1 TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C2 TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C3 TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C4 TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C5 TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
**************************************************
C1 CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C2 CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C3 CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C4 CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGA----------
C5 CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
****************************************
C1 CCCTGCGGTTCGGC------------------------------------
C2 CCCTGCGGTTCGGC------------------------------------
C3 CCCTGCGGTTCGGC------------------------------------
C4 --------------------------------------------------
C5 CCCTGCGGTTCGGC------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 --------------------------------------------------
C2 --------------------------------------------------
C3 --------------------------------------------------
C4 --------------------------------------------------
C5 --------------------------------------------------
C1 ---------
C2 ---------
C3 ---------
C4 ---------
C5 ---------
>C1
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C2
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C3
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------------------------------------------CTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C4
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACCCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGA----------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C5
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C1
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C2
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C3
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C4
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo
>C5
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 1959 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579790732
Setting output file names to "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 363994164
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0606926922
Seed = 1397246467
Swapseed = 1579790732
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 13 unique site patterns
Division 2 has 13 unique site patterns
Division 3 has 12 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2637.619777 -- -25.624409
Chain 2 -- -2637.491466 -- -25.624409
Chain 3 -- -2637.491466 -- -25.624409
Chain 4 -- -2636.916146 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2636.916146 -- -25.624409
Chain 2 -- -2637.577652 -- -25.624409
Chain 3 -- -2637.491467 -- -25.624409
Chain 4 -- -2637.491466 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2637.620] (-2637.491) (-2637.491) (-2636.916) * [-2636.916] (-2637.578) (-2637.491) (-2637.491)
500 -- [-1817.035] (-1812.922) (-1826.018) (-1812.715) * (-1812.958) (-1820.388) [-1825.387] (-1818.573) -- 0:00:00
1000 -- (-1811.047) [-1807.140] (-1822.021) (-1810.024) * (-1808.200) (-1814.905) [-1809.770] (-1812.950) -- 0:00:00
1500 -- (-1807.004) [-1810.446] (-1816.416) (-1807.855) * (-1812.344) (-1801.540) [-1811.150] (-1820.764) -- 0:00:00
2000 -- (-1809.046) [-1807.768] (-1807.264) (-1809.811) * (-1809.219) (-1807.455) [-1805.801] (-1807.567) -- 0:08:19
2500 -- (-1806.667) [-1813.234] (-1810.229) (-1806.647) * (-1804.706) (-1803.162) [-1810.081] (-1810.386) -- 0:06:39
3000 -- (-1808.601) (-1814.814) [-1813.430] (-1813.908) * [-1809.203] (-1805.967) (-1811.267) (-1807.414) -- 0:05:32
3500 -- [-1810.138] (-1812.338) (-1809.691) (-1812.905) * (-1805.052) [-1807.954] (-1812.740) (-1806.091) -- 0:04:44
4000 -- [-1806.143] (-1808.325) (-1816.290) (-1809.386) * (-1812.978) [-1807.639] (-1817.614) (-1810.197) -- 0:04:09
4500 -- [-1813.576] (-1816.116) (-1806.413) (-1814.585) * [-1814.494] (-1809.648) (-1808.886) (-1806.439) -- 0:03:41
5000 -- (-1805.602) (-1805.729) [-1808.890] (-1811.515) * (-1812.067) (-1807.504) (-1808.928) [-1809.293] -- 0:03:19
Average standard deviation of split frequencies: 0.087297
5500 -- (-1809.241) [-1809.982] (-1805.260) (-1808.208) * (-1819.823) (-1804.364) (-1814.157) [-1811.761] -- 0:03:00
6000 -- (-1812.581) (-1814.450) (-1815.232) [-1807.269] * [-1809.078] (-1810.414) (-1809.229) (-1811.841) -- 0:02:45
6500 -- (-1807.830) (-1809.723) (-1810.650) [-1809.245] * [-1814.685] (-1805.384) (-1804.359) (-1806.666) -- 0:02:32
7000 -- (-1813.836) (-1810.162) [-1809.345] (-1805.851) * [-1811.998] (-1806.963) (-1806.454) (-1811.733) -- 0:02:21
7500 -- (-1808.527) (-1810.135) [-1804.368] (-1808.388) * (-1814.941) (-1813.314) (-1813.043) [-1811.702] -- 0:02:12
8000 -- [-1809.345] (-1814.141) (-1825.470) (-1809.026) * (-1821.670) (-1808.614) [-1806.676] (-1806.329) -- 0:02:04
8500 -- (-1816.050) [-1809.794] (-1807.596) (-1808.522) * (-1810.132) (-1804.696) [-1807.465] (-1807.674) -- 0:01:56
9000 -- (-1811.923) [-1808.912] (-1807.491) (-1809.146) * [-1805.641] (-1804.452) (-1808.956) (-1809.529) -- 0:01:50
9500 -- (-1807.079) (-1810.187) (-1813.373) [-1809.327] * (-1807.505) (-1808.432) (-1811.341) [-1811.437] -- 0:01:44
10000 -- [-1806.123] (-1813.986) (-1809.810) (-1809.923) * (-1810.856) (-1803.766) (-1808.205) [-1811.243] -- 0:01:39
Average standard deviation of split frequencies: 0.068746
10500 -- (-1808.522) (-1810.467) (-1815.961) [-1809.887] * (-1815.754) [-1803.234] (-1807.834) (-1817.570) -- 0:01:34
11000 -- (-1811.091) (-1806.581) (-1821.738) [-1808.066] * (-1809.157) [-1805.595] (-1807.565) (-1806.937) -- 0:01:29
11500 -- (-1812.397) (-1810.673) (-1809.880) [-1812.948] * (-1807.696) (-1806.686) [-1811.434] (-1806.432) -- 0:02:51
12000 -- (-1809.848) [-1806.226] (-1813.871) (-1809.060) * [-1812.521] (-1809.737) (-1812.774) (-1808.724) -- 0:02:44
12500 -- (-1812.517) (-1820.812) [-1807.553] (-1819.618) * [-1808.894] (-1804.688) (-1804.256) (-1813.016) -- 0:02:38
13000 -- (-1813.463) (-1809.703) (-1808.360) [-1805.487] * (-1811.203) (-1805.550) [-1807.361] (-1808.941) -- 0:02:31
13500 -- (-1805.808) (-1818.645) [-1810.683] (-1813.440) * (-1806.025) [-1804.719] (-1809.658) (-1806.152) -- 0:02:26
14000 -- (-1804.654) (-1811.585) (-1809.955) [-1804.462] * [-1809.944] (-1806.903) (-1806.938) (-1806.345) -- 0:02:20
14500 -- [-1802.899] (-1814.077) (-1812.182) (-1807.533) * [-1812.729] (-1806.837) (-1807.167) (-1806.922) -- 0:02:15
15000 -- (-1803.043) (-1808.565) [-1809.912] (-1810.317) * (-1813.132) (-1804.632) [-1808.999] (-1808.398) -- 0:02:11
Average standard deviation of split frequencies: 0.052378
15500 -- (-1803.929) (-1806.340) [-1810.237] (-1811.176) * (-1809.845) [-1806.122] (-1807.871) (-1807.929) -- 0:02:07
16000 -- [-1804.826] (-1812.299) (-1809.458) (-1815.182) * (-1811.715) [-1804.254] (-1806.882) (-1807.462) -- 0:02:03
16500 -- [-1803.458] (-1813.362) (-1813.724) (-1812.524) * (-1806.714) (-1803.817) (-1807.600) [-1806.890] -- 0:01:59
17000 -- (-1804.221) (-1804.522) (-1815.634) [-1810.500] * (-1811.754) (-1803.459) [-1803.892] (-1804.848) -- 0:01:55
17500 -- [-1803.526] (-1804.747) (-1809.218) (-1818.818) * [-1804.886] (-1803.886) (-1812.575) (-1811.148) -- 0:01:52
18000 -- (-1804.028) (-1806.083) (-1811.760) [-1809.707] * (-1809.396) (-1803.980) [-1802.720] (-1805.318) -- 0:01:49
18500 -- [-1810.026] (-1806.035) (-1811.889) (-1806.677) * (-1803.270) (-1805.476) (-1805.004) [-1809.715] -- 0:01:46
19000 -- (-1806.189) [-1804.931] (-1810.604) (-1810.596) * (-1807.749) (-1805.676) (-1805.667) [-1805.587] -- 0:01:43
19500 -- (-1810.149) [-1801.980] (-1806.628) (-1813.408) * (-1810.640) (-1803.973) [-1804.440] (-1811.742) -- 0:01:40
20000 -- (-1807.753) (-1802.440) (-1806.610) [-1807.321] * [-1811.469] (-1803.980) (-1810.523) (-1809.820) -- 0:01:38
Average standard deviation of split frequencies: 0.059306
20500 -- [-1804.338] (-1804.316) (-1813.806) (-1806.050) * (-1822.939) [-1804.959] (-1806.621) (-1809.544) -- 0:01:35
21000 -- (-1803.891) (-1803.345) (-1809.567) [-1810.861] * (-1809.667) (-1805.400) (-1805.655) [-1805.690] -- 0:01:33
21500 -- (-1804.297) [-1803.365] (-1812.916) (-1806.464) * (-1806.060) [-1806.372] (-1813.801) (-1805.315) -- 0:02:16
22000 -- (-1805.294) (-1804.210) (-1806.316) [-1810.452] * (-1804.219) (-1804.103) (-1809.512) [-1804.476] -- 0:02:13
22500 -- (-1805.716) [-1804.147] (-1808.508) (-1811.809) * (-1810.865) (-1803.946) [-1804.572] (-1804.542) -- 0:02:10
23000 -- (-1806.610) (-1804.023) (-1810.839) [-1806.997] * [-1812.370] (-1804.583) (-1809.797) (-1805.075) -- 0:02:07
23500 -- (-1808.317) (-1809.010) [-1809.033] (-1812.250) * (-1810.740) (-1803.675) (-1811.188) [-1808.776] -- 0:02:04
24000 -- [-1804.045] (-1806.530) (-1812.393) (-1816.011) * [-1809.037] (-1804.750) (-1806.939) (-1805.432) -- 0:02:02
24500 -- (-1806.317) [-1805.146] (-1807.373) (-1815.152) * [-1812.603] (-1811.990) (-1810.480) (-1813.518) -- 0:01:59
25000 -- (-1806.937) [-1803.181] (-1809.786) (-1813.589) * [-1807.887] (-1809.419) (-1807.101) (-1806.160) -- 0:01:57
Average standard deviation of split frequencies: 0.061645
25500 -- (-1808.445) (-1802.779) [-1805.035] (-1805.675) * (-1811.827) (-1804.655) (-1810.248) [-1809.979] -- 0:01:54
26000 -- [-1805.112] (-1806.218) (-1808.608) (-1812.799) * (-1807.074) (-1804.313) [-1813.648] (-1805.911) -- 0:01:52
26500 -- (-1808.858) [-1805.407] (-1807.201) (-1811.933) * (-1809.436) (-1803.312) [-1811.798] (-1805.629) -- 0:01:50
27000 -- (-1803.048) (-1805.943) (-1805.978) [-1806.345] * (-1808.399) (-1805.029) [-1810.849] (-1807.495) -- 0:01:48
27500 -- (-1806.891) [-1803.993] (-1805.637) (-1806.432) * (-1804.651) (-1804.649) [-1807.898] (-1808.295) -- 0:01:46
28000 -- (-1803.875) (-1804.365) (-1809.238) [-1809.046] * (-1805.008) (-1805.117) (-1810.483) [-1813.000] -- 0:01:44
28500 -- (-1803.800) [-1803.266] (-1802.045) (-1812.728) * (-1809.911) [-1806.506] (-1806.724) (-1810.518) -- 0:01:42
29000 -- (-1804.943) [-1803.046] (-1815.219) (-1807.122) * (-1808.502) (-1802.715) (-1805.684) [-1808.584] -- 0:01:40
29500 -- (-1810.769) (-1802.478) [-1806.782] (-1812.391) * (-1808.071) [-1802.708] (-1814.339) (-1810.504) -- 0:01:38
30000 -- (-1805.256) [-1804.141] (-1816.450) (-1807.730) * (-1803.819) (-1803.301) (-1804.100) [-1806.237] -- 0:01:37
Average standard deviation of split frequencies: 0.039967
30500 -- (-1803.753) (-1803.339) [-1809.274] (-1814.064) * [-1806.331] (-1804.238) (-1807.892) (-1808.189) -- 0:01:35
31000 -- (-1804.112) (-1803.128) [-1807.173] (-1810.342) * (-1806.920) (-1804.817) [-1806.931] (-1803.953) -- 0:01:33
31500 -- (-1803.849) (-1803.291) [-1805.506] (-1805.475) * [-1809.698] (-1803.769) (-1808.046) (-1804.435) -- 0:02:02
32000 -- (-1805.404) (-1802.766) (-1808.621) [-1808.656] * [-1804.519] (-1805.644) (-1805.154) (-1803.646) -- 0:02:01
32500 -- (-1803.101) [-1806.311] (-1810.401) (-1809.038) * [-1803.751] (-1804.329) (-1811.270) (-1804.361) -- 0:01:59
33000 -- [-1803.529] (-1805.130) (-1805.135) (-1811.020) * (-1808.605) [-1804.177] (-1808.793) (-1803.213) -- 0:01:57
33500 -- (-1807.805) [-1803.549] (-1810.083) (-1811.143) * (-1808.282) (-1803.750) (-1817.244) [-1803.232] -- 0:01:55
34000 -- [-1808.536] (-1807.604) (-1805.503) (-1803.515) * (-1810.059) (-1803.024) (-1805.668) [-1804.080] -- 0:01:53
34500 -- (-1807.764) [-1804.725] (-1810.937) (-1806.227) * (-1810.336) (-1804.767) [-1804.710] (-1803.839) -- 0:01:51
35000 -- (-1804.251) (-1804.638) [-1807.503] (-1812.829) * [-1808.607] (-1805.738) (-1808.832) (-1804.725) -- 0:01:50
Average standard deviation of split frequencies: 0.044522
35500 -- (-1807.051) (-1804.387) [-1810.276] (-1813.646) * (-1805.142) [-1805.259] (-1814.776) (-1804.318) -- 0:01:48
36000 -- (-1805.047) [-1804.336] (-1809.857) (-1813.321) * (-1803.277) (-1805.513) (-1828.236) [-1804.646] -- 0:01:47
36500 -- (-1805.205) [-1803.503] (-1810.930) (-1813.494) * [-1806.026] (-1804.831) (-1807.086) (-1805.948) -- 0:01:45
37000 -- (-1804.543) (-1803.157) [-1805.241] (-1812.800) * (-1803.840) [-1804.250] (-1805.736) (-1804.912) -- 0:01:44
37500 -- (-1812.768) [-1806.109] (-1809.551) (-1809.035) * (-1817.830) (-1808.005) [-1806.341] (-1803.099) -- 0:01:42
38000 -- [-1806.091] (-1806.845) (-1803.682) (-1805.365) * (-1804.928) (-1806.174) [-1807.875] (-1802.949) -- 0:01:41
38500 -- (-1805.141) (-1807.933) (-1806.937) [-1804.973] * [-1806.525] (-1805.868) (-1807.746) (-1803.569) -- 0:01:39
39000 -- [-1804.221] (-1809.341) (-1806.719) (-1811.700) * [-1807.216] (-1805.882) (-1812.058) (-1803.244) -- 0:01:38
39500 -- [-1803.324] (-1810.011) (-1809.937) (-1805.328) * [-1806.998] (-1804.668) (-1814.896) (-1802.849) -- 0:01:37
40000 -- (-1803.125) (-1806.858) (-1811.737) [-1804.276] * (-1812.743) [-1806.487] (-1807.876) (-1803.436) -- 0:01:36
Average standard deviation of split frequencies: 0.053323
40500 -- [-1803.850] (-1807.666) (-1807.271) (-1808.548) * (-1809.995) [-1807.758] (-1807.591) (-1804.606) -- 0:01:34
41000 -- (-1804.519) [-1805.461] (-1820.619) (-1809.186) * (-1809.650) [-1804.276] (-1812.133) (-1805.072) -- 0:01:33
41500 -- (-1803.608) (-1807.672) (-1810.706) [-1802.292] * (-1805.933) (-1805.141) (-1814.974) [-1804.092] -- 0:01:32
42000 -- (-1807.987) (-1806.545) [-1810.737] (-1807.161) * [-1805.106] (-1804.829) (-1805.791) (-1805.522) -- 0:01:54
42500 -- (-1805.005) (-1804.899) [-1807.011] (-1808.743) * [-1814.084] (-1802.418) (-1815.478) (-1802.741) -- 0:01:52
43000 -- [-1807.465] (-1810.799) (-1807.014) (-1809.511) * [-1810.198] (-1802.616) (-1818.279) (-1802.678) -- 0:01:51
43500 -- (-1807.689) (-1808.763) [-1811.910] (-1805.018) * [-1805.603] (-1805.359) (-1804.684) (-1803.615) -- 0:01:49
44000 -- [-1807.580] (-1803.398) (-1811.387) (-1812.485) * (-1808.901) (-1806.199) [-1808.495] (-1803.624) -- 0:01:48
44500 -- [-1805.548] (-1806.607) (-1814.173) (-1810.723) * [-1809.652] (-1806.256) (-1808.165) (-1805.053) -- 0:01:47
45000 -- (-1807.824) (-1804.788) (-1807.047) [-1805.601] * [-1807.297] (-1807.906) (-1810.000) (-1803.421) -- 0:01:46
Average standard deviation of split frequencies: 0.047140
45500 -- (-1804.229) (-1803.546) (-1805.391) [-1807.010] * (-1808.746) (-1802.969) [-1809.177] (-1804.163) -- 0:01:44
46000 -- (-1806.652) (-1804.319) (-1807.912) [-1804.790] * (-1807.594) (-1804.721) [-1815.101] (-1805.917) -- 0:01:43
46500 -- (-1805.505) (-1805.718) [-1804.560] (-1808.414) * [-1808.826] (-1805.913) (-1808.590) (-1803.803) -- 0:01:42
47000 -- (-1804.395) (-1808.315) (-1807.111) [-1806.935] * (-1809.762) [-1804.014] (-1809.810) (-1805.783) -- 0:01:41
47500 -- [-1812.136] (-1804.981) (-1807.043) (-1812.486) * (-1808.027) [-1804.072] (-1810.825) (-1803.863) -- 0:01:40
48000 -- (-1803.412) [-1805.647] (-1808.470) (-1809.239) * [-1806.622] (-1803.210) (-1805.615) (-1803.949) -- 0:01:39
48500 -- (-1807.329) [-1804.775] (-1812.435) (-1814.654) * (-1805.261) (-1803.399) (-1811.126) [-1810.334] -- 0:01:38
49000 -- (-1804.414) [-1804.020] (-1807.814) (-1812.567) * [-1808.429] (-1803.527) (-1811.529) (-1809.259) -- 0:01:37
49500 -- [-1804.686] (-1803.817) (-1810.223) (-1806.187) * (-1807.607) (-1803.724) (-1809.942) [-1804.580] -- 0:01:36
50000 -- (-1805.030) (-1803.435) (-1809.306) [-1807.634] * (-1807.431) [-1804.887] (-1804.666) (-1804.920) -- 0:01:35
Average standard deviation of split frequencies: 0.048381
50500 -- (-1804.847) [-1803.607] (-1810.237) (-1812.547) * (-1810.000) [-1802.949] (-1805.902) (-1806.693) -- 0:01:34
51000 -- (-1804.976) (-1805.008) [-1811.249] (-1808.079) * [-1809.141] (-1802.513) (-1808.112) (-1803.023) -- 0:01:33
51500 -- (-1803.057) (-1805.659) (-1808.623) [-1810.456] * (-1807.594) [-1802.491] (-1806.567) (-1804.381) -- 0:01:32
52000 -- (-1803.661) (-1803.817) [-1809.358] (-1822.082) * (-1804.600) (-1804.185) [-1805.701] (-1802.852) -- 0:01:31
52500 -- (-1804.913) [-1802.922] (-1808.505) (-1807.703) * [-1811.733] (-1804.274) (-1812.088) (-1805.662) -- 0:01:48
53000 -- [-1803.499] (-1803.178) (-1807.902) (-1809.432) * (-1812.713) (-1803.217) (-1810.576) [-1803.461] -- 0:01:47
53500 -- [-1803.831] (-1802.403) (-1811.768) (-1807.294) * [-1807.405] (-1802.012) (-1805.910) (-1806.891) -- 0:01:46
54000 -- (-1804.650) (-1804.614) [-1809.397] (-1812.212) * (-1812.448) [-1802.765] (-1808.493) (-1804.156) -- 0:01:45
54500 -- (-1805.410) (-1804.587) (-1809.179) [-1809.849] * (-1814.623) (-1802.190) [-1803.096] (-1804.049) -- 0:01:44
55000 -- (-1805.501) (-1809.037) [-1808.900] (-1811.837) * (-1808.409) [-1802.519] (-1804.912) (-1803.764) -- 0:01:43
Average standard deviation of split frequencies: 0.048824
55500 -- (-1803.329) [-1803.335] (-1806.920) (-1804.583) * (-1809.211) (-1803.776) [-1812.564] (-1803.864) -- 0:01:42
56000 -- (-1805.851) (-1803.450) (-1807.591) [-1806.686] * [-1807.325] (-1805.961) (-1808.843) (-1803.107) -- 0:01:41
56500 -- (-1805.069) [-1802.960] (-1810.890) (-1813.209) * [-1812.111] (-1807.783) (-1807.035) (-1803.353) -- 0:01:40
57000 -- (-1807.024) [-1803.483] (-1806.099) (-1808.067) * (-1808.380) (-1809.453) [-1805.213] (-1803.422) -- 0:01:39
57500 -- (-1803.353) (-1805.657) [-1817.320] (-1808.620) * (-1808.668) [-1806.571] (-1806.700) (-1804.275) -- 0:01:38
58000 -- (-1803.217) (-1802.545) [-1812.596] (-1805.302) * (-1806.566) [-1804.390] (-1808.437) (-1803.894) -- 0:01:37
58500 -- (-1804.022) [-1804.489] (-1806.922) (-1806.323) * (-1804.483) [-1803.515] (-1806.412) (-1802.992) -- 0:01:36
59000 -- (-1804.048) (-1803.071) [-1808.240] (-1809.949) * (-1806.189) (-1807.564) (-1807.355) [-1803.068] -- 0:01:35
59500 -- (-1805.594) (-1804.400) [-1805.455] (-1803.910) * (-1813.173) (-1807.219) [-1804.567] (-1803.426) -- 0:01:34
60000 -- (-1808.039) [-1804.014] (-1805.461) (-1806.861) * [-1804.908] (-1805.042) (-1804.512) (-1803.611) -- 0:01:34
Average standard deviation of split frequencies: 0.041960
60500 -- [-1808.334] (-1806.408) (-1805.419) (-1803.231) * [-1807.592] (-1806.711) (-1810.870) (-1804.325) -- 0:01:33
61000 -- [-1806.274] (-1803.344) (-1808.075) (-1804.259) * [-1805.500] (-1810.987) (-1808.720) (-1802.865) -- 0:01:32
61500 -- (-1805.332) (-1806.803) [-1806.147] (-1803.254) * (-1804.992) (-1805.054) (-1811.043) [-1803.737] -- 0:01:31
62000 -- (-1806.506) (-1806.841) [-1805.882] (-1804.627) * [-1806.899] (-1804.468) (-1807.541) (-1803.057) -- 0:01:30
62500 -- (-1804.986) (-1804.005) (-1808.318) [-1803.090] * [-1808.215] (-1803.436) (-1811.096) (-1803.694) -- 0:01:30
63000 -- (-1805.059) [-1802.642] (-1809.675) (-1804.321) * [-1808.830] (-1803.751) (-1813.359) (-1805.482) -- 0:01:29
63500 -- (-1804.884) [-1805.189] (-1806.072) (-1803.613) * (-1808.514) [-1806.405] (-1805.508) (-1803.400) -- 0:01:43
64000 -- (-1804.581) [-1803.281] (-1808.569) (-1803.632) * (-1811.116) (-1808.058) [-1802.211] (-1803.400) -- 0:01:42
64500 -- [-1804.148] (-1805.121) (-1809.933) (-1805.930) * (-1813.084) [-1803.965] (-1812.591) (-1804.291) -- 0:01:41
65000 -- (-1803.962) [-1805.940] (-1813.533) (-1807.956) * (-1808.901) (-1804.871) [-1812.062] (-1806.657) -- 0:01:40
Average standard deviation of split frequencies: 0.039998
65500 -- (-1803.798) (-1807.996) (-1806.467) [-1802.746] * [-1812.659] (-1804.316) (-1807.080) (-1804.380) -- 0:01:39
66000 -- [-1807.086] (-1805.157) (-1805.932) (-1803.044) * (-1806.294) [-1808.314] (-1806.806) (-1803.784) -- 0:01:39
66500 -- [-1803.218] (-1805.981) (-1805.462) (-1805.627) * [-1803.582] (-1805.763) (-1807.768) (-1803.321) -- 0:01:38
67000 -- (-1806.682) (-1803.413) [-1805.292] (-1810.156) * (-1817.742) (-1805.857) (-1807.433) [-1804.023] -- 0:01:37
67500 -- (-1804.072) (-1803.457) [-1804.759] (-1808.194) * (-1810.541) (-1807.469) [-1807.204] (-1804.356) -- 0:01:36
68000 -- (-1803.682) [-1805.730] (-1806.450) (-1804.445) * (-1817.771) (-1804.589) [-1812.738] (-1803.148) -- 0:01:35
68500 -- (-1805.507) [-1803.322] (-1808.664) (-1803.803) * (-1804.603) (-1807.059) [-1810.921] (-1803.543) -- 0:01:35
69000 -- (-1804.803) (-1802.701) [-1804.762] (-1805.487) * [-1805.844] (-1806.047) (-1812.811) (-1803.667) -- 0:01:34
69500 -- (-1806.809) (-1806.122) [-1806.181] (-1805.990) * (-1808.207) (-1805.443) [-1802.663] (-1804.598) -- 0:01:33
70000 -- [-1803.973] (-1802.385) (-1805.687) (-1803.367) * [-1807.844] (-1805.148) (-1806.157) (-1803.042) -- 0:01:33
Average standard deviation of split frequencies: 0.046696
70500 -- (-1804.831) (-1803.119) [-1802.253] (-1802.634) * (-1811.356) [-1804.327] (-1811.246) (-1805.872) -- 0:01:32
71000 -- (-1805.412) (-1803.317) (-1802.795) [-1802.125] * (-1810.881) (-1803.387) [-1807.440] (-1806.304) -- 0:01:31
71500 -- [-1811.790] (-1803.385) (-1803.058) (-1802.793) * (-1811.333) [-1803.084] (-1812.235) (-1804.324) -- 0:01:30
72000 -- [-1803.154] (-1803.288) (-1803.713) (-1803.999) * (-1811.350) [-1802.586] (-1812.554) (-1806.974) -- 0:01:30
72500 -- (-1803.056) [-1805.073] (-1805.485) (-1804.838) * (-1813.025) (-1802.080) (-1816.242) [-1804.049] -- 0:01:29
73000 -- [-1802.779] (-1804.548) (-1804.593) (-1804.667) * (-1814.282) (-1803.962) [-1808.589] (-1804.487) -- 0:01:28
73500 -- [-1805.953] (-1804.977) (-1803.816) (-1803.567) * (-1811.504) (-1804.349) (-1818.908) [-1804.587] -- 0:01:28
74000 -- (-1805.755) (-1805.945) (-1804.393) [-1807.561] * [-1804.435] (-1802.563) (-1813.476) (-1803.836) -- 0:01:40
74500 -- [-1807.369] (-1805.613) (-1809.033) (-1806.532) * (-1808.325) [-1802.638] (-1803.785) (-1803.754) -- 0:01:39
75000 -- [-1811.784] (-1803.458) (-1807.003) (-1804.728) * (-1807.104) (-1806.515) [-1802.783] (-1805.578) -- 0:01:38
Average standard deviation of split frequencies: 0.047140
75500 -- (-1810.772) [-1805.378] (-1808.162) (-1805.682) * (-1806.846) (-1804.952) [-1805.558] (-1804.062) -- 0:01:37
76000 -- (-1810.453) (-1803.877) [-1809.405] (-1804.195) * [-1810.666] (-1805.530) (-1807.537) (-1807.419) -- 0:01:37
76500 -- (-1803.303) (-1803.711) [-1803.520] (-1803.013) * [-1808.618] (-1807.561) (-1805.356) (-1808.459) -- 0:01:36
77000 -- (-1803.996) (-1803.642) [-1802.820] (-1803.846) * (-1806.247) (-1808.830) (-1803.374) [-1804.706] -- 0:01:35
77500 -- [-1805.114] (-1803.487) (-1803.817) (-1807.819) * [-1806.850] (-1807.567) (-1805.375) (-1807.300) -- 0:01:35
78000 -- [-1803.165] (-1802.927) (-1802.978) (-1807.752) * [-1810.241] (-1805.287) (-1803.713) (-1805.469) -- 0:01:34
78500 -- [-1803.010] (-1803.111) (-1804.449) (-1807.814) * (-1811.483) (-1805.720) [-1806.997] (-1804.202) -- 0:01:33
79000 -- (-1802.630) (-1804.319) (-1804.868) [-1808.633] * [-1806.760] (-1805.883) (-1804.550) (-1809.835) -- 0:01:33
79500 -- (-1811.226) (-1804.334) [-1803.199] (-1805.036) * [-1804.816] (-1805.161) (-1804.954) (-1803.856) -- 0:01:32
80000 -- (-1812.408) (-1804.841) (-1810.441) [-1807.850] * [-1808.522] (-1805.162) (-1807.486) (-1804.555) -- 0:01:32
Average standard deviation of split frequencies: 0.040907
80500 -- [-1803.553] (-1803.916) (-1807.129) (-1803.347) * (-1804.201) (-1807.202) (-1805.832) [-1802.679] -- 0:01:31
81000 -- (-1805.189) [-1802.751] (-1804.077) (-1803.041) * (-1808.286) (-1805.655) (-1804.069) [-1802.666] -- 0:01:30
81500 -- [-1807.432] (-1806.256) (-1803.155) (-1804.633) * [-1805.682] (-1806.014) (-1804.166) (-1802.393) -- 0:01:30
82000 -- (-1806.131) (-1804.376) [-1804.999] (-1803.239) * (-1806.479) (-1805.568) [-1805.092] (-1802.710) -- 0:01:29
82500 -- (-1809.651) (-1805.094) (-1808.860) [-1806.731] * (-1807.208) (-1804.545) (-1802.387) [-1803.911] -- 0:01:28
83000 -- (-1808.499) (-1804.473) (-1806.036) [-1807.255] * (-1805.760) (-1804.666) [-1803.516] (-1803.620) -- 0:01:28
83500 -- [-1804.682] (-1806.899) (-1804.791) (-1804.514) * (-1805.190) (-1807.139) [-1805.963] (-1803.036) -- 0:01:27
84000 -- (-1805.916) (-1806.500) (-1806.220) [-1804.241] * (-1803.482) (-1804.953) (-1807.708) [-1802.710] -- 0:01:27
84500 -- (-1803.103) [-1802.204] (-1805.025) (-1804.820) * (-1803.483) (-1805.414) (-1803.778) [-1803.112] -- 0:01:26
85000 -- [-1805.169] (-1803.568) (-1804.010) (-1805.273) * [-1802.964] (-1809.497) (-1804.381) (-1803.158) -- 0:01:36
Average standard deviation of split frequencies: 0.038370
85500 -- (-1807.455) [-1803.534] (-1804.589) (-1810.300) * (-1803.600) (-1805.872) [-1807.830] (-1803.531) -- 0:01:36
86000 -- (-1804.426) [-1804.290] (-1805.344) (-1806.879) * [-1803.556] (-1805.632) (-1811.187) (-1805.445) -- 0:01:35
86500 -- (-1804.046) [-1805.059] (-1803.582) (-1808.014) * (-1803.468) [-1803.925] (-1802.862) (-1804.430) -- 0:01:35
87000 -- (-1803.846) [-1804.912] (-1804.387) (-1805.230) * (-1803.821) (-1803.944) [-1802.364] (-1804.614) -- 0:01:34
87500 -- [-1802.958] (-1803.437) (-1808.080) (-1805.044) * (-1804.914) (-1807.467) (-1805.203) [-1805.061] -- 0:01:33
88000 -- (-1807.632) [-1802.938] (-1804.076) (-1805.524) * (-1805.739) (-1805.620) [-1803.311] (-1805.230) -- 0:01:33
88500 -- (-1809.741) [-1806.155] (-1804.099) (-1804.713) * (-1805.647) (-1809.867) (-1803.498) [-1804.737] -- 0:01:32
89000 -- (-1808.459) (-1806.414) [-1804.523] (-1806.363) * (-1804.776) [-1805.387] (-1804.314) (-1805.709) -- 0:01:32
89500 -- (-1808.147) [-1804.873] (-1806.638) (-1807.205) * (-1804.144) (-1803.752) (-1804.995) [-1811.081] -- 0:01:31
90000 -- (-1808.215) [-1803.300] (-1803.901) (-1805.026) * (-1804.990) [-1803.965] (-1806.456) (-1804.187) -- 0:01:31
Average standard deviation of split frequencies: 0.035355
90500 -- (-1802.944) (-1807.145) [-1804.914] (-1804.679) * (-1802.592) (-1805.235) [-1804.046] (-1803.179) -- 0:01:30
91000 -- [-1802.747] (-1804.965) (-1806.720) (-1803.681) * [-1805.396] (-1803.932) (-1806.305) (-1802.940) -- 0:01:29
91500 -- (-1804.067) [-1803.511] (-1808.860) (-1807.234) * (-1807.428) (-1804.454) (-1803.365) [-1803.387] -- 0:01:29
92000 -- [-1803.109] (-1802.397) (-1806.508) (-1803.898) * [-1805.823] (-1804.350) (-1802.966) (-1804.101) -- 0:01:28
92500 -- [-1804.482] (-1802.653) (-1806.111) (-1803.464) * (-1805.064) [-1803.770] (-1803.606) (-1807.478) -- 0:01:28
93000 -- (-1804.387) (-1802.692) (-1805.369) [-1803.607] * (-1806.668) [-1806.260] (-1803.362) (-1804.353) -- 0:01:27
93500 -- (-1803.795) (-1802.716) [-1805.298] (-1804.610) * (-1804.758) (-1805.297) (-1803.507) [-1805.138] -- 0:01:27
94000 -- (-1803.239) [-1804.727] (-1803.291) (-1807.333) * (-1804.393) (-1803.773) [-1803.384] (-1805.299) -- 0:01:26
94500 -- [-1803.377] (-1803.566) (-1805.115) (-1810.634) * (-1805.206) (-1803.488) [-1804.182] (-1807.646) -- 0:01:26
95000 -- (-1809.006) (-1804.928) [-1804.554] (-1804.133) * (-1804.318) [-1805.758] (-1802.538) (-1805.933) -- 0:01:25
Average standard deviation of split frequencies: 0.032409
95500 -- (-1803.280) (-1804.317) [-1804.415] (-1803.409) * (-1804.528) [-1803.387] (-1804.381) (-1805.125) -- 0:01:34
96000 -- (-1803.893) (-1802.642) [-1805.100] (-1804.259) * (-1804.251) (-1802.804) (-1802.951) [-1805.472] -- 0:01:34
96500 -- (-1803.313) (-1804.961) [-1805.277] (-1805.010) * (-1804.289) [-1805.712] (-1802.491) (-1805.399) -- 0:01:33
97000 -- [-1803.676] (-1804.908) (-1804.455) (-1807.563) * (-1803.641) (-1803.487) (-1803.428) [-1805.757] -- 0:01:33
97500 -- (-1802.443) (-1803.510) [-1803.102] (-1804.747) * (-1803.136) [-1803.550] (-1803.487) (-1805.002) -- 0:01:32
98000 -- [-1802.714] (-1804.770) (-1810.620) (-1804.459) * (-1803.409) [-1803.237] (-1805.471) (-1803.698) -- 0:01:32
98500 -- (-1802.673) [-1802.900] (-1809.267) (-1804.509) * (-1803.418) [-1804.816] (-1803.911) (-1803.791) -- 0:01:31
99000 -- (-1804.390) (-1804.189) [-1803.280] (-1805.018) * [-1805.227] (-1807.441) (-1805.446) (-1804.773) -- 0:01:31
99500 -- (-1808.460) [-1804.851] (-1806.118) (-1806.733) * (-1803.376) (-1807.264) [-1804.777] (-1807.746) -- 0:01:30
100000 -- (-1803.420) (-1804.140) [-1804.679] (-1803.911) * (-1804.250) (-1805.529) [-1804.977] (-1805.180) -- 0:01:30
Average standard deviation of split frequencies: 0.029970
100500 -- (-1804.060) (-1808.705) (-1803.711) [-1804.291] * [-1806.057] (-1805.336) (-1805.712) (-1803.588) -- 0:01:29
101000 -- (-1806.989) (-1810.639) (-1809.553) [-1803.613] * (-1802.810) (-1805.757) [-1808.669] (-1802.669) -- 0:01:29
101500 -- (-1805.468) (-1807.062) [-1806.489] (-1804.997) * (-1802.732) (-1804.366) [-1804.742] (-1802.792) -- 0:01:28
102000 -- (-1811.206) (-1803.484) (-1805.500) [-1809.694] * (-1803.958) (-1805.041) (-1805.505) [-1804.423] -- 0:01:28
102500 -- [-1805.324] (-1805.107) (-1804.735) (-1809.528) * (-1806.706) [-1804.247] (-1806.033) (-1802.781) -- 0:01:27
103000 -- (-1804.213) (-1805.792) (-1808.306) [-1804.300] * [-1804.695] (-1807.172) (-1804.420) (-1806.260) -- 0:01:27
103500 -- (-1805.423) (-1805.181) (-1807.513) [-1807.328] * (-1806.990) (-1805.295) [-1802.407] (-1804.563) -- 0:01:26
104000 -- (-1804.874) [-1804.748] (-1803.153) (-1806.170) * (-1806.704) (-1803.899) [-1802.908] (-1805.534) -- 0:01:26
104500 -- (-1804.195) (-1808.265) (-1802.430) [-1805.454] * [-1805.488] (-1803.779) (-1805.908) (-1804.884) -- 0:01:25
105000 -- (-1803.972) [-1804.916] (-1803.898) (-1807.329) * [-1804.007] (-1805.237) (-1805.904) (-1804.058) -- 0:01:25
Average standard deviation of split frequencies: 0.032020
105500 -- (-1804.306) [-1803.733] (-1806.355) (-1809.970) * (-1810.357) (-1803.996) [-1805.122] (-1808.289) -- 0:01:24
106000 -- (-1804.566) (-1803.788) [-1804.922] (-1806.922) * [-1804.207] (-1804.468) (-1806.948) (-1805.723) -- 0:01:24
106500 -- (-1803.945) (-1806.609) (-1804.006) [-1805.269] * (-1807.569) [-1804.147] (-1804.710) (-1802.817) -- 0:01:32
107000 -- [-1803.911] (-1804.964) (-1804.307) (-1805.606) * [-1803.947] (-1806.386) (-1804.836) (-1804.370) -- 0:01:31
107500 -- (-1808.320) (-1805.163) [-1804.396] (-1803.672) * [-1806.202] (-1806.130) (-1805.452) (-1804.225) -- 0:01:31
108000 -- (-1802.406) (-1807.390) [-1804.838] (-1811.121) * [-1803.478] (-1806.620) (-1804.889) (-1804.878) -- 0:01:30
108500 -- (-1805.589) [-1806.143] (-1802.941) (-1807.881) * (-1806.787) [-1804.224] (-1802.454) (-1806.118) -- 0:01:30
109000 -- [-1804.907] (-1806.497) (-1806.399) (-1806.126) * (-1805.879) (-1803.411) (-1803.111) [-1804.302] -- 0:01:29
109500 -- (-1802.122) [-1803.388] (-1804.509) (-1803.478) * (-1808.289) (-1803.577) (-1803.059) [-1803.291] -- 0:01:29
110000 -- (-1801.976) (-1807.088) (-1804.689) [-1803.633] * (-1812.050) (-1805.783) (-1802.799) [-1804.507] -- 0:01:29
Average standard deviation of split frequencies: 0.032374
110500 -- (-1806.045) (-1805.355) (-1805.163) [-1805.059] * [-1805.607] (-1802.958) (-1805.959) (-1803.546) -- 0:01:28
111000 -- (-1805.203) [-1805.278] (-1805.954) (-1808.071) * (-1803.131) (-1804.718) (-1805.817) [-1805.634] -- 0:01:28
111500 -- (-1807.736) [-1805.828] (-1803.719) (-1805.341) * [-1805.689] (-1804.784) (-1805.134) (-1804.307) -- 0:01:27
112000 -- (-1805.509) [-1806.022] (-1806.310) (-1804.568) * (-1805.444) (-1804.356) (-1808.293) [-1802.619] -- 0:01:27
112500 -- (-1809.203) (-1803.053) (-1805.040) [-1806.423] * (-1805.601) (-1802.954) (-1806.866) [-1804.368] -- 0:01:26
113000 -- (-1804.945) (-1804.634) [-1804.116] (-1803.868) * (-1808.025) (-1803.529) [-1803.913] (-1802.454) -- 0:01:26
113500 -- [-1803.052] (-1804.856) (-1806.201) (-1803.286) * (-1803.341) [-1803.570] (-1804.120) (-1803.653) -- 0:01:25
114000 -- (-1802.866) (-1803.428) (-1805.262) [-1803.956] * (-1806.876) [-1803.515] (-1809.072) (-1803.895) -- 0:01:25
114500 -- [-1803.554] (-1806.426) (-1803.257) (-1803.097) * (-1807.226) (-1803.190) [-1803.299] (-1804.259) -- 0:01:25
115000 -- (-1804.435) (-1807.816) [-1805.259] (-1804.702) * [-1805.611] (-1807.369) (-1805.074) (-1802.913) -- 0:01:24
Average standard deviation of split frequencies: 0.030885
115500 -- (-1805.163) (-1802.962) (-1805.006) [-1806.992] * (-1806.729) [-1803.242] (-1803.228) (-1809.478) -- 0:01:24
116000 -- (-1804.067) [-1804.872] (-1804.192) (-1803.887) * (-1804.723) (-1806.260) [-1805.546] (-1806.389) -- 0:01:23
116500 -- [-1802.062] (-1804.490) (-1813.050) (-1805.246) * (-1804.377) (-1805.717) (-1809.020) [-1803.727] -- 0:01:23
117000 -- [-1803.277] (-1804.907) (-1813.815) (-1802.915) * (-1804.378) (-1804.408) [-1805.262] (-1807.920) -- 0:01:23
117500 -- (-1804.720) (-1804.385) (-1804.341) [-1804.385] * [-1804.181] (-1805.167) (-1803.802) (-1803.941) -- 0:01:30
118000 -- (-1805.447) (-1805.927) [-1803.605] (-1803.884) * (-1804.999) [-1803.271] (-1803.758) (-1804.467) -- 0:01:29
118500 -- [-1806.455] (-1809.497) (-1804.973) (-1805.265) * (-1803.569) (-1808.051) (-1804.444) [-1804.142] -- 0:01:29
119000 -- (-1805.977) (-1807.593) (-1804.141) [-1804.830] * (-1804.008) [-1805.417] (-1802.196) (-1803.938) -- 0:01:28
119500 -- (-1805.213) (-1803.469) [-1806.054] (-1804.088) * [-1803.595] (-1804.085) (-1808.958) (-1804.136) -- 0:01:28
120000 -- (-1806.717) (-1810.272) (-1803.873) [-1803.428] * (-1802.442) (-1804.525) [-1805.783] (-1804.650) -- 0:01:28
Average standard deviation of split frequencies: 0.027347
120500 -- (-1805.715) [-1802.887] (-1804.593) (-1805.870) * (-1803.202) [-1806.542] (-1804.575) (-1803.471) -- 0:01:27
121000 -- (-1806.899) (-1803.059) [-1803.162] (-1803.681) * (-1802.580) (-1804.968) (-1806.585) [-1803.301] -- 0:01:27
121500 -- (-1805.397) (-1805.068) (-1803.784) [-1804.427] * (-1804.825) (-1805.822) [-1803.448] (-1804.493) -- 0:01:26
122000 -- (-1804.104) [-1804.674] (-1805.438) (-1810.119) * (-1804.947) [-1803.040] (-1804.588) (-1804.945) -- 0:01:26
122500 -- (-1807.051) (-1806.186) (-1809.387) [-1806.458] * [-1805.927] (-1807.425) (-1804.126) (-1804.731) -- 0:01:25
123000 -- (-1807.171) (-1805.557) [-1803.801] (-1802.984) * (-1802.613) [-1804.267] (-1804.952) (-1805.370) -- 0:01:25
123500 -- [-1803.978] (-1805.470) (-1805.012) (-1805.175) * (-1802.613) [-1804.008] (-1803.127) (-1805.041) -- 0:01:25
124000 -- (-1804.181) (-1803.799) (-1808.060) [-1805.626] * [-1803.805] (-1804.309) (-1805.562) (-1806.576) -- 0:01:24
124500 -- (-1805.133) [-1803.798] (-1808.324) (-1806.537) * (-1804.919) (-1805.697) [-1805.857] (-1805.848) -- 0:01:24
125000 -- (-1806.279) [-1804.175] (-1805.213) (-1803.550) * (-1803.790) (-1809.664) (-1804.203) [-1804.886] -- 0:01:24
Average standard deviation of split frequencies: 0.026189
125500 -- (-1802.755) (-1807.117) [-1803.619] (-1804.235) * (-1809.285) (-1805.897) [-1803.182] (-1803.056) -- 0:01:23
126000 -- (-1803.681) [-1804.229] (-1802.823) (-1804.451) * [-1807.049] (-1805.714) (-1803.616) (-1804.703) -- 0:01:23
126500 -- (-1807.156) (-1803.455) (-1804.053) [-1803.163] * (-1806.550) (-1803.910) (-1805.526) [-1805.108] -- 0:01:22
127000 -- (-1803.097) (-1805.888) (-1807.327) [-1803.208] * (-1803.243) [-1803.440] (-1808.701) (-1805.259) -- 0:01:22
127500 -- [-1803.086] (-1804.565) (-1806.177) (-1802.756) * [-1803.574] (-1802.339) (-1803.840) (-1804.353) -- 0:01:22
128000 -- (-1802.801) [-1803.569] (-1805.474) (-1811.598) * (-1803.574) (-1803.998) (-1803.667) [-1803.956] -- 0:01:28
128500 -- (-1802.340) (-1808.272) [-1804.254] (-1804.934) * (-1803.630) (-1803.606) [-1806.127] (-1804.003) -- 0:01:28
129000 -- (-1802.709) (-1805.853) [-1803.381] (-1808.138) * (-1804.896) (-1809.416) [-1803.347] (-1803.131) -- 0:01:27
129500 -- (-1803.840) (-1805.236) (-1804.473) [-1810.983] * (-1807.295) (-1804.859) (-1803.669) [-1801.934] -- 0:01:27
130000 -- (-1805.294) (-1804.221) [-1803.507] (-1813.597) * (-1804.518) [-1802.688] (-1803.427) (-1802.219) -- 0:01:27
Average standard deviation of split frequencies: 0.025254
130500 -- (-1802.777) (-1805.178) [-1803.608] (-1805.813) * (-1805.307) (-1805.961) [-1803.546] (-1804.859) -- 0:01:26
131000 -- [-1802.311] (-1803.303) (-1803.926) (-1805.387) * (-1803.217) (-1808.566) [-1803.369] (-1804.561) -- 0:01:26
131500 -- (-1803.510) (-1803.323) [-1803.161] (-1810.356) * (-1803.605) [-1806.805] (-1803.928) (-1806.373) -- 0:01:25
132000 -- (-1803.882) [-1804.151] (-1803.743) (-1803.352) * (-1804.945) (-1804.269) (-1804.752) [-1802.408] -- 0:01:25
132500 -- (-1804.198) (-1804.146) [-1802.619] (-1804.884) * (-1802.891) (-1808.042) (-1804.755) [-1805.306] -- 0:01:25
133000 -- [-1805.143] (-1804.841) (-1803.215) (-1803.942) * (-1803.097) [-1807.959] (-1804.669) (-1804.550) -- 0:01:24
133500 -- [-1803.688] (-1803.497) (-1803.478) (-1805.402) * (-1804.248) [-1803.466] (-1805.286) (-1806.483) -- 0:01:24
134000 -- (-1803.764) [-1803.989] (-1803.041) (-1805.222) * (-1802.429) (-1804.024) [-1805.500] (-1804.285) -- 0:01:24
134500 -- (-1804.858) [-1804.846] (-1808.266) (-1811.529) * (-1803.422) [-1806.588] (-1807.300) (-1803.889) -- 0:01:23
135000 -- [-1804.222] (-1804.131) (-1807.397) (-1806.019) * [-1802.339] (-1804.162) (-1804.878) (-1803.916) -- 0:01:23
Average standard deviation of split frequencies: 0.024957
135500 -- (-1805.562) (-1805.059) [-1805.454] (-1803.506) * (-1804.596) [-1805.580] (-1805.326) (-1804.566) -- 0:01:22
136000 -- [-1803.392] (-1803.956) (-1802.763) (-1804.423) * [-1805.657] (-1804.016) (-1809.453) (-1807.973) -- 0:01:22
136500 -- (-1803.572) (-1805.210) [-1802.770] (-1805.183) * (-1803.693) [-1804.652] (-1808.527) (-1804.627) -- 0:01:22
137000 -- (-1804.303) (-1806.377) [-1804.039] (-1804.680) * [-1803.761] (-1803.835) (-1806.288) (-1804.765) -- 0:01:21
137500 -- (-1804.048) [-1808.320] (-1805.962) (-1806.910) * (-1806.103) [-1803.852] (-1809.553) (-1806.151) -- 0:01:21
138000 -- (-1803.579) (-1808.387) (-1803.564) [-1804.619] * (-1802.608) [-1803.892] (-1807.777) (-1804.002) -- 0:01:21
138500 -- [-1803.652] (-1804.862) (-1807.551) (-1803.292) * [-1803.851] (-1805.123) (-1809.360) (-1810.809) -- 0:01:20
139000 -- (-1804.554) (-1808.934) [-1806.969] (-1801.731) * (-1802.516) (-1804.692) [-1805.878] (-1803.584) -- 0:01:26
139500 -- (-1804.752) (-1804.896) (-1804.646) [-1802.341] * [-1804.065] (-1804.741) (-1803.848) (-1808.673) -- 0:01:26
140000 -- [-1804.936] (-1804.129) (-1803.123) (-1804.020) * (-1806.058) (-1806.984) (-1803.817) [-1803.967] -- 0:01:26
Average standard deviation of split frequencies: 0.022788
140500 -- (-1806.930) [-1805.090] (-1806.196) (-1802.720) * [-1804.400] (-1810.938) (-1803.631) (-1802.608) -- 0:01:25
141000 -- (-1804.086) (-1804.821) [-1804.877] (-1804.703) * (-1803.742) (-1809.441) [-1804.934] (-1802.681) -- 0:01:25
141500 -- (-1803.397) (-1805.580) [-1804.607] (-1808.476) * [-1803.727] (-1810.936) (-1807.003) (-1802.409) -- 0:01:24
142000 -- (-1805.980) [-1802.834] (-1806.093) (-1803.100) * (-1806.157) (-1803.304) (-1806.534) [-1804.992] -- 0:01:24
142500 -- (-1803.287) (-1805.390) [-1806.094] (-1805.137) * (-1809.866) [-1804.199] (-1804.464) (-1805.536) -- 0:01:24
143000 -- (-1803.171) (-1806.152) (-1806.909) [-1803.852] * (-1806.951) (-1805.667) [-1804.461] (-1806.928) -- 0:01:23
143500 -- (-1804.141) [-1803.883] (-1811.009) (-1805.852) * (-1806.013) [-1804.409] (-1804.649) (-1805.680) -- 0:01:23
144000 -- [-1804.063] (-1805.367) (-1805.319) (-1804.575) * (-1809.740) (-1805.230) (-1804.406) [-1803.861] -- 0:01:23
144500 -- (-1803.405) (-1806.564) [-1806.518] (-1804.453) * [-1804.516] (-1804.504) (-1804.174) (-1808.008) -- 0:01:22
145000 -- (-1805.795) [-1806.564] (-1806.795) (-1804.216) * (-1805.250) [-1804.766] (-1805.427) (-1811.698) -- 0:01:22
Average standard deviation of split frequencies: 0.021310
145500 -- (-1806.405) (-1810.689) (-1803.290) [-1804.293] * (-1804.358) [-1805.194] (-1804.328) (-1807.907) -- 0:01:22
146000 -- (-1806.149) [-1804.412] (-1803.478) (-1803.663) * (-1804.016) (-1805.511) (-1804.589) [-1804.914] -- 0:01:21
146500 -- (-1805.294) (-1808.289) [-1806.386] (-1803.918) * (-1805.330) (-1804.851) [-1804.404] (-1805.370) -- 0:01:21
147000 -- [-1802.312] (-1806.308) (-1804.675) (-1803.285) * (-1802.867) (-1806.089) [-1802.440] (-1805.222) -- 0:01:21
147500 -- [-1805.222] (-1804.750) (-1805.453) (-1805.771) * (-1804.252) (-1806.738) (-1805.012) [-1805.446] -- 0:01:20
148000 -- [-1802.897] (-1804.636) (-1805.605) (-1807.603) * (-1804.098) (-1805.396) [-1805.490] (-1804.083) -- 0:01:20
148500 -- [-1805.636] (-1805.482) (-1803.723) (-1806.996) * (-1807.154) (-1805.924) [-1803.717] (-1804.665) -- 0:01:20
149000 -- (-1802.956) (-1804.196) [-1805.839] (-1807.140) * [-1804.931] (-1803.734) (-1805.996) (-1803.197) -- 0:01:19
149500 -- (-1803.371) (-1803.203) [-1805.525] (-1803.726) * (-1804.578) [-1805.098] (-1812.722) (-1805.273) -- 0:01:25
150000 -- (-1804.005) (-1803.603) [-1803.248] (-1804.932) * (-1804.783) [-1802.871] (-1804.723) (-1806.924) -- 0:01:25
Average standard deviation of split frequencies: 0.018147
150500 -- (-1808.063) (-1803.122) (-1803.560) [-1802.789] * [-1804.742] (-1804.001) (-1807.348) (-1804.477) -- 0:01:24
151000 -- [-1804.377] (-1803.565) (-1803.615) (-1803.002) * [-1804.494] (-1803.468) (-1804.722) (-1806.136) -- 0:01:24
151500 -- (-1803.726) (-1804.868) [-1803.494] (-1805.409) * (-1804.346) [-1803.400] (-1805.637) (-1806.683) -- 0:01:24
152000 -- [-1804.078] (-1804.856) (-1804.771) (-1804.677) * (-1805.697) (-1804.547) [-1803.921] (-1806.419) -- 0:01:23
152500 -- (-1802.977) (-1805.316) [-1804.771] (-1804.312) * (-1802.758) [-1802.036] (-1804.566) (-1806.328) -- 0:01:23
153000 -- (-1802.984) (-1804.758) [-1805.108] (-1804.366) * (-1802.824) [-1804.813] (-1809.639) (-1803.605) -- 0:01:23
153500 -- (-1803.400) (-1804.478) (-1805.441) [-1803.257] * (-1805.142) (-1804.852) [-1806.598] (-1804.615) -- 0:01:22
154000 -- (-1803.524) (-1806.415) (-1808.293) [-1804.080] * (-1803.421) (-1803.573) (-1803.637) [-1805.493] -- 0:01:22
154500 -- [-1803.766] (-1806.163) (-1808.022) (-1809.302) * (-1804.284) (-1804.056) (-1805.244) [-1803.836] -- 0:01:22
155000 -- (-1804.123) (-1807.747) [-1803.560] (-1804.750) * (-1804.937) (-1805.381) (-1805.984) [-1804.236] -- 0:01:21
Average standard deviation of split frequencies: 0.016922
155500 -- [-1803.702] (-1804.141) (-1805.018) (-1804.235) * (-1805.801) (-1804.941) (-1803.469) [-1806.237] -- 0:01:21
156000 -- (-1804.539) [-1804.682] (-1807.424) (-1805.269) * (-1809.273) (-1806.288) (-1805.549) [-1805.931] -- 0:01:21
156500 -- [-1803.336] (-1803.670) (-1807.613) (-1805.856) * (-1806.338) (-1804.216) [-1804.449] (-1804.375) -- 0:01:20
157000 -- [-1804.233] (-1805.937) (-1805.783) (-1804.838) * (-1803.931) (-1805.833) (-1804.469) [-1803.080] -- 0:01:20
157500 -- [-1804.990] (-1803.042) (-1804.321) (-1804.755) * (-1806.503) [-1804.349] (-1809.512) (-1804.294) -- 0:01:20
158000 -- (-1806.642) (-1803.337) [-1804.446] (-1807.419) * (-1804.883) [-1804.907] (-1804.907) (-1804.766) -- 0:01:19
158500 -- (-1809.520) [-1803.337] (-1812.512) (-1804.373) * [-1803.346] (-1805.203) (-1804.235) (-1803.642) -- 0:01:19
159000 -- (-1806.965) (-1803.851) (-1803.800) [-1807.513] * (-1803.109) (-1807.707) [-1802.700] (-1802.653) -- 0:01:19
159500 -- [-1802.632] (-1804.628) (-1803.611) (-1803.114) * [-1803.163] (-1804.290) (-1802.726) (-1803.342) -- 0:01:19
160000 -- [-1801.514] (-1805.557) (-1804.146) (-1802.429) * (-1803.502) (-1806.547) (-1805.163) [-1803.646] -- 0:01:24
Average standard deviation of split frequencies: 0.018191
160500 -- (-1802.204) (-1803.427) [-1807.098] (-1802.508) * (-1803.214) (-1804.662) [-1805.915] (-1810.684) -- 0:01:23
161000 -- [-1802.724] (-1804.215) (-1807.255) (-1802.898) * (-1803.259) (-1808.021) [-1804.889] (-1811.654) -- 0:01:23
161500 -- [-1802.445] (-1804.333) (-1805.536) (-1803.173) * (-1802.787) [-1805.129] (-1803.059) (-1805.122) -- 0:01:23
162000 -- (-1802.591) (-1803.504) [-1804.531] (-1807.555) * (-1803.297) [-1804.267] (-1804.822) (-1803.507) -- 0:01:22
162500 -- (-1802.475) (-1809.015) [-1805.351] (-1806.339) * (-1802.645) (-1803.994) [-1804.898] (-1804.171) -- 0:01:22
163000 -- (-1802.307) (-1808.281) [-1803.568] (-1804.861) * (-1805.475) (-1804.303) (-1803.515) [-1803.762] -- 0:01:22
163500 -- (-1803.643) (-1803.713) (-1803.925) [-1807.119] * (-1808.668) (-1802.799) (-1806.585) [-1809.232] -- 0:01:21
164000 -- (-1803.898) (-1804.732) (-1803.452) [-1808.906] * (-1803.872) [-1803.991] (-1807.223) (-1807.647) -- 0:01:21
164500 -- (-1802.965) (-1806.506) [-1803.052] (-1803.355) * (-1805.797) [-1804.096] (-1804.233) (-1807.831) -- 0:01:21
165000 -- [-1804.760] (-1808.784) (-1802.615) (-1804.806) * (-1804.077) (-1804.695) [-1802.619] (-1808.906) -- 0:01:20
Average standard deviation of split frequencies: 0.016471
165500 -- (-1803.673) (-1804.517) [-1805.898] (-1807.620) * [-1802.620] (-1803.766) (-1802.631) (-1804.681) -- 0:01:20
166000 -- [-1803.991] (-1804.868) (-1804.024) (-1806.303) * (-1804.592) (-1804.160) [-1802.622] (-1804.932) -- 0:01:20
166500 -- (-1802.840) [-1803.951] (-1803.814) (-1806.310) * (-1804.284) (-1804.559) [-1802.448] (-1804.888) -- 0:01:20
167000 -- [-1805.606] (-1805.136) (-1803.750) (-1807.831) * (-1807.108) (-1805.373) (-1803.172) [-1807.595] -- 0:01:19
167500 -- (-1805.888) (-1802.870) (-1806.604) [-1806.161] * (-1803.410) (-1804.927) (-1803.183) [-1805.051] -- 0:01:19
168000 -- (-1806.024) [-1803.809] (-1804.057) (-1804.759) * (-1802.810) (-1806.231) [-1803.198] (-1805.817) -- 0:01:19
168500 -- (-1806.735) (-1804.600) [-1804.175] (-1808.949) * [-1802.767] (-1808.131) (-1804.541) (-1804.314) -- 0:01:18
169000 -- [-1802.598] (-1803.273) (-1806.072) (-1804.746) * [-1806.422] (-1811.610) (-1805.305) (-1804.102) -- 0:01:18
169500 -- [-1803.257] (-1805.338) (-1804.892) (-1803.118) * (-1806.878) [-1804.949] (-1803.668) (-1804.028) -- 0:01:18
170000 -- (-1803.180) [-1802.594] (-1803.984) (-1803.322) * (-1807.688) [-1807.425] (-1804.498) (-1803.660) -- 0:01:18
Average standard deviation of split frequencies: 0.018230
170500 -- [-1803.669] (-1804.057) (-1804.248) (-1804.605) * [-1802.616] (-1807.805) (-1803.654) (-1807.754) -- 0:01:22
171000 -- (-1805.669) [-1808.960] (-1804.336) (-1812.946) * [-1803.478] (-1807.232) (-1809.343) (-1809.604) -- 0:01:22
171500 -- (-1804.252) [-1805.512] (-1805.738) (-1809.806) * (-1803.070) [-1802.926] (-1803.188) (-1804.293) -- 0:01:22
172000 -- (-1804.776) [-1803.576] (-1806.948) (-1806.361) * (-1803.070) (-1803.056) [-1806.622] (-1803.471) -- 0:01:21
172500 -- (-1803.527) [-1804.382] (-1806.596) (-1805.034) * (-1805.119) (-1804.969) (-1804.733) [-1805.553] -- 0:01:21
173000 -- (-1804.195) (-1803.752) [-1804.445] (-1803.972) * [-1802.909] (-1802.459) (-1807.618) (-1805.916) -- 0:01:21
173500 -- [-1809.178] (-1805.207) (-1803.648) (-1803.282) * (-1804.581) (-1802.763) [-1806.076] (-1804.858) -- 0:01:20
174000 -- (-1803.949) (-1804.507) [-1804.065] (-1803.303) * (-1803.799) [-1802.806] (-1805.961) (-1803.798) -- 0:01:20
174500 -- (-1804.128) (-1808.844) [-1805.109] (-1804.190) * [-1804.300] (-1804.221) (-1810.297) (-1803.274) -- 0:01:20
175000 -- [-1805.274] (-1803.146) (-1804.727) (-1804.095) * [-1803.824] (-1803.022) (-1808.527) (-1803.323) -- 0:01:20
Average standard deviation of split frequencies: 0.015535
175500 -- (-1804.213) (-1804.640) (-1803.177) [-1803.947] * [-1803.904] (-1805.293) (-1806.019) (-1805.635) -- 0:01:19
176000 -- (-1808.906) (-1805.137) [-1804.994] (-1804.278) * (-1802.936) (-1804.677) [-1804.005] (-1805.418) -- 0:01:19
176500 -- (-1807.830) [-1806.258] (-1808.427) (-1803.309) * (-1803.768) [-1804.777] (-1804.976) (-1806.904) -- 0:01:19
177000 -- (-1807.991) (-1804.625) (-1804.907) [-1803.894] * (-1803.718) [-1807.733] (-1805.304) (-1805.127) -- 0:01:19
177500 -- (-1806.558) [-1803.260] (-1803.919) (-1804.904) * (-1805.492) (-1807.593) [-1803.663] (-1803.383) -- 0:01:18
178000 -- (-1804.774) (-1803.212) [-1804.339] (-1806.083) * (-1804.358) (-1807.093) (-1803.065) [-1804.816] -- 0:01:18
178500 -- (-1805.934) (-1804.176) [-1806.650] (-1805.923) * (-1810.153) (-1805.439) [-1802.874] (-1803.995) -- 0:01:18
179000 -- (-1803.609) (-1803.023) [-1806.379] (-1805.791) * (-1804.691) (-1804.692) (-1803.882) [-1806.787] -- 0:01:17
179500 -- (-1804.217) (-1803.896) (-1805.065) [-1805.855] * [-1804.401] (-1807.657) (-1804.127) (-1805.107) -- 0:01:17
180000 -- (-1805.722) [-1803.719] (-1806.672) (-1804.159) * (-1803.180) [-1807.444] (-1806.050) (-1805.513) -- 0:01:17
Average standard deviation of split frequencies: 0.018265
180500 -- (-1804.792) [-1804.800] (-1804.797) (-1804.819) * (-1803.437) (-1805.583) [-1802.974] (-1805.487) -- 0:01:17
181000 -- (-1805.384) (-1805.934) [-1803.822] (-1803.780) * [-1804.173] (-1804.108) (-1805.977) (-1806.424) -- 0:01:16
181500 -- [-1805.502] (-1810.810) (-1805.262) (-1803.695) * (-1804.201) (-1803.890) (-1805.660) [-1804.183] -- 0:01:21
182000 -- (-1804.101) [-1805.038] (-1806.738) (-1804.738) * [-1803.892] (-1804.590) (-1806.628) (-1805.625) -- 0:01:20
182500 -- (-1803.516) (-1804.407) [-1806.014] (-1808.555) * (-1803.912) (-1804.053) [-1804.815] (-1806.695) -- 0:01:20
183000 -- (-1808.861) [-1805.896] (-1808.816) (-1804.609) * (-1803.768) [-1804.731] (-1807.912) (-1805.007) -- 0:01:20
183500 -- (-1809.053) [-1805.829] (-1807.954) (-1804.616) * (-1805.542) [-1806.168] (-1806.108) (-1804.021) -- 0:01:20
184000 -- (-1810.023) (-1804.921) (-1807.526) [-1804.643] * (-1806.263) (-1806.908) [-1805.701] (-1803.942) -- 0:01:19
184500 -- (-1809.049) (-1802.413) (-1803.492) [-1805.277] * (-1804.929) [-1803.959] (-1806.345) (-1805.591) -- 0:01:19
185000 -- (-1806.736) (-1805.010) [-1802.931] (-1804.104) * [-1803.620] (-1807.802) (-1804.598) (-1804.034) -- 0:01:19
Average standard deviation of split frequencies: 0.017234
185500 -- (-1807.438) (-1808.667) (-1804.654) [-1804.121] * [-1803.227] (-1804.781) (-1805.505) (-1803.218) -- 0:01:19
186000 -- (-1806.834) [-1801.729] (-1802.843) (-1804.312) * [-1805.099] (-1803.897) (-1806.845) (-1802.750) -- 0:01:18
186500 -- (-1803.959) (-1805.071) [-1804.106] (-1803.515) * (-1803.377) [-1803.724] (-1807.747) (-1802.673) -- 0:01:18
187000 -- (-1808.457) [-1802.504] (-1805.562) (-1804.149) * [-1802.595] (-1805.841) (-1803.812) (-1804.615) -- 0:01:18
187500 -- [-1804.848] (-1802.240) (-1803.078) (-1808.567) * (-1803.830) [-1803.858] (-1803.276) (-1804.466) -- 0:01:18
188000 -- (-1806.188) [-1803.129] (-1804.375) (-1803.083) * (-1805.337) (-1804.131) [-1802.786] (-1804.004) -- 0:01:17
188500 -- (-1802.659) [-1803.366] (-1805.632) (-1806.074) * [-1805.082] (-1802.443) (-1802.469) (-1807.112) -- 0:01:17
189000 -- (-1802.888) (-1807.134) (-1804.525) [-1802.857] * (-1803.700) [-1802.740] (-1802.436) (-1804.986) -- 0:01:17
189500 -- [-1804.619] (-1805.261) (-1804.414) (-1803.979) * (-1806.311) (-1805.278) [-1805.237] (-1807.856) -- 0:01:16
190000 -- (-1804.005) (-1804.413) [-1806.172] (-1803.390) * (-1803.844) [-1806.236] (-1803.451) (-1803.086) -- 0:01:16
Average standard deviation of split frequencies: 0.016318
190500 -- [-1804.884] (-1802.622) (-1805.306) (-1803.409) * (-1803.451) [-1806.552] (-1803.480) (-1804.432) -- 0:01:16
191000 -- (-1805.448) [-1801.753] (-1803.085) (-1804.247) * (-1805.673) (-1808.189) [-1803.643] (-1806.990) -- 0:01:16
191500 -- (-1803.117) (-1802.189) (-1802.749) [-1804.892] * (-1807.307) (-1803.847) [-1804.124] (-1808.010) -- 0:01:15
192000 -- (-1805.547) (-1802.880) [-1802.519] (-1804.975) * (-1804.269) (-1805.641) (-1804.512) [-1806.791] -- 0:01:15
192500 -- (-1803.120) (-1804.968) [-1802.603] (-1803.888) * (-1805.573) [-1802.799] (-1803.698) (-1803.898) -- 0:01:19
193000 -- (-1803.536) [-1802.531] (-1803.337) (-1803.007) * [-1805.659] (-1803.130) (-1805.247) (-1803.515) -- 0:01:19
193500 -- (-1804.981) [-1804.055] (-1804.994) (-1804.007) * (-1806.806) [-1802.197] (-1804.795) (-1806.472) -- 0:01:19
194000 -- (-1806.382) (-1805.388) (-1805.752) [-1803.966] * [-1806.888] (-1802.894) (-1803.153) (-1804.979) -- 0:01:18
194500 -- (-1810.638) [-1806.874] (-1806.638) (-1802.894) * (-1809.474) (-1804.428) [-1803.381] (-1803.705) -- 0:01:18
195000 -- (-1805.825) (-1804.098) (-1803.540) [-1804.057] * [-1809.701] (-1802.729) (-1804.599) (-1803.896) -- 0:01:18
Average standard deviation of split frequencies: 0.018760
195500 -- [-1806.078] (-1805.986) (-1805.717) (-1803.374) * (-1803.568) (-1803.989) (-1805.386) [-1802.951] -- 0:01:18
196000 -- [-1805.629] (-1803.873) (-1804.630) (-1805.149) * (-1802.577) (-1803.388) (-1804.050) [-1804.447] -- 0:01:17
196500 -- (-1804.200) (-1806.640) (-1806.422) [-1805.683] * (-1804.461) [-1805.172] (-1805.459) (-1803.256) -- 0:01:17
197000 -- (-1804.730) (-1807.337) [-1806.418] (-1803.018) * (-1804.277) [-1804.691] (-1803.295) (-1802.999) -- 0:01:17
197500 -- (-1804.232) [-1805.435] (-1807.548) (-1803.009) * [-1803.362] (-1806.404) (-1803.494) (-1804.281) -- 0:01:17
198000 -- (-1804.482) (-1802.918) [-1804.231] (-1802.898) * (-1806.418) (-1809.120) [-1808.286] (-1805.195) -- 0:01:16
198500 -- [-1806.665] (-1802.642) (-1802.846) (-1802.987) * [-1803.012] (-1803.779) (-1810.871) (-1805.179) -- 0:01:16
199000 -- [-1804.483] (-1804.795) (-1802.768) (-1804.066) * [-1803.929] (-1808.611) (-1803.840) (-1805.886) -- 0:01:16
199500 -- [-1804.647] (-1802.362) (-1802.678) (-1806.210) * (-1804.680) (-1804.742) [-1805.949] (-1804.348) -- 0:01:16
200000 -- (-1803.470) (-1804.414) (-1805.517) [-1805.427] * (-1804.583) (-1803.585) [-1803.549] (-1803.146) -- 0:01:16
Average standard deviation of split frequencies: 0.018794
200500 -- [-1803.416] (-1803.438) (-1805.648) (-1806.737) * (-1804.645) [-1802.931] (-1804.084) (-1803.623) -- 0:01:15
201000 -- [-1803.570] (-1804.271) (-1804.039) (-1808.606) * (-1806.528) (-1803.004) [-1805.229] (-1804.187) -- 0:01:15
201500 -- (-1802.801) (-1804.740) [-1803.194] (-1803.779) * (-1804.411) [-1804.441] (-1803.650) (-1803.649) -- 0:01:15
202000 -- (-1803.029) [-1803.513] (-1803.639) (-1803.392) * (-1806.642) (-1803.528) [-1803.716] (-1804.298) -- 0:01:15
202500 -- (-1805.519) [-1805.898] (-1804.427) (-1804.821) * [-1805.416] (-1804.261) (-1803.036) (-1804.276) -- 0:01:14
203000 -- (-1804.473) [-1806.377] (-1804.048) (-1805.782) * (-1804.257) (-1806.341) [-1803.033] (-1805.362) -- 0:01:18
203500 -- (-1805.015) [-1807.868] (-1804.661) (-1811.777) * (-1802.360) (-1805.024) [-1807.116] (-1807.286) -- 0:01:18
204000 -- [-1803.039] (-1803.440) (-1803.560) (-1812.099) * (-1802.390) (-1805.779) [-1803.731] (-1805.839) -- 0:01:18
204500 -- (-1803.179) [-1802.899] (-1803.197) (-1804.669) * (-1803.384) (-1804.637) [-1803.858] (-1807.836) -- 0:01:17
205000 -- (-1803.096) (-1805.441) (-1808.256) [-1807.099] * (-1802.933) [-1804.601] (-1805.383) (-1803.440) -- 0:01:17
Average standard deviation of split frequencies: 0.018307
205500 -- (-1803.568) (-1806.371) [-1803.545] (-1803.551) * [-1803.869] (-1808.033) (-1803.218) (-1802.380) -- 0:01:17
206000 -- [-1809.622] (-1805.773) (-1802.554) (-1806.180) * (-1802.795) [-1804.632] (-1805.591) (-1804.254) -- 0:01:17
206500 -- (-1802.982) [-1806.635] (-1802.608) (-1807.997) * (-1804.278) [-1803.415] (-1803.757) (-1802.177) -- 0:01:16
207000 -- (-1803.154) (-1803.531) [-1803.612] (-1803.281) * (-1804.028) (-1806.897) (-1804.300) [-1807.005] -- 0:01:16
207500 -- [-1805.827] (-1805.458) (-1807.151) (-1804.129) * (-1804.082) [-1803.620] (-1806.237) (-1807.266) -- 0:01:16
208000 -- (-1806.054) [-1803.771] (-1804.252) (-1808.425) * [-1802.786] (-1802.344) (-1804.603) (-1804.851) -- 0:01:16
208500 -- [-1805.067] (-1804.851) (-1803.557) (-1807.321) * [-1804.365] (-1802.435) (-1805.095) (-1805.653) -- 0:01:15
209000 -- (-1807.813) (-1805.019) [-1802.857] (-1807.599) * (-1802.022) [-1804.564] (-1806.414) (-1805.101) -- 0:01:15
209500 -- (-1805.655) (-1805.951) (-1802.975) [-1813.885] * [-1804.514] (-1805.486) (-1804.973) (-1805.379) -- 0:01:15
210000 -- (-1805.047) (-1805.386) [-1804.874] (-1805.481) * [-1802.702] (-1804.961) (-1804.732) (-1803.407) -- 0:01:15
Average standard deviation of split frequencies: 0.017454
210500 -- [-1804.016] (-1803.859) (-1804.298) (-1811.746) * [-1806.561] (-1806.619) (-1803.433) (-1805.436) -- 0:01:15
211000 -- (-1804.342) [-1803.368] (-1804.610) (-1809.033) * (-1804.528) (-1807.557) (-1805.450) [-1803.740] -- 0:01:14
211500 -- [-1808.788] (-1805.798) (-1802.786) (-1805.059) * (-1802.048) (-1807.866) [-1802.689] (-1803.884) -- 0:01:14
212000 -- (-1807.838) [-1803.089] (-1804.987) (-1806.122) * (-1806.103) [-1807.336] (-1808.206) (-1803.817) -- 0:01:14
212500 -- (-1807.698) (-1802.869) (-1802.716) [-1802.456] * (-1803.605) [-1807.698] (-1804.123) (-1802.865) -- 0:01:14
213000 -- (-1804.316) [-1804.694] (-1803.278) (-1801.954) * (-1804.391) (-1804.127) [-1803.138] (-1803.513) -- 0:01:13
213500 -- (-1803.476) [-1803.076] (-1807.686) (-1806.101) * (-1812.383) (-1805.149) (-1808.554) [-1804.166] -- 0:01:17
214000 -- (-1803.675) (-1802.607) [-1806.070] (-1805.130) * (-1810.752) (-1804.309) [-1807.286] (-1803.801) -- 0:01:17
214500 -- (-1803.157) (-1802.833) [-1804.409] (-1803.296) * (-1806.465) [-1804.864] (-1802.938) (-1804.708) -- 0:01:16
215000 -- (-1802.955) (-1804.449) (-1805.409) [-1803.553] * (-1802.893) (-1806.115) [-1803.957] (-1803.564) -- 0:01:16
Average standard deviation of split frequencies: 0.015713
215500 -- (-1807.749) [-1804.655] (-1806.736) (-1804.707) * (-1805.520) (-1806.665) [-1804.108] (-1804.206) -- 0:01:16
216000 -- (-1806.424) (-1805.656) [-1806.015] (-1803.961) * (-1804.831) (-1809.083) [-1803.843] (-1803.314) -- 0:01:16
216500 -- (-1802.796) (-1806.379) (-1805.062) [-1803.703] * (-1803.168) [-1807.053] (-1803.815) (-1803.137) -- 0:01:15
217000 -- [-1803.904] (-1804.797) (-1806.966) (-1805.384) * (-1803.017) [-1808.076] (-1804.162) (-1803.125) -- 0:01:15
217500 -- (-1805.190) (-1804.458) [-1804.006] (-1804.618) * (-1803.757) [-1803.449] (-1807.241) (-1803.288) -- 0:01:15
218000 -- (-1802.746) (-1803.225) [-1802.297] (-1806.665) * (-1804.696) (-1806.620) (-1805.653) [-1804.495] -- 0:01:15
218500 -- [-1803.768] (-1804.232) (-1802.328) (-1804.880) * (-1804.542) (-1802.550) (-1805.462) [-1805.137] -- 0:01:15
219000 -- (-1804.484) (-1805.874) (-1802.541) [-1803.893] * (-1806.194) [-1802.153] (-1803.090) (-1805.191) -- 0:01:14
219500 -- (-1805.652) (-1804.797) (-1802.850) [-1804.029] * [-1805.924] (-1802.070) (-1804.219) (-1803.168) -- 0:01:14
220000 -- (-1805.786) (-1806.202) [-1802.550] (-1805.228) * [-1805.414] (-1802.992) (-1804.500) (-1803.369) -- 0:01:14
Average standard deviation of split frequencies: 0.013672
220500 -- (-1804.543) (-1807.434) [-1802.847] (-1805.725) * [-1803.556] (-1803.306) (-1803.562) (-1803.751) -- 0:01:14
221000 -- (-1806.093) (-1803.518) [-1803.171] (-1804.797) * (-1804.713) (-1804.637) (-1803.900) [-1807.200] -- 0:01:14
221500 -- (-1803.472) (-1802.334) (-1802.645) [-1808.754] * (-1803.266) (-1804.877) [-1805.504] (-1805.137) -- 0:01:13
222000 -- [-1803.829] (-1802.679) (-1804.453) (-1805.423) * (-1804.816) (-1804.021) [-1804.861] (-1803.317) -- 0:01:13
222500 -- (-1809.209) (-1804.114) [-1802.668] (-1804.446) * (-1803.694) (-1805.885) (-1805.596) [-1802.577] -- 0:01:13
223000 -- [-1806.617] (-1803.071) (-1803.064) (-1802.877) * (-1804.207) (-1806.264) (-1805.140) [-1802.117] -- 0:01:13
223500 -- (-1805.331) [-1802.719] (-1803.564) (-1802.906) * [-1804.478] (-1805.240) (-1804.426) (-1807.018) -- 0:01:12
224000 -- (-1804.730) (-1806.372) [-1808.542] (-1804.060) * (-1804.872) (-1809.753) (-1803.800) [-1806.331] -- 0:01:12
224500 -- [-1805.804] (-1803.282) (-1803.427) (-1809.593) * (-1804.591) [-1805.601] (-1803.880) (-1805.847) -- 0:01:15
225000 -- [-1805.343] (-1806.898) (-1804.848) (-1803.973) * [-1802.750] (-1805.542) (-1804.745) (-1803.688) -- 0:01:15
Average standard deviation of split frequencies: 0.015018
225500 -- (-1807.296) (-1809.312) [-1803.730] (-1805.119) * (-1805.608) [-1804.948] (-1807.303) (-1802.726) -- 0:01:15
226000 -- (-1803.597) (-1806.363) [-1805.587] (-1804.784) * (-1803.536) (-1805.573) (-1803.147) [-1804.196] -- 0:01:15
226500 -- [-1805.685] (-1807.263) (-1806.990) (-1806.082) * (-1802.470) (-1805.185) (-1804.804) [-1805.667] -- 0:01:15
227000 -- (-1804.641) [-1803.803] (-1807.516) (-1806.997) * (-1803.504) [-1809.627] (-1807.978) (-1802.948) -- 0:01:14
227500 -- (-1805.648) (-1804.461) (-1805.612) [-1805.780] * (-1804.093) (-1807.829) (-1804.444) [-1803.148] -- 0:01:14
228000 -- (-1803.293) [-1803.222] (-1804.013) (-1807.665) * (-1804.304) [-1803.475] (-1803.878) (-1802.901) -- 0:01:14
228500 -- [-1802.531] (-1803.247) (-1806.122) (-1804.133) * (-1806.994) [-1804.896] (-1802.794) (-1803.951) -- 0:01:14
229000 -- (-1806.000) (-1803.714) (-1805.738) [-1804.371] * (-1805.902) (-1805.574) (-1803.585) [-1804.769] -- 0:01:14
229500 -- (-1804.415) [-1804.226] (-1806.025) (-1805.137) * (-1803.859) (-1804.697) [-1803.347] (-1802.275) -- 0:01:13
230000 -- (-1804.430) (-1804.788) [-1807.528] (-1804.508) * (-1804.924) (-1802.665) (-1805.065) [-1804.181] -- 0:01:13
Average standard deviation of split frequencies: 0.017575
230500 -- [-1806.553] (-1808.724) (-1804.694) (-1804.675) * (-1802.574) [-1803.762] (-1804.446) (-1804.050) -- 0:01:13
231000 -- [-1803.438] (-1804.986) (-1805.088) (-1804.163) * [-1807.632] (-1809.997) (-1809.092) (-1806.471) -- 0:01:13
231500 -- [-1803.607] (-1804.357) (-1803.835) (-1806.004) * (-1810.610) [-1804.158] (-1803.756) (-1808.337) -- 0:01:13
232000 -- (-1803.853) (-1802.501) (-1803.399) [-1802.728] * (-1803.240) (-1805.405) [-1805.501] (-1806.064) -- 0:01:12
232500 -- (-1803.987) (-1804.267) (-1803.633) [-1803.580] * (-1804.575) [-1806.507] (-1804.864) (-1805.690) -- 0:01:12
233000 -- (-1804.786) [-1803.662] (-1803.685) (-1804.244) * (-1803.474) (-1805.561) (-1801.768) [-1803.970] -- 0:01:12
233500 -- (-1805.414) [-1805.437] (-1803.930) (-1805.979) * [-1804.026] (-1804.737) (-1805.502) (-1804.330) -- 0:01:12
234000 -- [-1805.376] (-1805.085) (-1807.593) (-1804.666) * [-1803.545] (-1803.350) (-1807.508) (-1803.968) -- 0:01:12
234500 -- (-1805.634) [-1803.732] (-1803.287) (-1804.536) * (-1803.178) (-1806.591) [-1808.370] (-1804.201) -- 0:01:11
235000 -- [-1804.639] (-1804.355) (-1803.356) (-1803.430) * (-1804.458) (-1806.112) [-1804.291] (-1804.363) -- 0:01:14
Average standard deviation of split frequencies: 0.017578
235500 -- (-1807.159) (-1803.355) [-1807.798] (-1803.666) * (-1803.068) (-1805.211) [-1803.802] (-1805.025) -- 0:01:14
236000 -- (-1804.702) [-1803.236] (-1805.483) (-1803.740) * (-1809.182) (-1803.888) (-1803.392) [-1804.992] -- 0:01:14
236500 -- (-1804.182) (-1804.181) [-1803.777] (-1803.869) * [-1808.887] (-1803.573) (-1803.869) (-1803.124) -- 0:01:14
237000 -- (-1807.463) [-1803.033] (-1802.946) (-1804.434) * (-1804.973) [-1804.682] (-1803.579) (-1801.912) -- 0:01:14
237500 -- [-1806.417] (-1804.975) (-1802.631) (-1803.541) * (-1805.556) (-1803.551) (-1803.617) [-1803.637] -- 0:01:13
238000 -- (-1805.751) (-1804.628) (-1802.858) [-1805.639] * (-1804.957) (-1804.481) [-1802.821] (-1806.153) -- 0:01:13
238500 -- (-1807.922) (-1805.206) [-1803.497] (-1805.647) * (-1805.797) (-1804.765) [-1804.495] (-1811.217) -- 0:01:13
239000 -- (-1807.405) (-1807.640) (-1802.637) [-1806.112] * (-1805.683) (-1803.742) [-1807.016] (-1805.479) -- 0:01:13
239500 -- (-1803.340) [-1803.936] (-1806.471) (-1806.235) * (-1804.111) [-1805.747] (-1807.056) (-1805.088) -- 0:01:13
240000 -- [-1803.087] (-1803.936) (-1805.530) (-1808.760) * (-1804.650) (-1803.793) (-1804.361) [-1802.867] -- 0:01:12
Average standard deviation of split frequencies: 0.017629
240500 -- [-1803.347] (-1806.418) (-1803.537) (-1806.825) * (-1803.927) (-1804.274) [-1803.031] (-1803.184) -- 0:01:12
241000 -- (-1804.139) (-1804.549) [-1803.193] (-1805.809) * [-1803.739] (-1803.029) (-1804.628) (-1807.724) -- 0:01:12
241500 -- (-1806.301) (-1804.053) [-1802.333] (-1805.362) * (-1804.353) (-1808.281) (-1803.775) [-1806.709] -- 0:01:12
242000 -- (-1803.315) [-1803.431] (-1802.304) (-1804.075) * (-1805.284) [-1807.195] (-1803.577) (-1806.723) -- 0:01:12
242500 -- (-1806.040) [-1802.832] (-1801.701) (-1804.671) * [-1803.943] (-1809.674) (-1804.708) (-1803.824) -- 0:01:11
243000 -- (-1804.885) (-1805.816) (-1804.829) [-1804.197] * (-1802.797) (-1806.770) (-1806.959) [-1802.545] -- 0:01:11
243500 -- (-1809.493) (-1804.992) [-1804.656] (-1803.162) * (-1804.850) (-1808.142) (-1803.655) [-1803.875] -- 0:01:11
244000 -- (-1807.362) (-1803.939) [-1803.725] (-1803.639) * [-1804.678] (-1808.498) (-1805.355) (-1803.549) -- 0:01:11
244500 -- [-1808.201] (-1802.490) (-1803.142) (-1804.328) * (-1805.760) [-1804.619] (-1806.342) (-1802.151) -- 0:01:11
245000 -- (-1805.928) [-1804.131] (-1801.985) (-1803.015) * (-1805.493) (-1806.909) [-1804.074] (-1802.989) -- 0:01:10
Average standard deviation of split frequencies: 0.016097
245500 -- (-1803.522) [-1803.726] (-1803.080) (-1803.007) * (-1807.953) (-1806.264) (-1803.216) [-1805.814] -- 0:01:10
246000 -- (-1804.353) (-1804.521) (-1802.952) [-1807.524] * (-1804.925) (-1807.273) (-1803.917) [-1805.101] -- 0:01:13
246500 -- (-1804.263) (-1802.857) (-1804.215) [-1804.587] * (-1804.838) (-1806.800) [-1803.554] (-1804.207) -- 0:01:13
247000 -- [-1803.902] (-1803.364) (-1802.809) (-1806.200) * (-1804.949) (-1809.010) [-1803.785] (-1805.629) -- 0:01:13
247500 -- (-1806.566) (-1805.437) (-1805.162) [-1805.345] * [-1804.323] (-1808.768) (-1806.020) (-1804.173) -- 0:01:12
248000 -- (-1808.555) (-1805.436) [-1806.287] (-1802.924) * (-1806.493) [-1803.358] (-1807.509) (-1807.479) -- 0:01:12
248500 -- [-1807.749] (-1805.940) (-1806.331) (-1804.240) * (-1806.000) (-1803.540) (-1805.808) [-1804.854] -- 0:01:12
249000 -- (-1804.086) (-1803.400) (-1808.622) [-1805.891] * [-1804.752] (-1803.588) (-1803.267) (-1804.576) -- 0:01:12
249500 -- (-1804.345) (-1803.340) (-1807.179) [-1803.798] * (-1804.055) [-1804.736] (-1803.526) (-1804.860) -- 0:01:12
250000 -- (-1804.227) (-1805.132) [-1805.973] (-1805.471) * [-1804.301] (-1804.998) (-1806.067) (-1805.682) -- 0:01:12
Average standard deviation of split frequencies: 0.015421
250500 -- (-1804.243) (-1804.214) [-1805.955] (-1805.448) * (-1804.393) (-1808.218) [-1803.362] (-1804.991) -- 0:01:11
251000 -- (-1804.064) (-1803.883) [-1804.118] (-1806.085) * [-1804.167] (-1805.982) (-1803.583) (-1804.342) -- 0:01:11
251500 -- (-1803.515) (-1805.457) [-1805.561] (-1806.429) * [-1805.896] (-1803.686) (-1803.967) (-1803.124) -- 0:01:11
252000 -- (-1804.171) [-1807.392] (-1803.283) (-1805.066) * (-1804.426) (-1803.447) (-1803.902) [-1804.285] -- 0:01:11
252500 -- [-1805.600] (-1803.965) (-1803.845) (-1804.060) * [-1802.785] (-1803.828) (-1806.114) (-1803.998) -- 0:01:11
253000 -- [-1803.363] (-1803.470) (-1805.143) (-1803.224) * (-1804.833) [-1803.467] (-1802.664) (-1805.199) -- 0:01:10
253500 -- [-1802.972] (-1805.866) (-1803.578) (-1803.564) * (-1803.728) [-1803.881] (-1803.097) (-1806.330) -- 0:01:10
254000 -- (-1805.140) (-1806.506) (-1805.536) [-1805.123] * (-1805.581) [-1803.010] (-1802.646) (-1805.080) -- 0:01:10
254500 -- (-1806.307) (-1806.253) [-1803.032] (-1806.029) * (-1807.032) [-1804.099] (-1803.212) (-1803.517) -- 0:01:10
255000 -- (-1805.018) (-1804.019) (-1802.944) [-1807.382] * [-1806.079] (-1803.745) (-1803.853) (-1803.160) -- 0:01:10
Average standard deviation of split frequencies: 0.015100
255500 -- (-1806.948) (-1805.768) (-1807.099) [-1807.928] * (-1803.271) (-1812.276) [-1807.681] (-1805.079) -- 0:01:09
256000 -- (-1805.750) (-1804.843) [-1807.308] (-1806.774) * (-1803.871) [-1805.231] (-1803.978) (-1805.672) -- 0:01:12
256500 -- [-1804.917] (-1804.103) (-1807.371) (-1805.049) * [-1803.770] (-1805.029) (-1805.902) (-1803.581) -- 0:01:12
257000 -- [-1803.674] (-1810.219) (-1806.757) (-1804.203) * (-1806.738) (-1807.868) [-1805.204] (-1803.430) -- 0:01:12
257500 -- (-1805.596) (-1806.277) (-1803.439) [-1803.376] * (-1804.727) (-1812.027) [-1804.467] (-1804.142) -- 0:01:12
258000 -- [-1804.127] (-1805.317) (-1804.122) (-1803.446) * (-1808.395) (-1807.370) [-1803.904] (-1803.889) -- 0:01:11
258500 -- [-1803.957] (-1802.477) (-1804.125) (-1803.943) * (-1807.473) [-1803.211] (-1803.354) (-1804.384) -- 0:01:11
259000 -- [-1804.838] (-1803.187) (-1803.913) (-1806.921) * (-1805.390) (-1802.544) [-1803.926] (-1802.746) -- 0:01:11
259500 -- [-1804.383] (-1804.264) (-1803.933) (-1802.991) * (-1804.578) [-1802.686] (-1803.372) (-1804.171) -- 0:01:11
260000 -- (-1805.600) [-1803.043] (-1804.789) (-1802.880) * [-1804.138] (-1802.562) (-1807.072) (-1802.337) -- 0:01:11
Average standard deviation of split frequencies: 0.014468
260500 -- [-1807.274] (-1803.185) (-1805.051) (-1803.430) * [-1804.269] (-1802.990) (-1804.313) (-1803.103) -- 0:01:10
261000 -- (-1806.199) [-1803.870] (-1803.176) (-1803.425) * (-1809.024) (-1803.316) [-1802.664] (-1806.102) -- 0:01:10
261500 -- (-1803.091) (-1804.451) (-1804.108) [-1807.894] * (-1806.146) [-1803.073] (-1806.581) (-1802.774) -- 0:01:10
262000 -- [-1803.632] (-1803.070) (-1805.756) (-1805.312) * (-1804.509) (-1806.928) (-1803.254) [-1804.575] -- 0:01:10
262500 -- [-1802.990] (-1802.696) (-1806.322) (-1804.426) * [-1804.958] (-1804.067) (-1803.985) (-1808.662) -- 0:01:10
263000 -- (-1804.164) [-1809.410] (-1807.804) (-1805.589) * [-1805.812] (-1803.047) (-1803.731) (-1804.246) -- 0:01:10
263500 -- (-1807.356) (-1809.226) (-1807.824) [-1805.631] * (-1804.991) (-1804.277) (-1803.096) [-1803.789] -- 0:01:09
264000 -- [-1804.200] (-1804.741) (-1807.217) (-1803.059) * (-1803.767) (-1806.129) [-1802.930] (-1804.531) -- 0:01:09
264500 -- (-1805.220) (-1802.803) (-1808.218) [-1804.802] * [-1804.855] (-1804.718) (-1803.329) (-1803.979) -- 0:01:09
265000 -- [-1805.581] (-1805.093) (-1807.264) (-1803.661) * [-1804.357] (-1803.359) (-1803.555) (-1802.709) -- 0:01:09
Average standard deviation of split frequencies: 0.013114
265500 -- (-1804.768) (-1804.672) [-1802.945] (-1803.737) * (-1805.605) (-1804.080) [-1803.769] (-1803.956) -- 0:01:09
266000 -- (-1807.079) (-1804.563) [-1804.093] (-1805.714) * (-1805.145) (-1804.760) (-1802.915) [-1803.576] -- 0:01:08
266500 -- (-1806.262) [-1804.365] (-1804.416) (-1805.162) * (-1804.225) [-1804.679] (-1803.737) (-1803.651) -- 0:01:08
267000 -- (-1805.864) (-1802.967) [-1806.273] (-1804.047) * (-1806.148) (-1805.295) (-1803.326) [-1804.654] -- 0:01:11
267500 -- [-1805.228] (-1803.784) (-1805.753) (-1803.739) * (-1803.052) (-1804.836) [-1805.879] (-1804.941) -- 0:01:11
268000 -- (-1803.807) [-1805.644] (-1805.274) (-1803.522) * (-1804.056) [-1804.351] (-1805.507) (-1805.911) -- 0:01:11
268500 -- (-1804.014) (-1804.265) (-1812.480) [-1803.378] * (-1810.498) [-1804.015] (-1805.574) (-1803.997) -- 0:01:10
269000 -- [-1805.305] (-1803.791) (-1805.271) (-1802.997) * (-1806.157) (-1805.811) (-1804.393) [-1805.296] -- 0:01:10
269500 -- (-1804.689) [-1804.546] (-1803.548) (-1802.342) * (-1805.505) (-1805.303) (-1805.029) [-1803.498] -- 0:01:10
270000 -- (-1810.058) (-1804.207) (-1803.063) [-1804.410] * (-1804.840) (-1803.253) (-1803.907) [-1804.090] -- 0:01:10
Average standard deviation of split frequencies: 0.012888
270500 -- [-1806.372] (-1806.909) (-1804.162) (-1802.892) * (-1805.284) (-1807.233) (-1804.861) [-1805.425] -- 0:01:10
271000 -- (-1805.511) [-1803.847] (-1803.157) (-1805.040) * (-1803.369) [-1808.693] (-1802.966) (-1806.224) -- 0:01:09
271500 -- [-1805.836] (-1805.485) (-1803.202) (-1804.602) * (-1803.548) [-1806.015] (-1803.722) (-1802.830) -- 0:01:09
272000 -- (-1806.426) [-1804.365] (-1804.471) (-1802.577) * (-1804.883) [-1803.868] (-1803.438) (-1804.267) -- 0:01:09
272500 -- (-1804.187) (-1808.670) (-1804.419) [-1803.695] * (-1804.883) (-1802.867) (-1803.813) [-1802.453] -- 0:01:09
273000 -- (-1802.362) [-1803.769] (-1803.963) (-1804.125) * (-1805.249) (-1803.643) (-1804.092) [-1804.931] -- 0:01:09
273500 -- [-1803.521] (-1803.769) (-1804.253) (-1803.976) * (-1804.785) [-1802.473] (-1803.598) (-1804.108) -- 0:01:09
274000 -- (-1804.434) (-1810.240) [-1807.707] (-1806.796) * (-1804.906) [-1805.063] (-1804.601) (-1805.746) -- 0:01:08
274500 -- (-1804.307) (-1803.961) [-1807.769] (-1804.337) * (-1806.126) [-1803.991] (-1810.021) (-1805.237) -- 0:01:08
275000 -- (-1805.640) (-1806.431) (-1806.575) [-1807.102] * (-1806.126) [-1805.022] (-1804.216) (-1807.089) -- 0:01:08
Average standard deviation of split frequencies: 0.013322
275500 -- (-1804.778) [-1806.024] (-1806.527) (-1804.841) * (-1803.386) (-1806.179) [-1804.112] (-1807.101) -- 0:01:08
276000 -- (-1804.112) (-1805.935) [-1805.912] (-1804.418) * (-1803.397) (-1804.161) (-1804.079) [-1803.897] -- 0:01:08
276500 -- [-1807.533] (-1805.812) (-1804.641) (-1803.750) * (-1803.452) (-1803.426) [-1803.480] (-1806.469) -- 0:01:08
277000 -- (-1806.175) (-1803.912) (-1805.790) [-1802.246] * [-1805.596] (-1804.145) (-1803.550) (-1804.863) -- 0:01:07
277500 -- (-1803.799) [-1802.838] (-1805.385) (-1805.349) * (-1807.753) (-1808.822) [-1805.855] (-1805.872) -- 0:01:10
278000 -- (-1802.637) (-1806.053) (-1806.547) [-1804.182] * (-1808.894) [-1806.987] (-1803.194) (-1808.329) -- 0:01:10
278500 -- (-1804.827) [-1804.456] (-1803.711) (-1804.778) * (-1806.307) (-1804.500) [-1804.069] (-1808.558) -- 0:01:09
279000 -- (-1804.628) (-1803.084) (-1805.313) [-1803.916] * (-1802.911) [-1805.476] (-1808.033) (-1805.977) -- 0:01:09
279500 -- (-1804.081) [-1803.469] (-1804.393) (-1805.510) * (-1803.082) (-1803.750) [-1805.382] (-1805.304) -- 0:01:09
280000 -- (-1809.067) (-1805.817) (-1803.305) [-1805.534] * (-1802.509) (-1803.423) [-1806.141] (-1806.372) -- 0:01:09
Average standard deviation of split frequencies: 0.011421
280500 -- [-1805.333] (-1803.581) (-1802.632) (-1803.292) * (-1803.654) (-1804.762) [-1803.751] (-1804.863) -- 0:01:09
281000 -- (-1803.890) (-1804.385) (-1802.336) [-1804.329] * (-1802.505) (-1805.143) [-1803.670] (-1803.200) -- 0:01:09
281500 -- (-1803.884) (-1806.689) (-1802.717) [-1803.678] * [-1804.672] (-1803.447) (-1803.670) (-1803.945) -- 0:01:08
282000 -- (-1804.128) (-1806.257) [-1802.996] (-1803.272) * (-1804.312) (-1805.332) (-1806.086) [-1805.865] -- 0:01:08
282500 -- (-1803.204) (-1806.079) (-1803.590) [-1803.390] * (-1803.542) (-1807.696) (-1804.751) [-1807.554] -- 0:01:08
283000 -- (-1804.766) (-1803.965) [-1802.723] (-1805.503) * (-1807.578) (-1805.665) (-1804.801) [-1804.229] -- 0:01:08
283500 -- (-1805.705) [-1803.793] (-1803.471) (-1807.515) * (-1804.033) (-1802.864) (-1805.638) [-1805.488] -- 0:01:08
284000 -- (-1805.767) (-1804.752) (-1806.575) [-1802.217] * (-1803.676) (-1802.987) [-1804.014] (-1803.733) -- 0:01:08
284500 -- (-1806.291) [-1803.961] (-1805.741) (-1805.366) * (-1802.863) [-1803.095] (-1804.079) (-1804.780) -- 0:01:07
285000 -- (-1803.875) [-1804.400] (-1806.828) (-1804.661) * (-1803.163) (-1803.517) [-1803.037] (-1805.317) -- 0:01:07
Average standard deviation of split frequencies: 0.013186
285500 -- [-1803.764] (-1805.210) (-1804.282) (-1803.496) * (-1804.275) [-1803.008] (-1804.172) (-1803.980) -- 0:01:07
286000 -- (-1803.896) (-1803.601) [-1809.778] (-1805.851) * (-1803.028) [-1802.887] (-1803.225) (-1803.861) -- 0:01:07
286500 -- [-1804.965] (-1803.090) (-1804.064) (-1803.630) * (-1803.734) (-1803.696) (-1805.008) [-1803.410] -- 0:01:07
287000 -- (-1802.759) [-1804.134] (-1805.876) (-1804.849) * (-1805.669) (-1807.562) [-1803.548] (-1803.360) -- 0:01:07
287500 -- [-1803.255] (-1803.339) (-1806.240) (-1805.820) * (-1804.704) (-1807.337) [-1803.523] (-1803.092) -- 0:01:06
288000 -- (-1803.490) [-1804.043] (-1806.193) (-1804.497) * (-1805.098) [-1803.085] (-1803.368) (-1804.081) -- 0:01:06
288500 -- (-1804.690) [-1803.381] (-1805.385) (-1806.361) * (-1806.783) (-1804.541) [-1804.999] (-1803.641) -- 0:01:09
289000 -- (-1807.775) [-1805.330] (-1803.983) (-1806.686) * (-1807.051) [-1803.943] (-1802.992) (-1804.408) -- 0:01:08
289500 -- (-1803.303) (-1804.196) [-1804.534] (-1806.966) * (-1806.612) [-1802.676] (-1803.845) (-1804.206) -- 0:01:08
290000 -- (-1804.602) (-1809.664) (-1806.559) [-1803.634] * (-1807.242) (-1804.928) [-1803.262] (-1805.753) -- 0:01:08
Average standard deviation of split frequencies: 0.013948
290500 -- (-1804.771) (-1806.474) (-1805.058) [-1804.754] * (-1809.972) [-1804.907] (-1804.354) (-1805.700) -- 0:01:08
291000 -- [-1805.644] (-1803.350) (-1804.175) (-1808.932) * (-1803.923) [-1804.068] (-1803.873) (-1805.022) -- 0:01:08
291500 -- [-1803.956] (-1809.941) (-1805.309) (-1805.265) * (-1804.964) [-1806.030] (-1805.400) (-1802.943) -- 0:01:08
292000 -- (-1804.487) (-1810.292) (-1806.415) [-1803.937] * (-1804.372) (-1805.678) (-1803.481) [-1806.786] -- 0:01:07
292500 -- [-1803.171] (-1804.635) (-1807.115) (-1805.476) * (-1804.491) [-1806.219] (-1804.047) (-1805.171) -- 0:01:07
293000 -- (-1804.325) [-1804.972] (-1803.242) (-1807.911) * [-1804.648] (-1804.405) (-1810.281) (-1805.397) -- 0:01:07
293500 -- (-1812.624) [-1803.107] (-1806.882) (-1808.577) * (-1806.510) (-1803.379) [-1809.333] (-1803.821) -- 0:01:07
294000 -- [-1808.113] (-1806.670) (-1803.685) (-1804.895) * (-1806.011) [-1803.673] (-1803.707) (-1804.788) -- 0:01:07
294500 -- (-1807.755) (-1804.419) (-1805.919) [-1804.267] * (-1803.314) [-1802.996] (-1805.330) (-1807.120) -- 0:01:07
295000 -- (-1803.755) (-1804.720) [-1803.515] (-1806.744) * (-1806.779) (-1805.507) (-1806.040) [-1805.676] -- 0:01:06
Average standard deviation of split frequencies: 0.012422
295500 -- (-1803.611) [-1803.730] (-1807.526) (-1802.863) * [-1806.634] (-1808.169) (-1812.906) (-1804.346) -- 0:01:06
296000 -- (-1804.030) [-1804.929] (-1804.536) (-1804.047) * (-1804.868) (-1803.888) (-1804.405) [-1804.221] -- 0:01:06
296500 -- [-1805.525] (-1804.246) (-1803.403) (-1803.496) * (-1803.570) [-1804.079] (-1807.902) (-1806.316) -- 0:01:06
297000 -- [-1803.772] (-1804.379) (-1803.584) (-1802.845) * [-1804.241] (-1805.112) (-1804.304) (-1804.656) -- 0:01:06
297500 -- (-1803.351) (-1804.311) (-1803.236) [-1802.923] * [-1805.529] (-1803.158) (-1807.115) (-1804.563) -- 0:01:06
298000 -- (-1803.730) (-1803.350) [-1804.030] (-1803.913) * [-1804.062] (-1803.644) (-1803.200) (-1804.260) -- 0:01:05
298500 -- [-1805.241] (-1805.075) (-1804.502) (-1803.259) * (-1805.148) (-1803.711) [-1803.201] (-1804.541) -- 0:01:05
299000 -- (-1805.395) (-1804.131) (-1804.810) [-1803.300] * (-1804.521) (-1805.395) (-1804.936) [-1803.333] -- 0:01:07
299500 -- (-1805.735) (-1803.446) [-1803.729] (-1809.309) * (-1803.736) (-1803.913) (-1803.133) [-1804.260] -- 0:01:07
300000 -- (-1809.143) [-1805.122] (-1803.604) (-1804.693) * (-1803.659) [-1803.700] (-1804.774) (-1812.704) -- 0:01:07
Average standard deviation of split frequencies: 0.012543
300500 -- (-1804.970) [-1807.405] (-1803.246) (-1804.860) * (-1803.562) (-1803.989) (-1804.409) [-1806.001] -- 0:01:07
301000 -- [-1805.926] (-1806.380) (-1804.539) (-1805.036) * [-1803.216] (-1807.478) (-1806.511) (-1807.174) -- 0:01:07
301500 -- (-1804.736) (-1806.255) [-1803.434] (-1803.019) * (-1804.348) (-1809.608) [-1803.649] (-1804.461) -- 0:01:07
302000 -- (-1804.385) [-1804.987] (-1805.663) (-1803.050) * (-1805.642) [-1805.149] (-1806.582) (-1803.222) -- 0:01:07
302500 -- (-1807.742) (-1802.727) (-1803.279) [-1803.920] * (-1803.569) (-1804.719) [-1805.233] (-1806.110) -- 0:01:06
303000 -- (-1809.051) (-1803.929) (-1803.346) [-1804.113] * (-1804.738) (-1805.152) (-1804.959) [-1804.469] -- 0:01:06
303500 -- (-1810.145) [-1803.915] (-1803.011) (-1803.563) * (-1805.295) [-1806.135] (-1804.096) (-1803.419) -- 0:01:06
304000 -- (-1814.247) (-1803.905) (-1803.400) [-1803.536] * [-1807.256] (-1804.997) (-1804.912) (-1806.096) -- 0:01:06
304500 -- (-1805.560) [-1804.106] (-1803.369) (-1805.387) * [-1802.728] (-1804.296) (-1805.265) (-1805.400) -- 0:01:06
305000 -- (-1804.649) (-1808.603) [-1804.635] (-1805.608) * (-1803.871) [-1806.273] (-1805.375) (-1806.649) -- 0:01:06
Average standard deviation of split frequencies: 0.012016
305500 -- (-1806.309) (-1804.320) [-1804.979] (-1804.270) * [-1806.874] (-1802.941) (-1804.957) (-1805.133) -- 0:01:05
306000 -- (-1807.323) [-1804.589] (-1805.338) (-1802.905) * (-1805.325) (-1804.329) [-1803.784] (-1804.702) -- 0:01:05
306500 -- [-1805.500] (-1805.633) (-1805.979) (-1806.471) * (-1804.473) (-1806.079) [-1803.562] (-1805.953) -- 0:01:05
307000 -- (-1806.732) (-1807.335) [-1803.760] (-1804.550) * [-1804.686] (-1802.880) (-1804.339) (-1804.514) -- 0:01:05
307500 -- (-1804.328) (-1807.590) [-1804.187] (-1806.243) * (-1804.522) [-1803.098] (-1802.210) (-1805.662) -- 0:01:05
308000 -- [-1804.519] (-1804.893) (-1804.930) (-1807.270) * (-1803.076) (-1804.138) [-1803.781] (-1803.814) -- 0:01:05
308500 -- [-1803.058] (-1804.779) (-1805.310) (-1804.894) * (-1802.400) (-1803.637) [-1802.551] (-1805.386) -- 0:01:05
309000 -- [-1804.513] (-1804.444) (-1803.705) (-1804.026) * (-1802.978) [-1802.501] (-1803.915) (-1804.415) -- 0:01:04
309500 -- (-1804.592) (-1804.322) [-1804.230] (-1803.787) * (-1803.760) (-1803.820) (-1806.722) [-1803.752] -- 0:01:04
310000 -- [-1806.978] (-1806.718) (-1802.968) (-1804.264) * (-1804.307) (-1803.840) [-1806.094] (-1803.751) -- 0:01:06
Average standard deviation of split frequencies: 0.011836
310500 -- (-1804.298) (-1803.128) (-1807.631) [-1804.312] * [-1804.783] (-1804.455) (-1805.130) (-1803.890) -- 0:01:06
311000 -- (-1804.501) (-1803.189) (-1803.466) [-1803.226] * (-1805.703) (-1803.889) [-1803.833] (-1803.003) -- 0:01:06
311500 -- (-1805.808) (-1804.381) [-1803.705] (-1805.132) * (-1805.087) (-1803.506) (-1803.800) [-1803.272] -- 0:01:06
312000 -- (-1804.212) (-1804.651) [-1806.409] (-1805.200) * (-1807.847) (-1806.119) (-1811.315) [-1803.923] -- 0:01:06
312500 -- [-1805.139] (-1804.806) (-1806.392) (-1803.261) * (-1805.410) (-1806.499) (-1804.648) [-1805.946] -- 0:01:06
313000 -- (-1802.856) (-1804.949) (-1804.898) [-1807.344] * (-1802.788) (-1810.831) (-1803.476) [-1804.911] -- 0:01:05
313500 -- (-1804.384) [-1804.283] (-1803.449) (-1807.967) * (-1804.288) (-1803.409) [-1806.642] (-1804.633) -- 0:01:05
314000 -- (-1804.187) (-1803.800) [-1804.251] (-1805.881) * [-1806.104] (-1803.336) (-1804.138) (-1806.139) -- 0:01:05
314500 -- [-1804.909] (-1804.527) (-1803.243) (-1804.158) * (-1808.681) (-1805.129) [-1804.121] (-1806.426) -- 0:01:05
315000 -- [-1804.620] (-1803.389) (-1803.243) (-1805.748) * (-1806.509) (-1802.978) (-1807.637) [-1805.527] -- 0:01:05
Average standard deviation of split frequencies: 0.011636
315500 -- (-1803.321) (-1805.092) [-1804.708] (-1806.792) * (-1804.897) (-1804.629) [-1804.949] (-1806.149) -- 0:01:05
316000 -- (-1803.877) (-1803.277) (-1803.501) [-1804.884] * (-1803.861) [-1805.569] (-1802.904) (-1808.966) -- 0:01:04
316500 -- (-1803.720) [-1803.293] (-1805.061) (-1804.080) * (-1805.632) (-1803.686) [-1803.765] (-1804.319) -- 0:01:04
317000 -- (-1802.947) [-1803.413] (-1802.990) (-1805.211) * (-1804.792) (-1803.881) [-1804.742] (-1808.426) -- 0:01:04
317500 -- (-1807.920) [-1802.987] (-1805.785) (-1802.701) * (-1804.402) [-1805.413] (-1802.822) (-1806.884) -- 0:01:04
318000 -- (-1805.149) (-1803.696) [-1803.872] (-1803.684) * (-1803.957) (-1805.886) [-1805.404] (-1805.048) -- 0:01:04
318500 -- [-1808.321] (-1806.217) (-1803.255) (-1804.014) * (-1803.641) [-1806.579] (-1805.311) (-1805.550) -- 0:01:04
319000 -- (-1806.356) (-1803.655) (-1805.597) [-1804.347] * (-1805.352) (-1802.971) [-1805.256] (-1804.852) -- 0:01:04
319500 -- (-1807.466) [-1803.812] (-1804.326) (-1805.243) * (-1804.661) (-1803.342) (-1804.946) [-1803.451] -- 0:01:03
320000 -- (-1807.699) (-1803.372) [-1804.023] (-1805.740) * (-1804.000) (-1804.116) (-1802.997) [-1804.118] -- 0:01:03
Average standard deviation of split frequencies: 0.012055
320500 -- (-1805.235) (-1802.462) (-1805.300) [-1806.242] * [-1805.286] (-1808.271) (-1802.212) (-1802.985) -- 0:01:05
321000 -- [-1804.156] (-1805.074) (-1802.413) (-1803.323) * (-1804.827) (-1806.830) (-1807.012) [-1803.986] -- 0:01:05
321500 -- (-1803.890) (-1806.019) [-1803.273] (-1804.690) * [-1803.199] (-1803.386) (-1805.377) (-1804.822) -- 0:01:05
322000 -- (-1804.605) (-1806.979) (-1802.296) [-1803.927] * (-1803.564) (-1803.386) [-1804.948] (-1802.814) -- 0:01:05
322500 -- (-1805.035) (-1802.654) (-1806.495) [-1803.117] * (-1804.364) (-1803.716) (-1806.155) [-1802.535] -- 0:01:05
323000 -- (-1803.704) [-1804.611] (-1805.242) (-1802.388) * [-1807.276] (-1803.668) (-1804.401) (-1803.563) -- 0:01:04
323500 -- (-1804.392) (-1803.553) (-1805.578) [-1804.561] * [-1803.099] (-1804.757) (-1804.683) (-1807.415) -- 0:01:04
324000 -- [-1804.129] (-1807.638) (-1803.461) (-1806.815) * [-1803.967] (-1804.130) (-1807.214) (-1807.197) -- 0:01:04
324500 -- (-1806.317) [-1802.987] (-1803.896) (-1804.423) * (-1808.754) (-1804.845) (-1803.564) [-1804.654] -- 0:01:04
325000 -- (-1805.981) [-1803.268] (-1802.841) (-1805.933) * [-1804.797] (-1803.936) (-1804.301) (-1805.740) -- 0:01:04
Average standard deviation of split frequencies: 0.013014
325500 -- (-1807.594) (-1804.385) (-1808.854) [-1806.107] * [-1803.542] (-1805.893) (-1804.361) (-1804.358) -- 0:01:04
326000 -- (-1807.777) (-1804.768) (-1806.885) [-1805.356] * (-1805.051) (-1804.767) [-1804.059] (-1804.886) -- 0:01:04
326500 -- (-1808.068) [-1803.544] (-1806.721) (-1804.325) * (-1803.289) [-1803.153] (-1803.958) (-1804.738) -- 0:01:03
327000 -- (-1810.447) (-1805.962) (-1804.153) [-1805.604] * (-1805.161) (-1803.190) (-1803.809) [-1804.739] -- 0:01:03
327500 -- (-1803.460) (-1806.276) [-1805.964] (-1804.291) * (-1806.012) (-1803.036) [-1804.247] (-1805.444) -- 0:01:03
328000 -- [-1803.609] (-1804.622) (-1804.105) (-1802.608) * [-1804.629] (-1803.579) (-1806.237) (-1804.221) -- 0:01:03
328500 -- (-1803.842) (-1804.518) [-1804.539] (-1802.987) * (-1807.187) (-1803.781) (-1803.453) [-1804.470] -- 0:01:03
329000 -- [-1805.034] (-1805.503) (-1803.218) (-1804.485) * [-1804.990] (-1804.020) (-1803.717) (-1805.335) -- 0:01:03
329500 -- (-1803.395) (-1805.622) [-1803.959] (-1807.914) * [-1807.233] (-1804.947) (-1803.698) (-1809.816) -- 0:01:03
330000 -- (-1804.644) (-1803.647) [-1804.911] (-1807.183) * (-1804.964) [-1803.969] (-1807.737) (-1805.318) -- 0:01:02
Average standard deviation of split frequencies: 0.014256
330500 -- (-1803.877) [-1802.656] (-1807.027) (-1806.085) * (-1803.231) (-1805.155) [-1804.941] (-1802.067) -- 0:01:04
331000 -- (-1803.338) [-1803.847] (-1804.982) (-1806.337) * (-1803.711) (-1806.186) (-1804.457) [-1804.066] -- 0:01:04
331500 -- (-1804.752) (-1805.821) [-1803.675] (-1806.722) * (-1803.096) (-1802.742) (-1803.982) [-1802.729] -- 0:01:04
332000 -- (-1805.284) [-1804.935] (-1804.743) (-1805.542) * [-1804.468] (-1802.719) (-1802.596) (-1804.060) -- 0:01:04
332500 -- (-1806.081) [-1802.637] (-1805.222) (-1804.042) * (-1805.531) (-1807.580) (-1803.959) [-1805.433] -- 0:01:04
333000 -- (-1804.085) (-1802.679) (-1805.671) [-1804.087] * [-1805.704] (-1803.159) (-1803.772) (-1804.203) -- 0:01:04
333500 -- (-1806.103) [-1805.103] (-1804.161) (-1803.032) * [-1805.579] (-1803.319) (-1805.118) (-1807.938) -- 0:01:03
334000 -- (-1803.498) [-1802.890] (-1804.950) (-1805.786) * (-1807.430) (-1804.127) [-1806.719] (-1804.296) -- 0:01:03
334500 -- (-1803.418) [-1802.784] (-1804.006) (-1808.917) * (-1807.831) (-1803.884) [-1805.490] (-1804.597) -- 0:01:03
335000 -- [-1805.944] (-1805.673) (-1805.396) (-1806.108) * (-1804.405) (-1803.023) (-1805.056) [-1803.177] -- 0:01:03
Average standard deviation of split frequencies: 0.014872
335500 -- (-1804.361) (-1802.871) [-1804.516] (-1803.768) * (-1805.278) (-1803.014) (-1804.378) [-1803.907] -- 0:01:03
336000 -- (-1805.430) [-1805.454] (-1806.587) (-1805.822) * (-1804.023) (-1805.152) [-1804.603] (-1802.603) -- 0:01:03
336500 -- (-1804.781) (-1805.325) (-1804.502) [-1805.142] * [-1803.425] (-1804.991) (-1805.381) (-1802.720) -- 0:01:03
337000 -- (-1804.610) [-1803.160] (-1804.585) (-1805.593) * (-1804.542) (-1806.222) (-1805.494) [-1804.427] -- 0:01:02
337500 -- (-1802.810) (-1805.893) (-1808.577) [-1806.817] * (-1803.199) [-1804.535] (-1804.248) (-1803.534) -- 0:01:02
338000 -- (-1804.266) (-1805.266) [-1803.773] (-1805.249) * [-1802.776] (-1804.387) (-1803.706) (-1802.716) -- 0:01:02
338500 -- [-1805.162] (-1805.915) (-1804.008) (-1809.436) * (-1804.803) [-1807.192] (-1803.778) (-1806.987) -- 0:01:02
339000 -- (-1805.789) (-1803.743) [-1803.737] (-1803.466) * (-1804.755) [-1804.357] (-1804.809) (-1807.133) -- 0:01:02
339500 -- (-1804.435) (-1805.042) [-1803.703] (-1803.921) * (-1803.020) (-1806.071) [-1807.716] (-1804.271) -- 0:01:02
340000 -- [-1804.405] (-1804.958) (-1803.977) (-1802.879) * (-1804.263) (-1805.133) [-1812.299] (-1803.611) -- 0:01:02
Average standard deviation of split frequencies: 0.013561
340500 -- (-1806.142) (-1804.876) [-1804.693] (-1806.997) * (-1803.370) (-1809.349) (-1804.972) [-1803.006] -- 0:01:03
341000 -- (-1804.343) (-1809.113) (-1807.989) [-1806.106] * (-1804.250) (-1805.805) [-1805.869] (-1805.358) -- 0:01:03
341500 -- (-1803.831) [-1803.877] (-1807.790) (-1802.423) * (-1804.921) [-1802.540] (-1803.249) (-1804.672) -- 0:01:03
342000 -- (-1804.913) (-1803.518) (-1810.126) [-1802.294] * (-1805.626) (-1804.884) [-1805.501] (-1803.683) -- 0:01:03
342500 -- [-1807.166] (-1803.784) (-1803.340) (-1803.840) * (-1804.602) (-1805.748) (-1806.796) [-1803.217] -- 0:01:03
343000 -- (-1806.002) [-1805.546] (-1803.646) (-1809.042) * [-1804.202] (-1804.814) (-1810.432) (-1803.548) -- 0:01:03
343500 -- (-1808.301) [-1807.474] (-1805.292) (-1803.242) * (-1805.781) [-1807.122] (-1807.104) (-1803.157) -- 0:01:03
344000 -- (-1807.861) [-1804.293] (-1803.748) (-1803.863) * (-1803.787) [-1808.527] (-1804.777) (-1804.509) -- 0:01:02
344500 -- (-1805.275) (-1803.458) (-1806.427) [-1804.492] * (-1803.610) (-1810.044) [-1803.242] (-1805.460) -- 0:01:02
345000 -- [-1804.596] (-1804.050) (-1803.875) (-1802.711) * [-1803.747] (-1803.733) (-1805.586) (-1808.756) -- 0:01:02
Average standard deviation of split frequencies: 0.014987
345500 -- (-1804.905) [-1804.914] (-1804.444) (-1803.598) * (-1806.164) (-1805.003) (-1803.129) [-1807.256] -- 0:01:02
346000 -- (-1804.515) [-1803.533] (-1804.796) (-1804.698) * (-1806.470) (-1808.585) [-1802.466] (-1804.364) -- 0:01:02
346500 -- (-1805.928) (-1804.490) (-1804.104) [-1806.795] * [-1803.780] (-1812.224) (-1803.310) (-1803.099) -- 0:01:02
347000 -- (-1804.384) (-1806.178) [-1803.196] (-1805.659) * (-1803.885) [-1804.049] (-1803.968) (-1803.156) -- 0:01:02
347500 -- [-1805.541] (-1805.655) (-1804.385) (-1806.187) * (-1803.717) [-1804.826] (-1804.192) (-1803.193) -- 0:01:01
348000 -- (-1805.506) (-1805.048) [-1805.343] (-1804.897) * (-1805.223) (-1805.706) [-1803.321] (-1809.718) -- 0:01:01
348500 -- (-1805.531) (-1807.178) [-1805.081] (-1804.031) * (-1805.764) (-1807.528) (-1805.067) [-1807.513] -- 0:01:01
349000 -- (-1805.064) [-1808.374] (-1803.596) (-1803.887) * [-1802.873] (-1805.281) (-1803.212) (-1804.394) -- 0:01:01
349500 -- [-1804.559] (-1805.391) (-1806.690) (-1807.327) * [-1805.799] (-1804.965) (-1804.993) (-1804.880) -- 0:01:01
350000 -- [-1804.846] (-1805.051) (-1807.472) (-1803.515) * [-1803.688] (-1806.197) (-1806.222) (-1804.376) -- 0:01:01
Average standard deviation of split frequencies: 0.016132
350500 -- (-1805.268) (-1805.051) (-1805.196) [-1803.163] * (-1806.807) (-1804.573) [-1806.259] (-1804.389) -- 0:01:03
351000 -- (-1805.010) (-1804.715) [-1807.665] (-1805.532) * (-1807.064) (-1804.511) (-1805.510) [-1802.730] -- 0:01:02
351500 -- (-1806.357) (-1806.609) (-1804.746) [-1804.858] * [-1803.555] (-1805.248) (-1805.882) (-1804.448) -- 0:01:02
352000 -- (-1805.417) (-1806.727) [-1803.704] (-1804.198) * [-1803.539] (-1806.379) (-1805.912) (-1803.414) -- 0:01:02
352500 -- (-1804.048) [-1804.560] (-1806.245) (-1803.909) * (-1808.269) (-1805.440) (-1807.243) [-1803.906] -- 0:01:02
353000 -- [-1804.767] (-1802.825) (-1803.877) (-1809.109) * (-1805.067) (-1811.153) [-1805.040] (-1803.640) -- 0:01:02
353500 -- [-1805.114] (-1807.771) (-1804.017) (-1804.076) * (-1803.996) (-1807.937) (-1802.831) [-1803.052] -- 0:01:02
354000 -- (-1807.733) (-1808.051) (-1806.956) [-1804.731] * (-1806.001) (-1805.224) (-1802.986) [-1803.424] -- 0:01:02
354500 -- (-1804.149) (-1807.475) (-1805.731) [-1804.154] * (-1806.213) (-1803.445) [-1804.898] (-1802.909) -- 0:01:01
355000 -- [-1805.252] (-1807.828) (-1802.818) (-1804.121) * (-1808.236) (-1805.590) [-1804.728] (-1803.632) -- 0:01:01
Average standard deviation of split frequencies: 0.016155
355500 -- (-1804.552) (-1806.622) (-1804.390) [-1803.879] * [-1804.137] (-1803.794) (-1804.628) (-1804.000) -- 0:01:01
356000 -- (-1809.856) (-1805.527) (-1804.910) [-1802.412] * (-1803.560) (-1803.467) [-1810.213] (-1804.082) -- 0:01:01
356500 -- (-1805.906) (-1808.336) [-1807.347] (-1803.396) * (-1802.753) (-1807.192) [-1803.731] (-1803.800) -- 0:01:01
357000 -- (-1806.478) (-1805.543) [-1802.781] (-1803.077) * [-1804.690] (-1802.778) (-1803.455) (-1803.824) -- 0:01:01
357500 -- (-1803.705) (-1805.414) [-1805.539] (-1810.375) * (-1804.683) [-1803.354] (-1804.269) (-1804.676) -- 0:01:01
358000 -- (-1804.900) (-1805.632) (-1807.890) [-1805.398] * [-1804.049] (-1803.373) (-1804.291) (-1804.697) -- 0:01:00
358500 -- (-1804.983) (-1805.302) [-1805.810] (-1805.173) * (-1804.261) [-1805.278] (-1804.183) (-1804.757) -- 0:01:00
359000 -- (-1804.259) (-1805.754) (-1808.314) [-1806.757] * (-1804.695) [-1805.182] (-1805.058) (-1803.974) -- 0:01:00
359500 -- [-1804.058] (-1805.854) (-1803.993) (-1807.106) * (-1803.751) (-1806.330) [-1805.348] (-1805.383) -- 0:01:00
360000 -- [-1802.543] (-1808.497) (-1805.673) (-1805.814) * (-1804.726) (-1804.191) [-1802.476] (-1803.809) -- 0:01:00
Average standard deviation of split frequencies: 0.014900
360500 -- (-1802.670) [-1803.143] (-1806.437) (-1805.589) * (-1803.894) [-1803.186] (-1802.509) (-1805.485) -- 0:01:00
361000 -- (-1803.866) (-1805.869) (-1804.048) [-1808.748] * (-1807.527) (-1804.253) [-1805.472] (-1806.849) -- 0:01:01
361500 -- (-1805.864) (-1805.313) (-1804.634) [-1806.241] * (-1805.105) (-1805.174) [-1805.913] (-1805.653) -- 0:01:01
362000 -- (-1807.238) [-1803.374] (-1805.806) (-1803.839) * [-1804.294] (-1803.401) (-1804.616) (-1804.418) -- 0:01:01
362500 -- (-1808.364) (-1806.554) [-1802.765] (-1806.320) * (-1803.864) (-1804.691) [-1804.655] (-1807.066) -- 0:01:01
363000 -- (-1806.378) [-1804.678] (-1802.274) (-1803.626) * (-1803.824) [-1805.056] (-1805.282) (-1804.992) -- 0:01:01
363500 -- (-1803.988) (-1802.658) [-1803.564] (-1809.315) * [-1804.037] (-1807.158) (-1804.767) (-1804.112) -- 0:01:01
364000 -- (-1804.685) (-1807.564) (-1802.494) [-1803.947] * (-1804.397) [-1804.771] (-1803.229) (-1807.648) -- 0:01:01
364500 -- (-1806.021) (-1804.838) (-1803.639) [-1805.305] * (-1805.618) [-1804.939] (-1803.681) (-1804.339) -- 0:01:01
365000 -- (-1807.392) [-1803.263] (-1803.978) (-1806.199) * (-1804.884) (-1806.048) [-1803.313] (-1804.746) -- 0:01:00
Average standard deviation of split frequencies: 0.015198
365500 -- (-1803.692) [-1804.684] (-1802.480) (-1805.285) * [-1804.195] (-1808.692) (-1805.007) (-1806.787) -- 0:01:00
366000 -- (-1805.318) (-1804.782) (-1809.827) [-1806.672] * [-1804.891] (-1804.530) (-1805.493) (-1807.237) -- 0:01:00
366500 -- (-1803.080) (-1804.837) (-1804.063) [-1803.982] * [-1805.702] (-1803.596) (-1809.622) (-1807.666) -- 0:01:00
367000 -- (-1806.115) [-1803.704] (-1804.600) (-1804.333) * (-1809.149) (-1804.634) (-1804.060) [-1807.226] -- 0:01:00
367500 -- [-1804.989] (-1803.400) (-1805.819) (-1809.193) * (-1806.448) [-1804.659] (-1806.098) (-1803.931) -- 0:01:00
368000 -- (-1804.990) (-1803.603) [-1804.759] (-1807.356) * (-1808.404) (-1804.676) [-1803.066] (-1803.271) -- 0:01:00
368500 -- (-1803.999) [-1804.103] (-1802.656) (-1804.166) * [-1806.147] (-1804.840) (-1804.504) (-1805.649) -- 0:00:59
369000 -- (-1803.999) (-1806.541) [-1802.929] (-1804.913) * (-1805.663) (-1803.751) (-1804.629) [-1801.779] -- 0:00:59
369500 -- (-1805.008) (-1806.608) (-1802.568) [-1802.307] * (-1805.202) (-1804.351) (-1804.714) [-1803.647] -- 0:00:59
370000 -- (-1805.957) [-1806.672] (-1804.135) (-1803.445) * (-1803.854) [-1803.770] (-1807.171) (-1803.224) -- 0:00:59
Average standard deviation of split frequencies: 0.016279
370500 -- (-1804.713) (-1806.144) (-1804.497) [-1803.436] * [-1802.126] (-1804.833) (-1805.118) (-1803.093) -- 0:00:59
371000 -- (-1805.702) (-1804.962) (-1804.482) [-1803.769] * (-1808.513) (-1803.439) [-1804.180] (-1803.788) -- 0:01:01
371500 -- [-1803.849] (-1804.656) (-1806.053) (-1805.103) * (-1804.370) (-1804.350) (-1803.249) [-1805.171] -- 0:01:00
372000 -- (-1804.796) (-1803.964) (-1804.679) [-1805.454] * (-1804.587) (-1804.485) (-1804.129) [-1801.856] -- 0:01:00
372500 -- [-1803.332] (-1803.163) (-1805.566) (-1803.804) * (-1805.269) (-1803.867) [-1805.054] (-1802.606) -- 0:01:00
373000 -- [-1805.447] (-1805.380) (-1804.126) (-1803.501) * (-1805.109) (-1804.433) (-1806.338) [-1802.113] -- 0:01:00
373500 -- (-1807.209) [-1805.328] (-1805.503) (-1804.256) * (-1804.084) (-1803.605) (-1804.615) [-1806.822] -- 0:01:00
374000 -- (-1809.467) [-1804.815] (-1806.047) (-1804.404) * [-1803.708] (-1803.250) (-1803.706) (-1806.832) -- 0:01:00
374500 -- (-1809.876) (-1803.823) [-1805.389] (-1804.239) * (-1806.762) [-1803.398] (-1805.215) (-1803.767) -- 0:01:00
375000 -- (-1806.966) [-1805.419] (-1803.206) (-1803.861) * (-1809.588) [-1804.541] (-1804.765) (-1804.270) -- 0:01:00
Average standard deviation of split frequencies: 0.016800
375500 -- (-1803.537) (-1803.008) (-1805.995) [-1806.226] * (-1805.936) (-1804.751) (-1805.504) [-1804.282] -- 0:00:59
376000 -- [-1803.372] (-1803.373) (-1807.192) (-1805.348) * (-1804.461) (-1803.600) [-1805.050] (-1802.885) -- 0:00:59
376500 -- (-1803.179) (-1803.416) [-1805.322] (-1806.970) * (-1804.661) (-1803.601) (-1806.128) [-1807.025] -- 0:00:59
377000 -- (-1801.999) [-1803.938] (-1804.250) (-1804.027) * (-1807.177) (-1804.216) [-1803.544] (-1803.783) -- 0:00:59
377500 -- (-1802.857) (-1803.901) [-1803.703] (-1802.858) * (-1805.479) [-1805.110] (-1804.067) (-1806.125) -- 0:00:59
378000 -- (-1804.924) (-1802.901) [-1803.842] (-1802.991) * (-1803.846) [-1805.077] (-1805.256) (-1805.455) -- 0:00:59
378500 -- (-1805.223) (-1806.020) [-1806.778] (-1803.132) * [-1807.242] (-1804.442) (-1804.056) (-1809.185) -- 0:00:59
379000 -- (-1806.492) (-1804.783) (-1809.435) [-1803.199] * (-1805.070) (-1804.244) (-1803.847) [-1806.446] -- 0:00:58
379500 -- (-1806.224) (-1802.891) (-1806.326) [-1804.889] * [-1805.112] (-1805.254) (-1803.524) (-1803.695) -- 0:01:00
380000 -- [-1804.390] (-1801.573) (-1806.012) (-1804.726) * [-1805.587] (-1807.541) (-1804.905) (-1803.564) -- 0:01:00
Average standard deviation of split frequencies: 0.015851
380500 -- [-1804.143] (-1804.146) (-1815.064) (-1803.060) * (-1804.862) [-1804.724] (-1808.838) (-1803.029) -- 0:01:00
381000 -- [-1805.140] (-1803.763) (-1815.483) (-1803.437) * (-1805.262) [-1809.492] (-1805.000) (-1805.938) -- 0:01:00
381500 -- (-1803.798) (-1803.560) [-1807.105] (-1802.902) * (-1803.769) (-1806.165) (-1804.992) [-1805.658] -- 0:00:59
382000 -- (-1805.127) [-1804.489] (-1804.243) (-1803.435) * [-1804.809] (-1806.831) (-1803.652) (-1806.777) -- 0:00:59
382500 -- (-1804.227) [-1805.157] (-1804.317) (-1804.246) * (-1803.012) (-1802.887) (-1805.238) [-1804.272] -- 0:00:59
383000 -- (-1805.153) (-1804.748) (-1802.758) [-1804.170] * (-1804.364) [-1804.571] (-1804.812) (-1803.559) -- 0:00:59
383500 -- (-1803.660) [-1802.906] (-1805.938) (-1803.354) * (-1804.303) (-1805.849) (-1804.219) [-1805.624] -- 0:00:59
384000 -- (-1803.447) (-1805.981) [-1805.391] (-1804.516) * (-1803.326) [-1804.558] (-1804.834) (-1803.336) -- 0:00:59
384500 -- (-1803.827) (-1803.480) [-1804.306] (-1807.581) * (-1803.925) (-1803.762) (-1805.390) [-1804.322] -- 0:00:59
385000 -- [-1804.199] (-1809.203) (-1805.287) (-1804.831) * [-1803.845] (-1804.954) (-1803.998) (-1804.521) -- 0:00:59
Average standard deviation of split frequencies: 0.016121
385500 -- (-1804.561) [-1803.299] (-1809.424) (-1803.101) * (-1806.476) (-1808.198) [-1807.314] (-1805.513) -- 0:00:58
386000 -- (-1809.404) (-1805.240) (-1804.897) [-1803.095] * (-1809.206) (-1804.721) (-1804.575) [-1804.147] -- 0:00:58
386500 -- (-1810.786) (-1803.968) (-1802.994) [-1803.794] * (-1807.713) (-1804.061) (-1803.607) [-1803.945] -- 0:00:58
387000 -- (-1807.601) (-1805.467) [-1803.571] (-1804.541) * (-1806.219) (-1803.797) (-1803.694) [-1804.195] -- 0:00:58
387500 -- [-1804.267] (-1805.055) (-1806.437) (-1804.911) * (-1808.901) (-1803.530) (-1806.500) [-1803.924] -- 0:00:58
388000 -- [-1803.459] (-1807.718) (-1807.007) (-1805.452) * (-1804.182) [-1805.867] (-1804.270) (-1803.673) -- 0:00:58
388500 -- (-1804.343) [-1806.090] (-1804.287) (-1805.337) * (-1807.926) (-1807.668) (-1802.809) [-1803.015] -- 0:00:59
389000 -- (-1804.334) [-1803.419] (-1803.072) (-1803.692) * (-1803.979) (-1806.884) (-1804.715) [-1803.344] -- 0:00:59
389500 -- (-1806.232) (-1805.289) [-1809.217] (-1804.772) * (-1803.745) (-1803.731) (-1804.952) [-1804.091] -- 0:00:59
390000 -- (-1803.654) (-1803.502) (-1808.403) [-1804.905] * (-1803.161) (-1805.053) (-1804.224) [-1806.316] -- 0:00:59
Average standard deviation of split frequencies: 0.016411
390500 -- (-1804.310) (-1805.300) (-1805.883) [-1804.847] * [-1804.439] (-1804.067) (-1805.093) (-1806.584) -- 0:00:59
391000 -- (-1804.696) [-1803.552] (-1803.795) (-1806.251) * [-1803.687] (-1807.071) (-1804.019) (-1805.405) -- 0:00:59
391500 -- [-1803.747] (-1805.720) (-1802.815) (-1809.579) * (-1806.830) (-1804.794) [-1803.566] (-1803.922) -- 0:00:59
392000 -- (-1802.847) (-1805.773) [-1803.323] (-1804.911) * (-1804.939) (-1803.634) [-1803.429] (-1805.776) -- 0:00:58
392500 -- (-1803.052) (-1806.044) (-1803.512) [-1804.903] * [-1804.122] (-1803.259) (-1802.996) (-1803.743) -- 0:00:58
393000 -- (-1804.347) (-1804.573) [-1803.276] (-1808.487) * [-1803.223] (-1807.301) (-1804.871) (-1804.944) -- 0:00:58
393500 -- (-1806.920) (-1804.684) (-1804.226) [-1811.762] * (-1805.633) [-1807.898] (-1804.173) (-1804.248) -- 0:00:58
394000 -- (-1806.521) (-1807.349) [-1803.871] (-1811.400) * [-1803.592] (-1803.940) (-1805.194) (-1809.808) -- 0:00:58
394500 -- (-1804.326) (-1810.911) [-1805.933] (-1805.411) * (-1806.042) (-1804.931) (-1804.828) [-1805.472] -- 0:00:58
395000 -- [-1804.202] (-1811.755) (-1802.335) (-1804.360) * (-1804.733) [-1803.506] (-1805.875) (-1804.495) -- 0:00:58
Average standard deviation of split frequencies: 0.016190
395500 -- (-1806.983) (-1805.593) [-1802.607] (-1806.221) * (-1807.524) (-1802.838) [-1803.822] (-1804.470) -- 0:00:58
396000 -- (-1805.616) (-1804.457) (-1803.475) [-1803.595] * (-1805.864) (-1807.438) [-1803.105] (-1805.977) -- 0:00:57
396500 -- (-1803.311) [-1803.422] (-1804.145) (-1803.377) * (-1803.518) (-1809.825) [-1803.701] (-1803.699) -- 0:00:57
397000 -- (-1806.051) (-1806.915) (-1803.393) [-1803.767] * (-1804.420) (-1808.623) [-1804.980] (-1803.342) -- 0:00:57
397500 -- (-1805.406) [-1805.250] (-1803.107) (-1804.206) * (-1805.330) (-1803.653) [-1806.112] (-1805.322) -- 0:00:59
398000 -- (-1804.219) (-1804.170) (-1805.003) [-1806.080] * [-1805.204] (-1806.417) (-1804.376) (-1803.964) -- 0:00:58
398500 -- (-1802.229) [-1805.801] (-1808.149) (-1803.660) * (-1805.034) (-1805.928) [-1803.778] (-1805.464) -- 0:00:58
399000 -- [-1803.265] (-1805.400) (-1805.836) (-1802.827) * (-1804.792) (-1805.649) (-1803.666) [-1807.991] -- 0:00:58
399500 -- (-1806.227) (-1805.872) (-1802.681) [-1806.225] * (-1803.623) (-1803.874) [-1803.128] (-1803.426) -- 0:00:58
400000 -- (-1804.959) (-1803.572) (-1806.935) [-1805.593] * (-1803.759) [-1802.643] (-1802.257) (-1808.819) -- 0:00:58
Average standard deviation of split frequencies: 0.014354
400500 -- (-1804.613) (-1803.293) [-1803.246] (-1806.547) * [-1803.823] (-1804.019) (-1803.100) (-1805.370) -- 0:00:58
401000 -- (-1805.543) (-1804.389) (-1804.006) [-1805.029] * (-1804.045) [-1803.833] (-1804.358) (-1803.560) -- 0:00:58
401500 -- (-1802.931) [-1803.543] (-1806.023) (-1806.476) * (-1806.646) (-1805.801) [-1805.950] (-1804.917) -- 0:00:58
402000 -- (-1805.862) [-1805.728] (-1809.719) (-1805.854) * (-1804.547) (-1803.753) (-1805.473) [-1803.767] -- 0:00:58
402500 -- (-1803.382) (-1807.358) [-1809.691] (-1806.391) * (-1804.055) (-1803.908) [-1806.889] (-1807.223) -- 0:00:57
403000 -- [-1803.704] (-1805.001) (-1808.952) (-1805.850) * (-1803.560) (-1805.212) (-1806.576) [-1802.423] -- 0:00:57
403500 -- (-1805.013) (-1802.851) (-1803.350) [-1803.980] * (-1803.992) [-1803.088] (-1802.954) (-1804.543) -- 0:00:57
404000 -- (-1807.625) (-1803.751) (-1802.897) [-1803.481] * (-1804.522) (-1805.155) (-1806.143) [-1805.351] -- 0:00:57
404500 -- (-1803.518) (-1803.792) [-1803.413] (-1805.399) * (-1804.888) (-1806.039) (-1805.433) [-1805.985] -- 0:00:57
405000 -- [-1802.585] (-1807.577) (-1803.611) (-1803.128) * (-1805.264) (-1802.656) [-1804.119] (-1807.066) -- 0:00:57
Average standard deviation of split frequencies: 0.014398
405500 -- (-1804.352) [-1804.090] (-1805.095) (-1804.007) * (-1803.979) (-1805.517) [-1803.003] (-1804.044) -- 0:00:57
406000 -- (-1804.658) (-1804.472) (-1807.978) [-1805.960] * (-1803.152) (-1805.017) [-1803.001] (-1804.979) -- 0:00:57
406500 -- (-1803.304) [-1806.311] (-1803.322) (-1806.605) * (-1804.358) (-1806.855) [-1805.475] (-1805.720) -- 0:00:58
407000 -- (-1804.596) (-1806.340) [-1803.248] (-1805.330) * (-1802.633) (-1803.728) (-1804.667) [-1804.857] -- 0:00:58
407500 -- (-1805.541) (-1807.542) [-1805.665] (-1805.452) * (-1804.020) [-1803.393] (-1807.489) (-1803.559) -- 0:00:58
408000 -- [-1806.329] (-1807.586) (-1804.805) (-1805.210) * (-1803.260) (-1803.744) [-1806.241] (-1804.165) -- 0:00:58
408500 -- (-1806.780) (-1808.154) (-1803.253) [-1804.904] * (-1802.773) (-1803.689) [-1805.260] (-1803.185) -- 0:00:57
409000 -- (-1806.145) (-1804.106) (-1803.423) [-1803.832] * (-1804.494) (-1805.284) [-1803.127] (-1803.651) -- 0:00:57
409500 -- (-1803.445) (-1806.794) (-1803.817) [-1802.666] * (-1805.251) (-1805.237) [-1804.775] (-1803.576) -- 0:00:57
410000 -- (-1804.071) [-1811.671] (-1802.964) (-1804.241) * (-1803.574) [-1803.053] (-1803.516) (-1802.784) -- 0:00:57
Average standard deviation of split frequencies: 0.014464
410500 -- (-1804.620) (-1805.913) [-1803.732] (-1803.372) * (-1803.688) (-1806.222) [-1803.987] (-1803.410) -- 0:00:57
411000 -- (-1803.775) (-1807.319) [-1803.318] (-1804.155) * (-1805.048) [-1804.117] (-1805.549) (-1804.731) -- 0:00:57
411500 -- (-1802.505) [-1802.730] (-1806.033) (-1805.414) * (-1802.732) (-1804.171) [-1803.021] (-1804.125) -- 0:00:57
412000 -- [-1803.166] (-1802.596) (-1807.197) (-1803.591) * (-1802.779) [-1802.687] (-1803.692) (-1804.410) -- 0:00:57
412500 -- (-1807.589) (-1802.978) [-1804.667] (-1804.963) * [-1803.224] (-1804.421) (-1803.202) (-1804.839) -- 0:00:56
413000 -- (-1804.603) [-1804.831] (-1804.983) (-1805.046) * [-1802.310] (-1802.453) (-1803.300) (-1808.071) -- 0:00:56
413500 -- (-1803.484) (-1803.965) [-1804.597] (-1803.680) * (-1808.425) (-1804.456) [-1804.546] (-1805.194) -- 0:00:56
414000 -- (-1805.076) (-1804.438) (-1804.299) [-1804.306] * (-1803.058) (-1805.274) [-1803.442] (-1804.558) -- 0:00:56
414500 -- (-1803.814) (-1803.565) [-1804.489] (-1804.411) * (-1804.375) (-1803.122) [-1804.378] (-1803.979) -- 0:00:56
415000 -- [-1804.195] (-1803.400) (-1805.139) (-1808.552) * (-1805.541) (-1803.348) (-1805.097) [-1806.322] -- 0:00:56
Average standard deviation of split frequencies: 0.014958
415500 -- (-1804.232) [-1803.480] (-1803.263) (-1803.670) * (-1805.304) (-1804.814) [-1802.349] (-1806.707) -- 0:00:57
416000 -- (-1804.375) [-1803.304] (-1803.908) (-1805.066) * (-1802.795) (-1806.943) (-1806.493) [-1803.679] -- 0:00:57
416500 -- (-1804.552) (-1805.205) [-1803.814] (-1803.383) * (-1803.245) [-1806.878] (-1804.701) (-1804.419) -- 0:00:57
417000 -- (-1803.460) [-1805.875] (-1804.563) (-1802.928) * (-1805.734) (-1808.508) (-1805.052) [-1803.543] -- 0:00:57
417500 -- (-1803.194) (-1804.675) [-1804.697] (-1802.971) * (-1807.141) [-1804.761] (-1806.450) (-1804.634) -- 0:00:57
418000 -- (-1803.553) [-1803.412] (-1806.279) (-1805.593) * (-1803.989) [-1805.031] (-1805.046) (-1804.304) -- 0:00:57
418500 -- (-1803.387) [-1807.431] (-1804.370) (-1802.631) * (-1808.471) (-1808.949) (-1807.349) [-1804.455] -- 0:00:56
419000 -- (-1805.398) (-1802.702) [-1805.535] (-1802.068) * (-1803.738) (-1808.612) (-1806.031) [-1805.349] -- 0:00:56
419500 -- [-1803.166] (-1802.957) (-1803.997) (-1803.702) * [-1803.929] (-1805.354) (-1803.047) (-1808.214) -- 0:00:56
420000 -- (-1803.857) (-1805.728) [-1803.841] (-1804.122) * (-1803.325) [-1804.609] (-1802.941) (-1804.166) -- 0:00:56
Average standard deviation of split frequencies: 0.013896
420500 -- (-1803.674) [-1806.847] (-1807.030) (-1806.134) * (-1802.796) [-1804.840] (-1807.319) (-1804.647) -- 0:00:56
421000 -- [-1806.163] (-1804.315) (-1807.959) (-1803.632) * (-1803.701) [-1803.154] (-1803.793) (-1804.532) -- 0:00:56
421500 -- (-1804.091) (-1803.883) (-1805.056) [-1804.687] * [-1807.938] (-1804.128) (-1803.101) (-1803.245) -- 0:00:56
422000 -- (-1803.845) [-1804.524] (-1804.381) (-1803.381) * (-1803.392) [-1803.341] (-1805.868) (-1803.278) -- 0:00:56
422500 -- (-1804.084) [-1805.193] (-1804.950) (-1803.148) * (-1809.757) [-1803.376] (-1806.126) (-1803.293) -- 0:00:56
423000 -- (-1804.316) (-1803.696) [-1803.583] (-1804.422) * (-1809.959) (-1803.404) (-1804.754) [-1803.629] -- 0:00:55
423500 -- [-1805.821] (-1806.046) (-1804.014) (-1806.731) * (-1805.533) (-1803.491) [-1805.742] (-1808.070) -- 0:00:55
424000 -- (-1804.572) [-1802.655] (-1803.334) (-1802.704) * (-1804.058) (-1804.642) (-1806.053) [-1804.260] -- 0:00:55
424500 -- [-1805.605] (-1802.737) (-1803.017) (-1803.657) * [-1804.210] (-1803.549) (-1806.409) (-1803.178) -- 0:00:55
425000 -- (-1806.742) [-1802.841] (-1803.524) (-1803.848) * (-1802.993) (-1804.059) [-1805.638] (-1804.258) -- 0:00:55
Average standard deviation of split frequencies: 0.015050
425500 -- (-1810.091) (-1805.607) (-1806.688) [-1803.949] * (-1805.632) (-1810.168) (-1805.076) [-1805.849] -- 0:00:56
426000 -- (-1807.868) (-1807.223) (-1808.510) [-1802.387] * (-1806.710) (-1804.627) (-1810.099) [-1805.063] -- 0:00:56
426500 -- (-1804.014) [-1802.449] (-1810.253) (-1805.401) * (-1806.538) (-1805.106) (-1802.704) [-1808.881] -- 0:00:56
427000 -- (-1804.484) (-1807.653) [-1805.937] (-1803.426) * (-1807.068) (-1806.963) [-1803.752] (-1803.337) -- 0:00:56
427500 -- (-1804.671) (-1802.512) (-1805.081) [-1803.677] * (-1803.290) [-1808.169] (-1804.825) (-1804.097) -- 0:00:56
428000 -- (-1803.227) (-1805.008) [-1803.066] (-1802.857) * (-1806.100) (-1807.395) [-1802.990] (-1803.911) -- 0:00:56
428500 -- [-1806.684] (-1803.573) (-1804.888) (-1802.513) * (-1804.460) (-1809.706) [-1804.795] (-1803.593) -- 0:00:56
429000 -- (-1803.413) [-1804.144] (-1804.238) (-1804.094) * (-1803.113) (-1804.682) [-1803.761] (-1805.142) -- 0:00:55
429500 -- (-1807.853) (-1804.115) (-1806.528) [-1806.735] * (-1804.750) (-1804.247) [-1805.238] (-1804.764) -- 0:00:55
430000 -- (-1806.114) (-1805.836) [-1804.767] (-1803.349) * (-1808.359) (-1804.281) [-1805.465] (-1803.488) -- 0:00:55
Average standard deviation of split frequencies: 0.014886
430500 -- [-1808.415] (-1806.046) (-1805.690) (-1802.921) * (-1809.639) [-1803.621] (-1804.270) (-1805.976) -- 0:00:55
431000 -- (-1806.139) [-1804.168] (-1804.447) (-1803.092) * (-1807.906) (-1804.197) (-1804.883) [-1805.542] -- 0:00:55
431500 -- (-1803.487) [-1806.289] (-1803.021) (-1803.238) * (-1804.364) (-1804.582) (-1804.772) [-1805.724] -- 0:00:55
432000 -- (-1807.256) (-1804.953) (-1807.192) [-1803.050] * (-1803.580) [-1803.746] (-1804.616) (-1804.811) -- 0:00:55
432500 -- [-1803.159] (-1803.960) (-1805.600) (-1803.594) * (-1803.987) [-1805.080] (-1806.496) (-1804.892) -- 0:00:55
433000 -- [-1803.003] (-1803.738) (-1804.668) (-1804.096) * (-1803.514) [-1806.747] (-1806.451) (-1805.893) -- 0:00:54
433500 -- [-1802.599] (-1803.558) (-1806.369) (-1802.759) * (-1805.400) (-1805.097) [-1804.944] (-1807.581) -- 0:00:54
434000 -- (-1803.453) (-1803.797) (-1803.943) [-1804.659] * (-1805.924) [-1803.924] (-1805.147) (-1803.888) -- 0:00:54
434500 -- (-1803.416) (-1810.254) [-1802.161] (-1803.961) * (-1803.761) [-1804.377] (-1808.838) (-1803.227) -- 0:00:54
435000 -- (-1804.584) [-1805.758] (-1806.286) (-1805.730) * [-1804.262] (-1806.139) (-1806.224) (-1803.183) -- 0:00:54
Average standard deviation of split frequencies: 0.014704
435500 -- [-1805.999] (-1805.946) (-1803.503) (-1807.387) * [-1804.766] (-1803.417) (-1805.896) (-1804.109) -- 0:00:54
436000 -- [-1803.929] (-1802.971) (-1803.363) (-1807.412) * (-1804.266) (-1804.711) (-1805.461) [-1803.741] -- 0:00:55
436500 -- (-1805.484) (-1803.630) (-1804.018) [-1803.100] * (-1807.873) [-1805.442] (-1803.676) (-1805.155) -- 0:00:55
437000 -- (-1806.345) (-1805.028) (-1804.701) [-1804.165] * (-1805.911) [-1804.612] (-1803.205) (-1805.215) -- 0:00:55
437500 -- (-1803.947) (-1804.028) (-1804.317) [-1803.048] * (-1805.918) (-1803.475) (-1805.112) [-1805.535] -- 0:00:55
438000 -- (-1805.603) (-1805.533) (-1808.425) [-1804.646] * [-1804.177] (-1805.227) (-1803.501) (-1804.073) -- 0:00:55
438500 -- (-1805.161) (-1809.078) [-1804.991] (-1806.418) * (-1808.387) (-1803.326) (-1804.320) [-1802.679] -- 0:00:55
439000 -- (-1804.498) (-1804.578) [-1809.545] (-1805.746) * (-1803.780) (-1804.401) (-1805.090) [-1802.814] -- 0:00:54
439500 -- (-1804.340) (-1806.141) [-1807.474] (-1805.784) * (-1803.681) (-1807.138) (-1802.684) [-1802.650] -- 0:00:54
440000 -- (-1807.376) (-1803.552) [-1804.592] (-1803.405) * (-1804.358) (-1806.944) [-1804.240] (-1803.402) -- 0:00:54
Average standard deviation of split frequencies: 0.013479
440500 -- (-1805.474) (-1803.575) [-1805.549] (-1803.926) * (-1804.553) (-1804.002) (-1803.669) [-1803.570] -- 0:00:54
441000 -- [-1805.291] (-1806.013) (-1806.552) (-1805.673) * (-1806.489) [-1805.235] (-1805.016) (-1803.443) -- 0:00:54
441500 -- [-1804.797] (-1803.729) (-1806.180) (-1804.352) * [-1804.428] (-1803.540) (-1806.826) (-1803.355) -- 0:00:54
442000 -- (-1803.626) [-1803.241] (-1806.108) (-1805.160) * (-1806.599) (-1803.458) (-1803.990) [-1803.857] -- 0:00:54
442500 -- (-1803.532) (-1803.791) [-1803.510] (-1804.157) * (-1803.547) (-1802.681) (-1805.914) [-1802.372] -- 0:00:54
443000 -- [-1803.169] (-1804.371) (-1802.642) (-1804.016) * (-1803.581) [-1805.244] (-1807.634) (-1803.228) -- 0:00:54
443500 -- (-1804.168) [-1803.898] (-1809.429) (-1808.164) * (-1807.462) (-1805.297) (-1805.786) [-1806.472] -- 0:00:53
444000 -- (-1803.498) (-1803.202) [-1803.451] (-1803.855) * (-1806.435) (-1804.225) [-1805.180] (-1803.953) -- 0:00:53
444500 -- (-1804.594) (-1803.950) (-1804.236) [-1804.297] * [-1804.291] (-1803.727) (-1805.016) (-1804.820) -- 0:00:53
445000 -- [-1806.342] (-1804.823) (-1803.623) (-1803.232) * [-1805.591] (-1803.998) (-1804.020) (-1806.515) -- 0:00:53
Average standard deviation of split frequencies: 0.013106
445500 -- (-1805.952) (-1804.720) [-1803.141] (-1804.852) * [-1804.436] (-1809.568) (-1805.684) (-1805.703) -- 0:00:53
446000 -- (-1805.406) [-1809.346] (-1807.186) (-1805.122) * (-1806.588) (-1803.677) [-1805.742] (-1802.797) -- 0:00:53
446500 -- (-1804.637) [-1803.375] (-1803.148) (-1804.875) * (-1808.284) [-1804.785] (-1804.650) (-1803.847) -- 0:00:53
447000 -- [-1803.548] (-1803.712) (-1803.428) (-1806.172) * (-1805.016) (-1803.830) (-1805.409) [-1804.342] -- 0:00:54
447500 -- (-1807.109) [-1805.847] (-1802.889) (-1803.959) * (-1803.451) [-1804.456] (-1802.848) (-1803.536) -- 0:00:54
448000 -- [-1804.978] (-1805.453) (-1803.721) (-1805.115) * (-1805.705) (-1805.096) [-1805.619] (-1803.929) -- 0:00:54
448500 -- (-1803.915) (-1804.718) (-1806.036) [-1802.805] * (-1803.399) [-1805.063] (-1806.761) (-1803.565) -- 0:00:54
449000 -- [-1802.902] (-1803.421) (-1804.837) (-1804.917) * [-1805.558] (-1805.131) (-1807.194) (-1805.218) -- 0:00:53
449500 -- (-1803.141) (-1803.650) (-1803.859) [-1804.215] * (-1803.691) (-1805.872) [-1807.286] (-1804.635) -- 0:00:53
450000 -- [-1803.433] (-1803.826) (-1805.288) (-1805.450) * (-1805.142) (-1803.691) (-1805.978) [-1805.532] -- 0:00:53
Average standard deviation of split frequencies: 0.013389
450500 -- (-1807.654) (-1804.294) [-1804.070] (-1805.589) * [-1807.291] (-1803.621) (-1804.531) (-1805.829) -- 0:00:53
451000 -- (-1803.361) (-1804.155) [-1804.370] (-1803.439) * (-1804.794) (-1805.671) [-1803.989] (-1805.964) -- 0:00:53
451500 -- (-1804.310) (-1805.014) [-1806.477] (-1803.948) * (-1803.107) (-1808.512) (-1803.442) [-1805.552] -- 0:00:53
452000 -- (-1803.407) (-1803.206) (-1804.647) [-1804.552] * (-1803.232) (-1807.575) (-1807.932) [-1802.774] -- 0:00:53
452500 -- (-1803.887) (-1804.237) (-1813.082) [-1803.352] * (-1803.585) (-1803.871) (-1807.120) [-1803.236] -- 0:00:53
453000 -- [-1804.790] (-1803.951) (-1803.656) (-1803.742) * (-1803.409) (-1804.956) (-1814.238) [-1803.744] -- 0:00:53
453500 -- [-1805.136] (-1805.990) (-1807.319) (-1804.337) * [-1805.604] (-1804.724) (-1805.301) (-1805.635) -- 0:00:53
454000 -- (-1804.853) [-1806.684] (-1806.001) (-1803.359) * (-1804.848) (-1804.522) [-1805.132] (-1806.982) -- 0:00:52
454500 -- (-1805.472) [-1806.928] (-1806.025) (-1803.029) * [-1805.971] (-1803.639) (-1804.517) (-1804.623) -- 0:00:52
455000 -- (-1803.317) [-1808.448] (-1804.141) (-1803.660) * (-1806.836) (-1804.848) (-1804.421) [-1805.548] -- 0:00:52
Average standard deviation of split frequencies: 0.013232
455500 -- (-1803.244) (-1803.874) [-1802.893] (-1803.331) * (-1809.657) (-1803.790) (-1803.325) [-1803.622] -- 0:00:52
456000 -- (-1804.867) (-1804.095) [-1803.357] (-1802.245) * [-1806.636] (-1804.978) (-1805.243) (-1804.653) -- 0:00:52
456500 -- (-1809.000) (-1805.026) (-1804.435) [-1803.875] * (-1808.983) (-1804.856) [-1802.999] (-1806.428) -- 0:00:52
457000 -- (-1810.065) (-1804.176) (-1805.618) [-1804.799] * (-1807.950) (-1803.905) (-1803.284) [-1802.769] -- 0:00:52
457500 -- [-1806.975] (-1802.844) (-1804.951) (-1804.442) * (-1808.469) (-1804.470) [-1802.426] (-1805.381) -- 0:00:53
458000 -- (-1806.486) (-1802.130) (-1804.480) [-1803.507] * (-1803.904) (-1806.818) [-1803.001] (-1807.185) -- 0:00:53
458500 -- (-1808.241) (-1802.288) (-1805.114) [-1806.071] * (-1803.515) [-1803.924] (-1806.256) (-1813.315) -- 0:00:53
459000 -- (-1806.621) [-1802.885] (-1805.734) (-1804.036) * [-1803.146] (-1807.058) (-1803.758) (-1810.012) -- 0:00:53
459500 -- (-1804.559) (-1803.886) [-1805.940] (-1806.041) * (-1805.024) [-1804.642] (-1806.815) (-1803.194) -- 0:00:52
460000 -- [-1803.835] (-1804.948) (-1805.478) (-1804.734) * (-1808.321) [-1805.929] (-1806.696) (-1802.643) -- 0:00:52
Average standard deviation of split frequencies: 0.012484
460500 -- (-1804.262) (-1805.791) [-1803.945] (-1802.117) * (-1805.070) (-1804.320) [-1805.114] (-1806.759) -- 0:00:52
461000 -- (-1803.689) (-1804.373) (-1803.490) [-1803.978] * (-1806.048) [-1803.999] (-1806.997) (-1804.934) -- 0:00:52
461500 -- [-1801.900] (-1811.997) (-1803.610) (-1805.282) * (-1804.891) (-1803.079) [-1804.668] (-1804.667) -- 0:00:52
462000 -- (-1804.659) (-1807.493) [-1802.836] (-1810.408) * (-1803.370) (-1802.850) (-1808.822) [-1803.931] -- 0:00:52
462500 -- (-1804.390) [-1802.706] (-1804.162) (-1806.325) * (-1803.884) [-1805.815] (-1802.636) (-1805.177) -- 0:00:52
463000 -- (-1805.928) [-1805.428] (-1807.398) (-1803.077) * (-1804.902) [-1802.993] (-1803.309) (-1804.838) -- 0:00:52
463500 -- [-1806.587] (-1804.283) (-1805.779) (-1811.146) * (-1805.193) (-1804.171) [-1805.349] (-1805.760) -- 0:00:52
464000 -- (-1805.537) (-1804.296) (-1807.044) [-1804.684] * (-1803.294) [-1803.367] (-1803.846) (-1803.490) -- 0:00:51
464500 -- (-1803.788) (-1805.216) [-1803.801] (-1805.930) * [-1804.449] (-1804.726) (-1803.535) (-1804.151) -- 0:00:51
465000 -- [-1803.144] (-1807.644) (-1804.965) (-1805.618) * [-1804.482] (-1804.658) (-1805.576) (-1803.314) -- 0:00:51
Average standard deviation of split frequencies: 0.012341
465500 -- [-1804.075] (-1804.677) (-1804.476) (-1804.094) * [-1803.972] (-1805.818) (-1805.663) (-1803.366) -- 0:00:51
466000 -- (-1803.160) [-1803.481] (-1806.842) (-1806.320) * (-1803.343) (-1803.931) (-1807.104) [-1803.384] -- 0:00:51
466500 -- [-1804.613] (-1812.114) (-1803.294) (-1803.991) * (-1803.745) (-1803.787) (-1805.446) [-1804.866] -- 0:00:51
467000 -- (-1804.371) (-1804.413) [-1803.915] (-1804.246) * (-1804.326) [-1804.128] (-1804.321) (-1802.822) -- 0:00:51
467500 -- (-1805.262) [-1805.280] (-1808.608) (-1804.824) * [-1803.457] (-1803.283) (-1806.159) (-1804.199) -- 0:00:51
468000 -- (-1802.458) [-1802.846] (-1803.975) (-1804.022) * [-1804.414] (-1805.301) (-1805.376) (-1803.871) -- 0:00:51
468500 -- (-1805.379) (-1810.442) [-1805.202] (-1803.075) * [-1804.012] (-1804.504) (-1805.285) (-1805.322) -- 0:00:52
469000 -- (-1806.491) [-1803.516] (-1805.008) (-1809.562) * (-1806.768) (-1806.907) [-1805.700] (-1803.717) -- 0:00:52
469500 -- (-1809.419) (-1803.407) (-1805.389) [-1803.897] * (-1803.188) (-1803.038) [-1805.239] (-1804.710) -- 0:00:51
470000 -- (-1805.586) (-1802.218) (-1806.467) [-1803.345] * [-1804.092] (-1805.366) (-1803.376) (-1809.916) -- 0:00:51
Average standard deviation of split frequencies: 0.012620
470500 -- [-1802.897] (-1808.593) (-1805.913) (-1806.298) * [-1805.280] (-1808.375) (-1803.914) (-1806.745) -- 0:00:51
471000 -- (-1802.520) (-1806.791) [-1806.393] (-1804.680) * (-1802.908) (-1804.988) (-1806.589) [-1805.931] -- 0:00:51
471500 -- (-1807.049) (-1804.747) [-1806.776] (-1805.125) * (-1804.106) (-1804.164) [-1804.227] (-1807.548) -- 0:00:51
472000 -- (-1805.966) (-1804.474) [-1803.855] (-1804.657) * (-1803.300) (-1804.907) [-1803.110] (-1803.557) -- 0:00:51
472500 -- (-1802.843) [-1804.506] (-1805.418) (-1809.469) * [-1802.929] (-1805.242) (-1803.198) (-1803.426) -- 0:00:51
473000 -- [-1806.514] (-1802.848) (-1806.747) (-1803.319) * (-1806.858) [-1805.979] (-1804.351) (-1805.079) -- 0:00:51
473500 -- (-1809.832) [-1804.209] (-1806.189) (-1803.585) * (-1804.163) (-1805.015) [-1802.683] (-1807.382) -- 0:00:51
474000 -- (-1803.940) (-1804.071) (-1803.318) [-1803.683] * (-1806.798) [-1805.468] (-1805.765) (-1806.937) -- 0:00:51
474500 -- [-1803.666] (-1803.968) (-1802.583) (-1807.053) * (-1806.388) (-1802.893) [-1808.276] (-1802.938) -- 0:00:50
475000 -- (-1804.873) [-1803.795] (-1803.647) (-1803.454) * (-1804.423) (-1803.219) [-1805.285] (-1803.231) -- 0:00:50
Average standard deviation of split frequencies: 0.011884
475500 -- (-1805.219) (-1805.894) [-1802.992] (-1803.158) * (-1804.484) [-1807.357] (-1804.509) (-1806.212) -- 0:00:50
476000 -- (-1805.462) [-1805.136] (-1802.737) (-1802.731) * (-1802.873) [-1803.591] (-1805.324) (-1805.597) -- 0:00:50
476500 -- (-1803.224) (-1804.079) [-1802.484] (-1803.400) * (-1804.482) (-1803.216) [-1806.524] (-1804.859) -- 0:00:50
477000 -- (-1806.508) [-1803.578] (-1804.780) (-1803.001) * [-1805.724] (-1802.944) (-1804.715) (-1805.246) -- 0:00:50
477500 -- (-1808.239) (-1803.280) (-1805.923) [-1803.161] * (-1806.187) (-1804.835) (-1803.141) [-1804.485] -- 0:00:50
478000 -- (-1808.045) (-1803.470) [-1807.540] (-1804.631) * (-1804.982) (-1804.291) (-1803.310) [-1805.760] -- 0:00:50
478500 -- (-1806.761) (-1805.306) (-1802.927) [-1808.285] * (-1804.130) [-1805.845] (-1806.131) (-1805.510) -- 0:00:50
479000 -- (-1806.355) (-1805.986) [-1802.656] (-1803.735) * (-1803.867) (-1803.752) (-1809.220) [-1805.282] -- 0:00:50
479500 -- (-1805.562) (-1806.342) [-1804.134] (-1804.364) * [-1802.610] (-1803.751) (-1804.726) (-1805.692) -- 0:00:51
480000 -- (-1805.866) [-1805.005] (-1805.364) (-1804.122) * (-1807.263) (-1803.334) (-1804.888) [-1803.762] -- 0:00:50
Average standard deviation of split frequencies: 0.010200
480500 -- (-1805.952) [-1803.298] (-1811.043) (-1803.161) * (-1809.438) [-1803.825] (-1803.434) (-1804.948) -- 0:00:50
481000 -- (-1805.542) (-1803.137) (-1805.397) [-1802.718] * (-1807.430) [-1807.717] (-1804.888) (-1809.525) -- 0:00:50
481500 -- (-1804.168) (-1802.546) (-1807.568) [-1802.781] * (-1803.982) (-1804.191) [-1803.912] (-1810.395) -- 0:00:50
482000 -- (-1805.184) (-1805.973) (-1806.613) [-1804.238] * [-1805.705] (-1805.080) (-1804.022) (-1805.908) -- 0:00:50
482500 -- [-1805.001] (-1807.002) (-1804.647) (-1803.453) * (-1806.295) (-1804.758) [-1805.421] (-1804.175) -- 0:00:50
483000 -- (-1805.141) (-1805.038) (-1805.367) [-1804.564] * (-1805.397) (-1803.639) [-1804.987] (-1805.233) -- 0:00:50
483500 -- [-1804.923] (-1805.795) (-1805.721) (-1805.364) * (-1803.766) [-1803.497] (-1802.525) (-1808.765) -- 0:00:50
484000 -- (-1805.210) (-1803.150) (-1803.269) [-1804.353] * (-1805.068) [-1803.436] (-1804.314) (-1808.601) -- 0:00:50
484500 -- (-1805.449) [-1807.445] (-1806.163) (-1804.271) * (-1803.918) (-1804.200) [-1805.098] (-1807.676) -- 0:00:50
485000 -- (-1802.871) (-1806.651) [-1806.149] (-1803.666) * (-1805.044) (-1807.482) (-1804.673) [-1811.714] -- 0:00:49
Average standard deviation of split frequencies: 0.010282
485500 -- [-1803.205] (-1804.094) (-1806.628) (-1804.290) * [-1808.631] (-1803.780) (-1803.193) (-1804.443) -- 0:00:49
486000 -- [-1804.465] (-1804.359) (-1804.623) (-1803.355) * [-1804.883] (-1803.381) (-1805.729) (-1806.941) -- 0:00:49
486500 -- [-1804.204] (-1807.638) (-1805.357) (-1804.208) * (-1804.185) (-1803.386) (-1804.417) [-1803.191] -- 0:00:49
487000 -- (-1803.564) [-1807.564] (-1804.170) (-1802.546) * (-1804.173) [-1807.214] (-1804.102) (-1804.284) -- 0:00:49
487500 -- (-1802.253) (-1804.559) (-1804.992) [-1803.028] * (-1804.748) [-1806.419] (-1805.846) (-1803.938) -- 0:00:49
488000 -- (-1806.264) (-1803.917) [-1806.130] (-1803.847) * (-1808.014) [-1804.012] (-1803.452) (-1804.107) -- 0:00:49
488500 -- (-1805.430) [-1803.015] (-1804.123) (-1803.080) * [-1806.811] (-1813.643) (-1804.959) (-1806.281) -- 0:00:49
489000 -- (-1807.836) (-1806.177) (-1803.906) [-1803.901] * [-1805.227] (-1807.703) (-1803.743) (-1804.234) -- 0:00:49
489500 -- [-1806.266] (-1808.761) (-1806.376) (-1803.802) * (-1806.489) [-1808.072] (-1803.323) (-1806.780) -- 0:00:49
490000 -- (-1805.988) (-1807.187) (-1804.266) [-1803.688] * (-1808.798) (-1806.955) [-1803.543] (-1804.194) -- 0:00:49
Average standard deviation of split frequencies: 0.010952
490500 -- (-1802.922) [-1809.980] (-1805.589) (-1802.526) * (-1808.312) (-1809.918) [-1803.812] (-1804.151) -- 0:00:49
491000 -- (-1805.047) (-1805.059) [-1804.231] (-1803.410) * (-1804.710) [-1806.964] (-1803.643) (-1803.480) -- 0:00:49
491500 -- [-1806.533] (-1803.495) (-1804.025) (-1806.020) * [-1802.022] (-1805.747) (-1803.599) (-1808.099) -- 0:00:49
492000 -- [-1804.760] (-1805.281) (-1803.121) (-1804.230) * (-1802.621) (-1805.747) [-1803.317] (-1802.457) -- 0:00:49
492500 -- [-1803.952] (-1804.345) (-1804.042) (-1803.395) * (-1804.262) (-1804.416) [-1806.747] (-1804.266) -- 0:00:49
493000 -- (-1805.300) (-1803.234) (-1804.526) [-1806.208] * (-1805.021) (-1808.469) (-1807.519) [-1805.499] -- 0:00:49
493500 -- [-1804.730] (-1803.527) (-1803.509) (-1805.702) * (-1806.499) [-1803.686] (-1808.046) (-1803.879) -- 0:00:49
494000 -- [-1805.969] (-1803.250) (-1804.341) (-1804.477) * (-1804.158) (-1803.642) (-1807.031) [-1805.568] -- 0:00:49
494500 -- (-1803.976) (-1805.697) (-1804.335) [-1810.960] * [-1805.424] (-1810.244) (-1806.964) (-1803.378) -- 0:00:49
495000 -- [-1808.294] (-1804.512) (-1803.349) (-1805.169) * (-1806.120) [-1802.978] (-1804.427) (-1804.311) -- 0:00:48
Average standard deviation of split frequencies: 0.010455
495500 -- (-1802.824) (-1804.493) (-1805.048) [-1803.883] * (-1804.042) (-1803.485) (-1804.173) [-1804.703] -- 0:00:48
496000 -- (-1803.404) (-1804.720) [-1806.735] (-1803.642) * (-1806.273) (-1805.051) (-1803.526) [-1804.639] -- 0:00:48
496500 -- [-1803.144] (-1806.684) (-1804.554) (-1804.744) * (-1806.692) [-1803.895] (-1805.807) (-1804.735) -- 0:00:48
497000 -- [-1802.349] (-1803.060) (-1803.798) (-1804.210) * (-1802.703) (-1805.436) [-1806.393] (-1803.982) -- 0:00:48
497500 -- [-1804.094] (-1803.269) (-1805.512) (-1803.358) * [-1804.553] (-1805.029) (-1804.236) (-1804.439) -- 0:00:48
498000 -- [-1803.987] (-1803.142) (-1804.262) (-1810.952) * (-1805.725) (-1803.697) (-1805.420) [-1804.074] -- 0:00:48
498500 -- (-1805.477) [-1805.101] (-1808.107) (-1803.647) * (-1803.949) (-1803.034) (-1805.322) [-1805.607] -- 0:00:48
499000 -- [-1804.556] (-1805.749) (-1807.605) (-1803.106) * (-1803.259) (-1806.638) (-1803.354) [-1805.607] -- 0:00:48
499500 -- [-1803.015] (-1803.726) (-1807.643) (-1803.834) * (-1803.058) (-1806.569) [-1803.478] (-1803.905) -- 0:00:48
500000 -- (-1806.763) (-1805.461) [-1803.368] (-1809.862) * [-1803.803] (-1803.680) (-1806.737) (-1806.718) -- 0:00:48
Average standard deviation of split frequencies: 0.009792
500500 -- (-1810.340) (-1803.031) [-1803.346] (-1803.077) * (-1805.430) [-1804.034] (-1810.554) (-1806.467) -- 0:00:47
501000 -- (-1803.615) (-1807.946) (-1805.076) [-1805.081] * (-1804.453) [-1804.021] (-1803.320) (-1803.857) -- 0:00:48
501500 -- (-1804.654) (-1807.350) [-1806.493] (-1805.094) * [-1805.181] (-1802.931) (-1803.110) (-1803.780) -- 0:00:48
502000 -- (-1803.199) [-1803.862] (-1805.116) (-1803.614) * (-1803.169) (-1810.303) [-1804.292] (-1804.004) -- 0:00:48
502500 -- (-1805.564) (-1806.606) [-1803.621] (-1807.166) * (-1803.438) (-1804.309) (-1805.557) [-1806.664] -- 0:00:48
503000 -- (-1805.945) [-1804.726] (-1805.667) (-1806.896) * (-1806.988) (-1807.689) (-1805.046) [-1803.665] -- 0:00:48
503500 -- (-1805.823) (-1805.041) (-1805.387) [-1804.069] * (-1806.281) (-1807.962) (-1804.243) [-1805.178] -- 0:00:48
504000 -- [-1803.325] (-1803.732) (-1805.359) (-1803.440) * (-1806.132) (-1803.796) [-1804.556] (-1804.602) -- 0:00:48
504500 -- (-1803.519) (-1802.874) (-1809.495) [-1804.846] * [-1804.321] (-1805.519) (-1806.256) (-1809.783) -- 0:00:48
505000 -- (-1803.749) [-1805.250] (-1805.592) (-1803.439) * (-1805.482) (-1803.786) (-1807.197) [-1803.632] -- 0:00:48
Average standard deviation of split frequencies: 0.009875
505500 -- (-1804.060) (-1804.892) [-1804.805] (-1803.328) * (-1802.857) (-1803.806) (-1803.709) [-1804.721] -- 0:00:47
506000 -- (-1804.042) [-1804.899] (-1803.396) (-1802.790) * (-1803.513) [-1803.166] (-1805.670) (-1804.234) -- 0:00:47
506500 -- (-1806.996) (-1804.376) (-1806.672) [-1805.052] * (-1804.224) [-1802.527] (-1804.424) (-1805.283) -- 0:00:47
507000 -- (-1805.114) (-1803.174) [-1804.315] (-1805.537) * (-1803.469) (-1802.447) (-1804.846) [-1806.637] -- 0:00:47
507500 -- [-1804.199] (-1803.242) (-1805.132) (-1810.598) * (-1804.898) (-1803.503) (-1803.970) [-1802.237] -- 0:00:47
508000 -- (-1805.526) (-1803.454) (-1804.517) [-1811.358] * (-1802.803) (-1804.968) [-1804.159] (-1803.906) -- 0:00:47
508500 -- [-1803.105] (-1804.672) (-1803.369) (-1805.136) * (-1803.578) (-1804.964) [-1805.291] (-1803.468) -- 0:00:47
509000 -- (-1803.467) (-1803.935) (-1804.971) [-1804.571] * (-1806.057) (-1802.554) (-1805.448) [-1804.790] -- 0:00:47
509500 -- [-1803.339] (-1804.800) (-1802.969) (-1804.508) * (-1803.625) [-1803.027] (-1803.580) (-1803.110) -- 0:00:47
510000 -- [-1805.731] (-1802.759) (-1807.646) (-1804.588) * (-1805.562) (-1804.480) (-1805.295) [-1803.106] -- 0:00:47
Average standard deviation of split frequencies: 0.010339
510500 -- (-1807.145) [-1805.417] (-1804.964) (-1809.498) * [-1804.885] (-1805.615) (-1803.793) (-1802.985) -- 0:00:46
511000 -- (-1808.450) [-1804.994] (-1804.380) (-1805.603) * [-1804.471] (-1810.101) (-1811.045) (-1803.954) -- 0:00:46
511500 -- (-1805.630) [-1804.224] (-1803.167) (-1805.298) * (-1805.019) [-1806.036] (-1806.273) (-1803.344) -- 0:00:47
512000 -- (-1804.618) [-1806.844] (-1803.509) (-1809.908) * (-1804.358) [-1803.258] (-1804.638) (-1803.013) -- 0:00:47
512500 -- (-1805.444) [-1804.069] (-1803.375) (-1808.259) * (-1804.335) (-1807.024) [-1806.109] (-1804.262) -- 0:00:47
513000 -- (-1804.226) (-1804.759) [-1803.925] (-1806.126) * (-1806.169) [-1804.616] (-1804.995) (-1803.531) -- 0:00:47
513500 -- (-1802.347) [-1804.572] (-1805.761) (-1806.268) * (-1807.675) (-1807.235) [-1802.981] (-1807.769) -- 0:00:47
514000 -- (-1803.019) (-1807.598) (-1803.761) [-1802.493] * (-1802.593) [-1806.637] (-1810.910) (-1806.201) -- 0:00:47
514500 -- (-1804.462) (-1803.166) [-1805.004] (-1804.194) * [-1802.849] (-1805.448) (-1806.693) (-1809.484) -- 0:00:47
515000 -- (-1805.959) [-1803.952] (-1806.216) (-1805.451) * [-1802.629] (-1803.371) (-1804.490) (-1808.107) -- 0:00:47
Average standard deviation of split frequencies: 0.010049
515500 -- (-1806.183) (-1803.138) [-1808.938] (-1807.628) * (-1801.908) (-1803.332) (-1805.311) [-1802.604] -- 0:00:46
516000 -- [-1804.218] (-1808.623) (-1802.916) (-1807.110) * [-1802.701] (-1805.090) (-1806.358) (-1803.826) -- 0:00:46
516500 -- (-1803.271) [-1806.486] (-1802.396) (-1811.845) * (-1804.845) [-1803.050] (-1805.407) (-1804.313) -- 0:00:46
517000 -- [-1804.996] (-1803.305) (-1803.262) (-1806.066) * (-1810.161) (-1805.272) [-1805.257] (-1803.552) -- 0:00:46
517500 -- (-1804.516) [-1805.185] (-1804.196) (-1807.958) * [-1804.124] (-1805.042) (-1806.890) (-1804.955) -- 0:00:46
518000 -- [-1805.082] (-1802.603) (-1804.841) (-1804.388) * [-1804.747] (-1803.388) (-1803.129) (-1806.278) -- 0:00:46
518500 -- (-1805.390) (-1802.855) [-1804.408] (-1810.635) * (-1804.560) (-1803.181) (-1805.083) [-1804.437] -- 0:00:46
519000 -- (-1804.645) [-1805.582] (-1803.350) (-1808.466) * (-1803.437) (-1805.046) [-1804.981] (-1805.883) -- 0:00:46
519500 -- (-1807.047) (-1804.170) (-1808.813) [-1805.054] * [-1804.443] (-1804.030) (-1805.115) (-1806.243) -- 0:00:46
520000 -- (-1803.594) (-1803.877) [-1807.005] (-1804.271) * (-1803.614) (-1806.819) (-1803.145) [-1805.366] -- 0:00:46
Average standard deviation of split frequencies: 0.008692
520500 -- (-1805.778) (-1804.497) (-1803.728) [-1804.366] * (-1804.132) (-1803.271) (-1803.847) [-1804.291] -- 0:00:46
521000 -- (-1805.469) (-1804.985) [-1807.426] (-1806.529) * (-1809.030) (-1802.544) (-1803.087) [-1805.470] -- 0:00:45
521500 -- [-1803.307] (-1810.291) (-1804.411) (-1808.799) * (-1805.308) [-1804.163] (-1803.300) (-1806.794) -- 0:00:45
522000 -- [-1802.604] (-1806.240) (-1804.411) (-1804.330) * (-1804.953) (-1803.258) (-1803.723) [-1803.716] -- 0:00:45
522500 -- [-1804.996] (-1804.495) (-1806.111) (-1803.326) * [-1804.621] (-1803.974) (-1807.766) (-1803.976) -- 0:00:46
523000 -- [-1803.677] (-1803.999) (-1805.491) (-1802.856) * (-1807.003) (-1807.715) [-1805.367] (-1803.986) -- 0:00:46
523500 -- (-1804.169) (-1804.488) [-1805.192] (-1803.463) * (-1803.237) [-1805.257] (-1804.720) (-1803.067) -- 0:00:46
524000 -- [-1804.497] (-1802.934) (-1803.252) (-1803.724) * (-1803.581) (-1807.378) (-1803.305) [-1803.863] -- 0:00:46
524500 -- [-1803.275] (-1807.725) (-1804.628) (-1807.242) * [-1804.227] (-1806.423) (-1806.082) (-1805.412) -- 0:00:46
525000 -- [-1806.473] (-1809.502) (-1806.691) (-1803.977) * (-1803.076) (-1803.813) (-1807.458) [-1806.573] -- 0:00:46
Average standard deviation of split frequencies: 0.008783
525500 -- [-1807.277] (-1805.508) (-1805.537) (-1806.673) * (-1803.925) (-1802.763) [-1803.422] (-1802.384) -- 0:00:46
526000 -- [-1806.424] (-1806.362) (-1804.394) (-1804.572) * [-1802.643] (-1803.632) (-1805.134) (-1802.512) -- 0:00:45
526500 -- [-1804.559] (-1803.801) (-1805.641) (-1805.343) * (-1803.436) (-1803.216) [-1803.780] (-1806.260) -- 0:00:45
527000 -- (-1805.382) [-1803.529] (-1806.713) (-1806.872) * [-1803.887] (-1803.823) (-1803.537) (-1804.812) -- 0:00:45
527500 -- [-1803.108] (-1803.175) (-1808.024) (-1804.910) * (-1804.678) (-1803.541) (-1803.882) [-1805.761] -- 0:00:45
528000 -- [-1803.085] (-1803.356) (-1805.950) (-1806.330) * (-1805.059) [-1802.968] (-1805.705) (-1806.754) -- 0:00:45
528500 -- (-1803.195) (-1804.699) [-1808.396] (-1804.728) * (-1805.478) [-1803.538] (-1805.364) (-1803.144) -- 0:00:45
529000 -- [-1805.595] (-1803.528) (-1805.690) (-1804.548) * (-1804.072) (-1802.739) (-1805.334) [-1805.440] -- 0:00:45
529500 -- (-1806.147) (-1803.761) (-1803.792) [-1806.068] * (-1804.801) (-1804.725) [-1805.402] (-1804.160) -- 0:00:45
530000 -- [-1806.802] (-1803.767) (-1804.856) (-1803.272) * (-1802.492) (-1802.586) (-1805.414) [-1803.911] -- 0:00:45
Average standard deviation of split frequencies: 0.008706
530500 -- (-1803.804) [-1803.177] (-1804.463) (-1803.726) * (-1804.655) (-1805.962) [-1804.959] (-1804.085) -- 0:00:45
531000 -- [-1805.514] (-1804.484) (-1806.527) (-1803.999) * [-1806.693] (-1804.007) (-1805.658) (-1803.909) -- 0:00:45
531500 -- (-1805.026) (-1802.961) [-1803.357] (-1804.160) * (-1803.233) [-1803.939] (-1807.457) (-1808.243) -- 0:00:44
532000 -- (-1807.680) [-1806.623] (-1803.106) (-1804.599) * (-1805.280) [-1804.178] (-1802.532) (-1806.802) -- 0:00:44
532500 -- (-1804.479) (-1807.469) (-1804.120) [-1804.824] * (-1803.801) (-1804.576) (-1804.842) [-1804.153] -- 0:00:44
533000 -- [-1804.707] (-1805.784) (-1803.710) (-1804.820) * [-1804.337] (-1802.875) (-1804.604) (-1804.380) -- 0:00:44
533500 -- (-1808.050) (-1803.464) [-1805.382] (-1804.673) * (-1806.718) (-1803.535) (-1803.488) [-1805.221] -- 0:00:45
534000 -- [-1804.796] (-1805.289) (-1803.901) (-1804.232) * (-1803.327) (-1804.797) [-1804.378] (-1805.683) -- 0:00:45
534500 -- [-1806.502] (-1805.293) (-1806.226) (-1810.309) * (-1803.928) (-1806.048) [-1802.673] (-1805.486) -- 0:00:45
535000 -- [-1808.377] (-1805.017) (-1805.126) (-1802.851) * (-1803.507) (-1805.607) (-1802.346) [-1806.393] -- 0:00:45
Average standard deviation of split frequencies: 0.009498
535500 -- (-1807.881) (-1804.198) (-1809.940) [-1804.186] * [-1805.800] (-1811.790) (-1803.762) (-1808.438) -- 0:00:45
536000 -- (-1808.148) (-1803.816) (-1805.741) [-1804.523] * [-1805.084] (-1804.243) (-1803.448) (-1803.954) -- 0:00:45
536500 -- (-1810.709) [-1805.065] (-1805.738) (-1803.036) * (-1804.279) (-1802.615) (-1803.852) [-1803.677] -- 0:00:44
537000 -- (-1806.662) [-1802.837] (-1807.246) (-1803.725) * (-1802.738) (-1805.506) [-1805.401] (-1806.100) -- 0:00:44
537500 -- (-1804.097) (-1804.460) (-1806.782) [-1803.093] * [-1804.659] (-1805.357) (-1803.642) (-1808.839) -- 0:00:44
538000 -- (-1802.965) (-1803.983) (-1804.342) [-1804.460] * [-1804.061] (-1806.743) (-1806.429) (-1805.554) -- 0:00:44
538500 -- (-1805.563) (-1806.221) (-1805.039) [-1803.539] * (-1802.473) (-1806.042) (-1809.638) [-1803.543] -- 0:00:44
539000 -- (-1806.396) (-1802.925) [-1804.483] (-1804.935) * (-1803.098) [-1804.955] (-1806.711) (-1805.052) -- 0:00:44
539500 -- (-1802.897) (-1805.584) (-1805.418) [-1803.835] * (-1804.815) (-1806.795) (-1804.988) [-1808.670] -- 0:00:44
540000 -- [-1804.006] (-1805.015) (-1803.681) (-1803.598) * (-1809.299) (-1803.586) (-1807.436) [-1805.708] -- 0:00:44
Average standard deviation of split frequencies: 0.009242
540500 -- (-1807.337) [-1808.129] (-1805.951) (-1803.567) * (-1805.080) [-1803.378] (-1803.239) (-1803.997) -- 0:00:44
541000 -- (-1804.132) (-1807.059) [-1804.335] (-1802.810) * (-1807.892) (-1804.133) (-1804.126) [-1803.132] -- 0:00:44
541500 -- (-1804.183) [-1803.144] (-1803.053) (-1803.048) * (-1805.233) (-1805.057) [-1804.627] (-1802.737) -- 0:00:44
542000 -- (-1803.608) (-1804.187) [-1804.558] (-1803.332) * [-1807.248] (-1804.617) (-1802.784) (-1802.880) -- 0:00:43
542500 -- (-1803.091) [-1804.493] (-1802.430) (-1805.032) * (-1804.934) [-1802.555] (-1805.431) (-1806.200) -- 0:00:43
543000 -- (-1803.861) [-1803.211] (-1806.264) (-1804.361) * [-1807.101] (-1803.565) (-1805.249) (-1803.252) -- 0:00:43
543500 -- (-1804.569) (-1803.941) [-1804.318] (-1806.297) * (-1809.099) [-1804.577] (-1803.460) (-1805.360) -- 0:00:43
544000 -- (-1804.912) (-1805.354) (-1806.538) [-1805.300] * (-1807.559) [-1803.378] (-1803.782) (-1805.276) -- 0:00:43
544500 -- (-1803.974) [-1803.915] (-1804.377) (-1803.886) * (-1803.612) [-1803.685] (-1803.016) (-1803.047) -- 0:00:44
545000 -- (-1804.158) (-1806.695) [-1804.645] (-1804.288) * [-1802.855] (-1803.024) (-1804.137) (-1803.560) -- 0:00:44
Average standard deviation of split frequencies: 0.009324
545500 -- (-1805.569) (-1804.550) [-1804.316] (-1805.794) * (-1804.477) (-1804.472) (-1806.731) [-1807.526] -- 0:00:44
546000 -- [-1804.574] (-1806.357) (-1804.101) (-1804.162) * (-1802.653) (-1803.061) (-1806.143) [-1804.632] -- 0:00:44
546500 -- (-1803.877) (-1811.477) [-1803.838] (-1804.612) * (-1804.162) (-1802.394) [-1802.590] (-1802.825) -- 0:00:43
547000 -- (-1803.137) (-1810.350) [-1804.632] (-1804.332) * [-1804.692] (-1803.760) (-1802.917) (-1802.250) -- 0:00:43
547500 -- [-1802.519] (-1806.156) (-1804.761) (-1803.746) * (-1803.341) (-1807.452) [-1804.741] (-1805.142) -- 0:00:43
548000 -- [-1804.444] (-1805.762) (-1803.464) (-1805.540) * (-1802.797) (-1803.473) [-1804.249] (-1803.845) -- 0:00:43
548500 -- [-1802.712] (-1803.827) (-1804.430) (-1804.998) * (-1806.806) (-1804.907) (-1805.121) [-1803.776] -- 0:00:43
549000 -- (-1802.270) [-1803.036] (-1806.481) (-1804.041) * (-1806.142) [-1803.445] (-1806.596) (-1806.716) -- 0:00:43
549500 -- (-1803.292) [-1803.499] (-1806.711) (-1804.365) * (-1803.559) (-1803.913) (-1804.222) [-1803.991] -- 0:00:43
550000 -- (-1803.319) (-1802.874) [-1803.872] (-1804.178) * [-1805.076] (-1803.659) (-1803.707) (-1808.560) -- 0:00:43
Average standard deviation of split frequencies: 0.009759
550500 -- (-1803.763) (-1805.564) (-1803.636) [-1804.776] * (-1804.910) (-1804.220) [-1805.156] (-1802.800) -- 0:00:43
551000 -- (-1803.479) (-1803.878) [-1803.850] (-1806.810) * (-1805.870) [-1803.240] (-1805.186) (-1805.117) -- 0:00:43
551500 -- (-1809.406) (-1806.569) (-1804.176) [-1804.627] * (-1804.777) (-1802.795) [-1803.312] (-1806.185) -- 0:00:43
552000 -- (-1809.720) [-1805.791] (-1804.303) (-1804.821) * (-1804.621) [-1803.976] (-1803.113) (-1805.118) -- 0:00:43
552500 -- (-1811.139) (-1803.722) [-1806.044] (-1805.393) * [-1803.464] (-1807.472) (-1802.916) (-1804.545) -- 0:00:42
553000 -- [-1806.981] (-1803.867) (-1807.269) (-1805.973) * (-1805.420) [-1804.937] (-1803.995) (-1802.817) -- 0:00:42
553500 -- (-1806.727) [-1803.113] (-1804.789) (-1803.349) * (-1802.525) (-1806.929) (-1810.593) [-1802.428] -- 0:00:42
554000 -- (-1812.432) (-1803.593) [-1807.727] (-1805.696) * (-1805.590) (-1802.897) (-1809.625) [-1802.937] -- 0:00:42
554500 -- (-1806.854) (-1803.073) (-1805.392) [-1803.331] * [-1803.726] (-1803.227) (-1805.568) (-1803.195) -- 0:00:42
555000 -- (-1804.046) (-1802.516) [-1806.691] (-1804.622) * (-1803.129) (-1805.535) (-1803.711) [-1803.173] -- 0:00:43
Average standard deviation of split frequencies: 0.009835
555500 -- [-1806.037] (-1803.569) (-1804.748) (-1804.446) * (-1803.444) (-1804.770) [-1804.794] (-1804.996) -- 0:00:43
556000 -- (-1804.579) (-1803.434) (-1803.858) [-1804.316] * [-1804.173] (-1806.378) (-1804.464) (-1804.174) -- 0:00:43
556500 -- [-1803.311] (-1803.228) (-1803.688) (-1802.975) * (-1804.592) (-1803.576) (-1804.084) [-1803.993] -- 0:00:43
557000 -- (-1803.591) (-1806.646) [-1806.005] (-1803.662) * (-1804.631) (-1806.539) [-1806.099] (-1804.333) -- 0:00:42
557500 -- (-1803.228) (-1804.122) (-1805.696) [-1807.418] * [-1804.401] (-1804.530) (-1806.305) (-1803.029) -- 0:00:42
558000 -- (-1804.565) (-1803.132) (-1802.454) [-1803.814] * (-1805.668) (-1806.337) [-1806.459] (-1803.531) -- 0:00:42
558500 -- (-1804.283) [-1806.265] (-1803.285) (-1803.845) * [-1803.387] (-1806.434) (-1804.011) (-1804.077) -- 0:00:42
559000 -- (-1805.009) (-1805.301) (-1803.065) [-1803.244] * [-1805.476] (-1806.349) (-1805.808) (-1804.513) -- 0:00:42
559500 -- (-1809.123) (-1804.914) (-1805.114) [-1803.484] * (-1804.321) (-1806.872) [-1805.453] (-1803.662) -- 0:00:42
560000 -- [-1805.454] (-1805.232) (-1805.415) (-1804.357) * (-1804.265) (-1807.175) (-1804.803) [-1803.986] -- 0:00:42
Average standard deviation of split frequencies: 0.010090
560500 -- (-1807.626) [-1805.296] (-1804.363) (-1803.168) * [-1804.038] (-1807.075) (-1803.636) (-1806.438) -- 0:00:42
561000 -- (-1811.582) [-1803.142] (-1806.187) (-1803.576) * (-1804.966) (-1807.288) (-1806.662) [-1808.057] -- 0:00:42
561500 -- [-1802.529] (-1806.433) (-1806.140) (-1804.251) * (-1804.255) [-1804.383] (-1804.383) (-1809.607) -- 0:00:42
562000 -- [-1802.651] (-1804.993) (-1803.698) (-1805.338) * (-1803.889) (-1804.140) [-1804.279] (-1805.154) -- 0:00:42
562500 -- (-1804.497) (-1805.528) [-1802.826] (-1807.280) * (-1803.593) (-1804.594) (-1804.658) [-1803.091] -- 0:00:42
563000 -- (-1804.290) [-1807.812] (-1802.419) (-1808.541) * [-1806.494] (-1804.289) (-1804.834) (-1804.318) -- 0:00:41
563500 -- (-1803.556) (-1804.557) [-1804.629] (-1807.583) * [-1803.666] (-1806.394) (-1805.721) (-1804.791) -- 0:00:41
564000 -- [-1803.573] (-1804.004) (-1805.498) (-1803.672) * (-1805.010) (-1803.685) [-1803.774] (-1804.959) -- 0:00:41
564500 -- (-1803.090) [-1802.928] (-1803.703) (-1807.031) * (-1805.320) [-1803.785] (-1806.332) (-1804.118) -- 0:00:41
565000 -- (-1809.628) [-1804.429] (-1804.875) (-1803.915) * [-1804.146] (-1802.907) (-1804.008) (-1804.490) -- 0:00:41
Average standard deviation of split frequencies: 0.009994
565500 -- [-1805.083] (-1806.772) (-1802.985) (-1804.786) * (-1804.453) (-1803.833) [-1803.783] (-1810.563) -- 0:00:42
566000 -- (-1805.072) (-1803.827) [-1802.975] (-1803.105) * [-1805.392] (-1804.083) (-1803.141) (-1804.907) -- 0:00:42
566500 -- (-1804.793) (-1804.513) (-1805.747) [-1802.805] * (-1806.398) (-1805.769) (-1803.581) [-1804.878] -- 0:00:42
567000 -- (-1805.502) (-1805.144) [-1803.615] (-1803.766) * (-1806.150) (-1806.431) [-1805.121] (-1805.846) -- 0:00:42
567500 -- (-1806.327) (-1804.088) (-1803.508) [-1802.886] * (-1807.009) (-1807.014) [-1804.441] (-1809.084) -- 0:00:41
568000 -- (-1807.400) [-1803.441] (-1803.849) (-1802.869) * (-1806.241) (-1804.776) [-1807.134] (-1806.148) -- 0:00:41
568500 -- (-1808.112) [-1803.133] (-1803.333) (-1805.322) * (-1803.981) (-1804.075) [-1804.657] (-1806.802) -- 0:00:41
569000 -- (-1802.275) (-1801.518) [-1803.371] (-1807.590) * (-1803.866) (-1805.000) (-1803.751) [-1805.348] -- 0:00:41
569500 -- (-1803.259) (-1802.123) (-1803.813) [-1806.860] * [-1803.755] (-1804.850) (-1803.397) (-1803.367) -- 0:00:41
570000 -- (-1803.474) [-1804.176] (-1804.121) (-1806.783) * (-1803.152) (-1803.963) (-1806.434) [-1803.180] -- 0:00:41
Average standard deviation of split frequencies: 0.010739
570500 -- (-1802.372) [-1805.469] (-1805.157) (-1807.405) * (-1802.367) (-1803.496) (-1807.732) [-1804.654] -- 0:00:41
571000 -- (-1803.095) [-1804.232] (-1804.509) (-1805.532) * (-1804.553) [-1803.156] (-1806.329) (-1805.264) -- 0:00:41
571500 -- (-1806.005) [-1803.160] (-1802.477) (-1804.877) * (-1804.635) (-1803.185) (-1804.559) [-1804.907] -- 0:00:41
572000 -- [-1805.053] (-1805.258) (-1802.904) (-1805.181) * (-1808.823) [-1804.683] (-1804.367) (-1804.880) -- 0:00:41
572500 -- (-1804.665) (-1803.165) (-1809.117) [-1807.678] * (-1806.706) (-1803.835) (-1807.162) [-1806.922] -- 0:00:41
573000 -- [-1807.251] (-1802.872) (-1808.145) (-1805.164) * (-1806.756) [-1803.543] (-1804.634) (-1804.088) -- 0:00:40
573500 -- (-1807.105) (-1805.614) (-1805.763) [-1803.609] * (-1803.809) [-1806.271] (-1802.536) (-1807.980) -- 0:00:40
574000 -- (-1805.561) (-1802.800) (-1806.784) [-1804.633] * (-1804.079) [-1803.691] (-1806.104) (-1805.945) -- 0:00:40
574500 -- (-1803.802) [-1802.842] (-1806.136) (-1809.065) * (-1803.917) [-1806.085] (-1807.537) (-1803.854) -- 0:00:40
575000 -- [-1802.530] (-1808.344) (-1803.959) (-1804.089) * [-1804.122] (-1805.712) (-1805.443) (-1804.426) -- 0:00:40
Average standard deviation of split frequencies: 0.011458
575500 -- (-1804.623) [-1805.291] (-1803.101) (-1803.870) * (-1802.999) (-1806.249) [-1805.118] (-1804.502) -- 0:00:40
576000 -- (-1803.954) (-1805.570) [-1802.761] (-1803.614) * (-1803.823) (-1808.248) (-1803.549) [-1803.411] -- 0:00:41
576500 -- [-1802.837] (-1804.864) (-1803.010) (-1807.516) * [-1803.515] (-1808.256) (-1804.170) (-1803.923) -- 0:00:41
577000 -- (-1805.170) [-1805.384] (-1806.264) (-1807.258) * [-1804.823] (-1804.750) (-1803.261) (-1804.087) -- 0:00:41
577500 -- (-1802.161) (-1805.213) [-1803.901] (-1805.278) * (-1805.251) (-1804.688) (-1804.227) [-1804.834] -- 0:00:40
578000 -- [-1805.351] (-1805.871) (-1808.705) (-1803.661) * (-1805.523) [-1804.266] (-1804.415) (-1805.239) -- 0:00:40
578500 -- (-1802.646) [-1803.084] (-1805.268) (-1803.913) * (-1803.915) (-1804.228) [-1803.605] (-1803.373) -- 0:00:40
579000 -- (-1810.257) (-1802.445) (-1805.069) [-1802.794] * (-1804.734) (-1804.420) (-1803.888) [-1803.886] -- 0:00:40
579500 -- (-1806.502) (-1806.682) (-1804.294) [-1802.735] * (-1804.655) [-1806.019] (-1804.089) (-1803.395) -- 0:00:40
580000 -- (-1802.627) (-1803.628) (-1803.632) [-1801.645] * [-1805.758] (-1804.984) (-1805.556) (-1804.376) -- 0:00:40
Average standard deviation of split frequencies: 0.011528
580500 -- (-1806.175) (-1809.037) (-1808.230) [-1808.026] * (-1804.116) [-1805.659] (-1803.746) (-1805.445) -- 0:00:40
581000 -- (-1809.015) (-1803.354) [-1807.510] (-1804.560) * (-1803.891) (-1805.193) [-1803.522] (-1804.768) -- 0:00:40
581500 -- (-1803.449) (-1805.024) [-1806.170] (-1806.375) * (-1803.223) (-1807.364) (-1806.348) [-1803.496] -- 0:00:40
582000 -- (-1802.903) (-1804.012) [-1805.075] (-1806.542) * [-1803.082] (-1807.794) (-1803.178) (-1803.094) -- 0:00:40
582500 -- (-1803.972) [-1803.476] (-1804.589) (-1804.351) * (-1804.150) [-1805.276] (-1804.918) (-1804.565) -- 0:00:40
583000 -- (-1804.877) (-1807.873) (-1802.808) [-1804.318] * (-1804.077) (-1806.357) [-1802.990] (-1805.287) -- 0:00:40
583500 -- (-1805.104) (-1806.451) (-1803.383) [-1804.454] * [-1804.438] (-1805.893) (-1804.255) (-1802.738) -- 0:00:39
584000 -- (-1803.055) (-1804.224) (-1805.124) [-1803.526] * (-1805.914) [-1805.565] (-1805.113) (-1803.339) -- 0:00:39
584500 -- (-1803.733) (-1804.009) (-1802.723) [-1805.294] * (-1804.013) (-1804.108) (-1804.803) [-1803.337] -- 0:00:39
585000 -- (-1808.013) (-1805.297) [-1804.990] (-1802.891) * [-1807.935] (-1803.403) (-1803.084) (-1804.927) -- 0:00:39
Average standard deviation of split frequencies: 0.010780
585500 -- (-1804.015) (-1803.088) (-1806.404) [-1804.367] * (-1805.306) [-1803.385] (-1803.047) (-1804.213) -- 0:00:39
586000 -- (-1803.370) (-1803.439) [-1805.094] (-1804.261) * (-1805.056) (-1806.477) [-1803.621] (-1807.229) -- 0:00:39
586500 -- (-1803.306) (-1803.368) (-1806.446) [-1803.796] * (-1803.956) (-1808.123) [-1803.648] (-1804.123) -- 0:00:40
587000 -- (-1803.447) (-1805.320) (-1803.777) [-1804.593] * (-1805.258) (-1804.498) (-1804.975) [-1804.292] -- 0:00:40
587500 -- (-1805.842) (-1805.775) [-1802.843] (-1802.898) * (-1803.765) [-1803.538] (-1804.616) (-1804.591) -- 0:00:40
588000 -- (-1806.743) (-1807.522) (-1802.887) [-1804.017] * (-1805.524) (-1803.751) [-1802.415] (-1804.251) -- 0:00:39
588500 -- [-1810.573] (-1803.067) (-1802.876) (-1806.676) * (-1806.236) (-1804.503) (-1802.594) [-1806.242] -- 0:00:39
589000 -- [-1808.272] (-1803.393) (-1804.948) (-1807.152) * (-1803.418) [-1802.043] (-1803.089) (-1806.932) -- 0:00:39
589500 -- (-1806.715) (-1806.748) (-1803.528) [-1803.428] * (-1803.181) [-1803.578] (-1803.805) (-1803.476) -- 0:00:39
590000 -- (-1808.012) [-1806.738] (-1804.883) (-1805.340) * (-1804.101) (-1806.119) [-1807.003] (-1805.035) -- 0:00:39
Average standard deviation of split frequencies: 0.011173
590500 -- [-1805.424] (-1808.465) (-1808.930) (-1804.798) * (-1804.402) (-1804.305) [-1807.063] (-1804.469) -- 0:00:39
591000 -- (-1812.238) (-1810.455) [-1803.587] (-1805.161) * (-1805.942) [-1807.614] (-1807.667) (-1805.082) -- 0:00:39
591500 -- (-1810.210) (-1804.471) [-1803.083] (-1804.336) * [-1803.875] (-1803.672) (-1807.863) (-1805.469) -- 0:00:39
592000 -- [-1803.914] (-1804.913) (-1804.094) (-1802.971) * [-1804.063] (-1804.761) (-1811.538) (-1807.528) -- 0:00:39
592500 -- (-1810.638) (-1806.484) (-1802.662) [-1803.338] * (-1805.326) (-1805.323) (-1804.168) [-1803.113] -- 0:00:39
593000 -- (-1805.694) [-1803.735] (-1803.197) (-1803.581) * (-1811.290) [-1804.569] (-1804.760) (-1808.159) -- 0:00:39
593500 -- [-1804.770] (-1803.454) (-1804.855) (-1807.126) * (-1808.573) (-1804.716) (-1805.057) [-1806.679] -- 0:00:39
594000 -- [-1804.996] (-1803.235) (-1802.158) (-1805.622) * (-1806.959) [-1804.901] (-1807.605) (-1809.564) -- 0:00:38
594500 -- (-1806.086) (-1803.070) [-1803.195] (-1807.038) * (-1803.746) [-1803.265] (-1809.165) (-1806.793) -- 0:00:38
595000 -- (-1804.778) [-1805.210] (-1803.633) (-1804.041) * (-1805.267) (-1804.575) (-1810.145) [-1806.659] -- 0:00:38
Average standard deviation of split frequencies: 0.011231
595500 -- (-1810.388) (-1803.994) (-1803.383) [-1805.777] * [-1804.083] (-1803.642) (-1804.404) (-1802.966) -- 0:00:38
596000 -- (-1804.610) [-1802.819] (-1804.513) (-1807.208) * (-1806.083) (-1806.089) [-1804.771] (-1804.925) -- 0:00:38
596500 -- [-1803.328] (-1803.131) (-1805.052) (-1808.255) * (-1803.101) (-1803.540) [-1806.464] (-1804.386) -- 0:00:38
597000 -- (-1807.880) [-1803.428] (-1804.295) (-1806.759) * (-1802.779) [-1803.196] (-1807.248) (-1805.995) -- 0:00:38
597500 -- [-1806.254] (-1803.564) (-1805.222) (-1808.681) * [-1805.955] (-1804.549) (-1805.084) (-1804.339) -- 0:00:39
598000 -- (-1806.434) [-1805.074] (-1804.796) (-1804.407) * (-1805.948) (-1804.459) [-1803.055] (-1804.181) -- 0:00:38
598500 -- (-1805.285) (-1804.743) (-1808.490) [-1804.447] * (-1803.509) (-1803.934) (-1806.667) [-1806.374] -- 0:00:38
599000 -- [-1805.050] (-1803.848) (-1806.123) (-1807.333) * (-1802.875) [-1805.801] (-1804.892) (-1804.285) -- 0:00:38
599500 -- (-1807.742) (-1806.448) [-1810.042] (-1806.169) * (-1804.125) (-1807.022) [-1801.906] (-1803.376) -- 0:00:38
600000 -- (-1812.538) (-1806.498) [-1810.674] (-1805.816) * [-1805.119] (-1807.940) (-1802.748) (-1803.498) -- 0:00:38
Average standard deviation of split frequencies: 0.009889
600500 -- (-1806.377) [-1803.150] (-1806.796) (-1803.739) * (-1808.478) (-1806.525) [-1802.293] (-1804.051) -- 0:00:38
601000 -- (-1806.023) (-1803.319) [-1806.485] (-1803.175) * (-1807.573) (-1803.896) (-1804.300) [-1802.748] -- 0:00:38
601500 -- (-1805.690) (-1805.287) (-1806.067) [-1804.574] * (-1803.255) (-1803.366) (-1804.459) [-1805.870] -- 0:00:38
602000 -- (-1805.106) (-1803.520) (-1804.295) [-1803.218] * [-1803.807] (-1803.501) (-1804.533) (-1804.846) -- 0:00:38
602500 -- (-1805.466) (-1808.400) [-1802.843] (-1804.447) * (-1806.338) (-1806.192) (-1803.480) [-1805.361] -- 0:00:38
603000 -- (-1803.075) (-1807.187) [-1804.178] (-1804.634) * [-1805.011] (-1804.174) (-1803.996) (-1806.733) -- 0:00:38
603500 -- (-1802.626) (-1803.084) [-1802.371] (-1807.902) * (-1803.754) [-1804.434] (-1803.130) (-1804.299) -- 0:00:38
604000 -- (-1803.047) (-1803.393) (-1805.470) [-1805.478] * [-1803.618] (-1806.721) (-1803.471) (-1805.054) -- 0:00:38
604500 -- (-1803.130) (-1803.658) [-1804.453] (-1805.915) * (-1803.004) (-1804.347) (-1806.467) [-1804.178] -- 0:00:37
605000 -- (-1804.379) [-1802.933] (-1804.479) (-1807.994) * (-1804.354) (-1803.666) (-1802.871) [-1805.090] -- 0:00:37
Average standard deviation of split frequencies: 0.011046
605500 -- (-1805.825) [-1803.518] (-1804.826) (-1804.237) * (-1802.566) (-1805.256) [-1804.565] (-1810.255) -- 0:00:37
606000 -- (-1805.002) (-1810.715) (-1804.974) [-1803.685] * (-1802.833) (-1804.637) [-1806.641] (-1804.255) -- 0:00:37
606500 -- (-1804.201) (-1811.815) (-1802.414) [-1803.311] * (-1803.631) (-1802.455) (-1809.642) [-1805.013] -- 0:00:37
607000 -- (-1805.648) (-1806.029) [-1803.397] (-1806.153) * [-1805.012] (-1803.830) (-1803.809) (-1804.053) -- 0:00:37
607500 -- (-1804.497) (-1805.987) [-1807.725] (-1804.726) * (-1804.463) (-1803.800) [-1803.625] (-1807.122) -- 0:00:37
608000 -- (-1804.391) [-1803.212] (-1803.199) (-1804.991) * (-1804.644) (-1809.406) [-1804.039] (-1804.877) -- 0:00:38
608500 -- (-1802.977) (-1803.462) [-1803.709] (-1807.128) * (-1803.616) (-1805.365) (-1807.472) [-1805.145] -- 0:00:37
609000 -- (-1803.462) [-1803.820] (-1804.127) (-1807.019) * (-1804.271) [-1803.926] (-1807.978) (-1803.529) -- 0:00:37
609500 -- [-1805.649] (-1803.941) (-1803.825) (-1807.230) * [-1804.821] (-1805.418) (-1805.617) (-1803.411) -- 0:00:37
610000 -- (-1809.034) [-1804.182] (-1803.130) (-1805.455) * (-1803.693) [-1803.605] (-1807.026) (-1805.952) -- 0:00:37
Average standard deviation of split frequencies: 0.010807
610500 -- (-1807.142) (-1804.625) [-1807.037] (-1805.122) * [-1803.809] (-1808.890) (-1804.902) (-1803.919) -- 0:00:37
611000 -- (-1805.106) [-1802.823] (-1806.028) (-1803.200) * (-1805.531) (-1804.914) (-1803.685) [-1803.699] -- 0:00:37
611500 -- (-1804.210) (-1802.866) (-1803.727) [-1803.886] * (-1805.703) (-1807.591) [-1805.366] (-1810.417) -- 0:00:37
612000 -- (-1804.172) (-1804.964) [-1803.423] (-1803.623) * (-1810.956) (-1802.671) [-1804.501] (-1804.714) -- 0:00:37
612500 -- (-1804.411) [-1804.008] (-1804.207) (-1803.624) * (-1807.917) [-1805.529] (-1803.309) (-1802.660) -- 0:00:37
613000 -- (-1805.516) (-1804.084) (-1804.543) [-1804.885] * (-1805.884) (-1807.600) (-1804.449) [-1803.715] -- 0:00:37
613500 -- (-1802.977) (-1805.746) (-1804.938) [-1803.554] * (-1803.727) (-1805.979) (-1804.443) [-1806.915] -- 0:00:37
614000 -- (-1805.701) (-1803.260) (-1804.979) [-1805.130] * (-1805.438) [-1805.975] (-1806.395) (-1804.824) -- 0:00:37
614500 -- (-1804.813) [-1802.582] (-1807.129) (-1802.994) * [-1803.486] (-1802.704) (-1803.680) (-1804.416) -- 0:00:37
615000 -- (-1805.679) (-1801.865) [-1805.584] (-1802.995) * (-1804.334) (-1805.219) [-1807.872] (-1806.695) -- 0:00:36
Average standard deviation of split frequencies: 0.010561
615500 -- (-1805.045) (-1805.382) [-1805.623] (-1804.271) * [-1805.983] (-1805.106) (-1807.242) (-1805.940) -- 0:00:36
616000 -- [-1803.189] (-1804.701) (-1805.459) (-1807.811) * (-1806.304) (-1808.043) (-1805.769) [-1805.716] -- 0:00:36
616500 -- (-1804.615) (-1805.247) (-1804.430) [-1803.170] * [-1802.748] (-1806.336) (-1805.299) (-1802.813) -- 0:00:36
617000 -- [-1806.944] (-1806.978) (-1803.961) (-1805.076) * (-1803.193) (-1805.012) [-1803.394] (-1803.426) -- 0:00:36
617500 -- (-1803.573) (-1807.000) [-1805.686] (-1804.281) * [-1803.828] (-1802.979) (-1806.048) (-1805.298) -- 0:00:36
618000 -- [-1804.168] (-1804.802) (-1803.853) (-1804.783) * (-1805.874) (-1803.665) (-1804.127) [-1806.415] -- 0:00:36
618500 -- (-1804.269) (-1803.201) (-1803.815) [-1803.935] * (-1803.049) [-1802.993] (-1805.040) (-1804.380) -- 0:00:36
619000 -- (-1803.246) (-1802.479) (-1803.437) [-1805.462] * (-1805.019) [-1803.781] (-1805.307) (-1806.333) -- 0:00:36
619500 -- [-1806.413] (-1803.335) (-1805.666) (-1805.190) * (-1804.206) (-1804.074) [-1802.398] (-1802.214) -- 0:00:36
620000 -- [-1805.028] (-1804.757) (-1802.842) (-1803.805) * [-1805.943] (-1805.167) (-1802.106) (-1804.099) -- 0:00:36
Average standard deviation of split frequencies: 0.011089
620500 -- (-1803.757) (-1803.852) [-1803.817] (-1805.231) * [-1807.139] (-1806.763) (-1802.802) (-1803.755) -- 0:00:36
621000 -- [-1807.841] (-1803.837) (-1803.676) (-1804.511) * (-1802.943) (-1804.242) [-1802.614] (-1803.008) -- 0:00:36
621500 -- (-1805.083) (-1803.646) [-1803.547] (-1803.637) * (-1802.535) (-1804.745) (-1803.998) [-1802.580] -- 0:00:36
622000 -- (-1803.664) [-1804.060] (-1804.084) (-1804.279) * (-1803.136) (-1802.465) [-1803.951] (-1803.924) -- 0:00:36
622500 -- (-1805.732) (-1805.596) [-1803.404] (-1805.220) * (-1808.274) (-1804.662) [-1806.359] (-1803.491) -- 0:00:36
623000 -- (-1807.151) [-1804.101] (-1803.833) (-1807.552) * (-1803.777) (-1803.220) [-1803.762] (-1802.810) -- 0:00:36
623500 -- (-1803.165) [-1807.278] (-1808.000) (-1807.945) * (-1804.623) (-1806.389) [-1806.405] (-1802.661) -- 0:00:36
624000 -- [-1806.925] (-1804.019) (-1804.152) (-1806.549) * (-1802.789) (-1805.082) (-1804.221) [-1804.721] -- 0:00:36
624500 -- (-1804.207) (-1805.800) (-1804.107) [-1804.387] * (-1807.535) (-1805.496) (-1803.334) [-1803.920] -- 0:00:36
625000 -- (-1803.464) [-1803.786] (-1802.201) (-1806.427) * (-1802.641) (-1806.323) [-1802.581] (-1805.770) -- 0:00:36
Average standard deviation of split frequencies: 0.010844
625500 -- (-1806.979) (-1804.095) (-1803.636) [-1804.379] * [-1803.413] (-1804.828) (-1803.518) (-1805.703) -- 0:00:35
626000 -- (-1807.406) (-1803.734) (-1806.148) [-1804.684] * (-1804.060) [-1806.817] (-1804.130) (-1804.793) -- 0:00:35
626500 -- (-1803.382) [-1804.130] (-1804.454) (-1803.325) * [-1803.992] (-1810.883) (-1805.979) (-1802.979) -- 0:00:35
627000 -- (-1805.112) (-1806.346) [-1804.894] (-1803.655) * [-1806.965] (-1804.031) (-1804.039) (-1803.164) -- 0:00:35
627500 -- (-1805.122) (-1805.648) (-1809.121) [-1803.677] * (-1806.492) (-1805.153) (-1804.096) [-1803.261] -- 0:00:35
628000 -- (-1802.975) (-1806.881) [-1809.590] (-1803.432) * (-1803.191) (-1803.703) (-1804.721) [-1802.533] -- 0:00:35
628500 -- [-1802.387] (-1804.163) (-1810.506) (-1803.556) * [-1802.880] (-1803.950) (-1805.008) (-1804.870) -- 0:00:35
629000 -- (-1806.438) (-1805.899) [-1806.431] (-1803.892) * (-1804.175) (-1808.109) (-1805.450) [-1806.919] -- 0:00:35
629500 -- (-1803.576) (-1805.241) (-1805.143) [-1803.274] * (-1805.209) (-1802.316) [-1805.686] (-1806.906) -- 0:00:35
630000 -- [-1802.953] (-1804.757) (-1802.611) (-1804.001) * (-1804.826) (-1805.863) (-1805.406) [-1802.956] -- 0:00:35
Average standard deviation of split frequencies: 0.010016
630500 -- [-1804.501] (-1804.704) (-1804.942) (-1803.745) * (-1804.429) (-1808.158) (-1803.991) [-1806.359] -- 0:00:35
631000 -- (-1802.739) (-1805.732) (-1803.947) [-1806.559] * (-1803.934) (-1815.237) (-1804.612) [-1803.614] -- 0:00:35
631500 -- (-1803.136) [-1803.667] (-1806.133) (-1804.320) * [-1803.815] (-1803.723) (-1805.917) (-1804.883) -- 0:00:35
632000 -- [-1803.596] (-1802.953) (-1803.425) (-1809.518) * (-1804.186) (-1804.884) (-1803.996) [-1803.025] -- 0:00:35
632500 -- [-1803.861] (-1805.252) (-1803.718) (-1805.857) * (-1806.650) (-1803.526) (-1808.558) [-1805.649] -- 0:00:35
633000 -- [-1803.749] (-1803.646) (-1803.914) (-1804.896) * [-1802.626] (-1803.251) (-1805.589) (-1805.103) -- 0:00:35
633500 -- (-1803.986) (-1807.553) [-1804.983] (-1803.045) * (-1803.511) (-1805.882) [-1804.190] (-1803.031) -- 0:00:35
634000 -- (-1803.838) (-1805.895) (-1803.658) [-1802.803] * (-1802.856) [-1805.428] (-1804.539) (-1803.733) -- 0:00:35
634500 -- [-1803.293] (-1805.774) (-1813.260) (-1804.106) * (-1805.465) (-1804.243) (-1802.917) [-1804.396] -- 0:00:35
635000 -- (-1805.071) [-1806.845] (-1805.989) (-1806.375) * (-1802.578) (-1804.378) [-1806.991] (-1804.687) -- 0:00:35
Average standard deviation of split frequencies: 0.010080
635500 -- (-1805.104) (-1806.158) [-1805.090] (-1805.214) * (-1803.482) [-1803.516] (-1803.410) (-1804.593) -- 0:00:34
636000 -- (-1804.211) [-1804.649] (-1802.471) (-1803.825) * (-1803.072) [-1805.083] (-1804.021) (-1803.166) -- 0:00:34
636500 -- (-1810.756) (-1806.356) [-1803.204] (-1804.798) * (-1805.262) [-1805.974] (-1802.972) (-1802.246) -- 0:00:34
637000 -- (-1804.306) [-1806.235] (-1805.831) (-1801.881) * [-1803.091] (-1804.491) (-1804.981) (-1802.845) -- 0:00:34
637500 -- (-1804.794) (-1805.336) [-1802.409] (-1805.471) * (-1802.912) (-1804.482) (-1804.238) [-1803.840] -- 0:00:34
638000 -- [-1803.708] (-1804.263) (-1804.537) (-1804.896) * (-1805.629) (-1804.001) [-1803.623] (-1805.975) -- 0:00:34
638500 -- [-1802.636] (-1805.020) (-1804.585) (-1805.330) * (-1803.438) (-1803.562) [-1805.438] (-1803.439) -- 0:00:34
639000 -- (-1802.563) (-1804.953) [-1804.989] (-1803.464) * [-1804.370] (-1802.636) (-1801.902) (-1802.983) -- 0:00:34
639500 -- (-1803.141) [-1803.110] (-1809.365) (-1805.233) * (-1803.818) (-1804.086) [-1802.799] (-1806.887) -- 0:00:34
640000 -- (-1802.711) [-1806.296] (-1804.229) (-1803.470) * (-1803.753) (-1803.168) [-1803.111] (-1804.993) -- 0:00:34
Average standard deviation of split frequencies: 0.010448
640500 -- (-1803.301) (-1806.907) (-1803.226) [-1803.915] * (-1804.544) (-1806.804) [-1803.463] (-1803.232) -- 0:00:34
641000 -- (-1803.550) (-1804.160) [-1803.285] (-1802.883) * (-1805.176) (-1808.385) [-1807.288] (-1802.747) -- 0:00:34
641500 -- (-1806.549) [-1803.581] (-1802.773) (-1803.336) * (-1806.084) (-1809.670) [-1805.204] (-1804.605) -- 0:00:34
642000 -- (-1808.131) [-1803.770] (-1802.544) (-1803.244) * (-1808.712) (-1808.677) (-1805.651) [-1804.670] -- 0:00:34
642500 -- (-1805.606) (-1805.716) [-1804.303] (-1802.657) * (-1810.526) (-1807.223) (-1809.934) [-1806.852] -- 0:00:34
643000 -- (-1809.069) (-1805.656) (-1811.617) [-1803.174] * (-1807.491) (-1805.690) [-1807.085] (-1805.966) -- 0:00:34
643500 -- (-1803.572) (-1806.867) [-1805.001] (-1806.176) * [-1807.381] (-1804.381) (-1803.771) (-1805.205) -- 0:00:34
644000 -- [-1804.063] (-1807.396) (-1804.320) (-1803.402) * (-1806.899) (-1804.663) [-1803.155] (-1811.404) -- 0:00:34
644500 -- (-1804.134) (-1805.148) [-1803.555] (-1803.968) * (-1805.374) (-1807.824) [-1803.158] (-1806.132) -- 0:00:34
645000 -- (-1805.897) (-1803.475) (-1808.245) [-1803.150] * [-1804.962] (-1803.418) (-1802.311) (-1807.717) -- 0:00:34
Average standard deviation of split frequencies: 0.009778
645500 -- [-1806.368] (-1802.611) (-1804.714) (-1803.308) * (-1804.173) (-1803.011) (-1803.492) [-1804.368] -- 0:00:34
646000 -- (-1807.254) (-1805.327) [-1805.066] (-1803.308) * [-1803.892] (-1803.015) (-1802.885) (-1807.666) -- 0:00:33
646500 -- (-1805.530) [-1805.159] (-1804.123) (-1802.695) * (-1804.397) (-1804.806) (-1804.307) [-1808.155] -- 0:00:33
647000 -- (-1805.418) (-1804.419) (-1805.353) [-1802.865] * [-1803.722] (-1804.706) (-1804.612) (-1809.922) -- 0:00:33
647500 -- (-1802.863) [-1804.935] (-1808.440) (-1804.038) * (-1807.112) [-1804.191] (-1804.419) (-1806.445) -- 0:00:33
648000 -- [-1802.195] (-1805.912) (-1805.057) (-1804.599) * (-1806.654) [-1803.131] (-1804.632) (-1808.708) -- 0:00:33
648500 -- (-1803.998) [-1806.478] (-1811.582) (-1807.518) * (-1803.723) (-1809.208) [-1805.659] (-1804.545) -- 0:00:33
649000 -- (-1803.571) (-1805.449) (-1804.366) [-1809.833] * [-1803.016] (-1808.209) (-1806.603) (-1803.670) -- 0:00:33
649500 -- (-1803.209) (-1805.977) (-1805.575) [-1803.022] * (-1803.182) (-1804.888) [-1802.889] (-1802.494) -- 0:00:33
650000 -- (-1807.843) (-1803.919) (-1804.598) [-1804.354] * (-1806.189) (-1804.527) (-1804.974) [-1803.684] -- 0:00:33
Average standard deviation of split frequencies: 0.009418
650500 -- (-1813.588) (-1802.769) (-1804.316) [-1806.054] * (-1806.554) (-1806.313) [-1804.369] (-1802.854) -- 0:00:33
651000 -- (-1812.626) [-1806.016] (-1807.053) (-1808.887) * (-1806.761) (-1803.777) (-1804.171) [-1803.563] -- 0:00:33
651500 -- (-1805.436) [-1805.196] (-1803.973) (-1806.554) * (-1803.297) (-1804.471) [-1803.535] (-1803.178) -- 0:00:33
652000 -- (-1803.142) (-1810.990) (-1804.771) [-1803.721] * (-1805.821) (-1804.919) (-1804.003) [-1804.814] -- 0:00:33
652500 -- (-1802.306) (-1809.978) (-1804.585) [-1804.326] * (-1803.978) (-1804.153) (-1804.857) [-1803.343] -- 0:00:33
653000 -- (-1807.723) [-1803.526] (-1803.625) (-1806.938) * (-1803.487) (-1805.042) [-1803.125] (-1804.013) -- 0:00:33
653500 -- (-1805.836) (-1804.536) [-1804.717] (-1805.688) * (-1806.119) (-1802.710) (-1804.324) [-1803.993] -- 0:00:33
654000 -- [-1804.317] (-1802.518) (-1806.536) (-1805.694) * (-1804.664) [-1802.909] (-1805.991) (-1804.150) -- 0:00:33
654500 -- (-1805.627) (-1804.906) [-1804.656] (-1806.255) * (-1803.918) [-1803.626] (-1805.001) (-1804.195) -- 0:00:33
655000 -- (-1805.318) (-1803.181) (-1808.709) [-1807.550] * (-1803.076) [-1802.846] (-1807.503) (-1803.418) -- 0:00:33
Average standard deviation of split frequencies: 0.009629
655500 -- (-1803.468) [-1803.010] (-1803.737) (-1806.261) * (-1805.246) [-1805.231] (-1804.725) (-1804.511) -- 0:00:33
656000 -- (-1802.743) (-1802.368) (-1806.867) [-1803.094] * (-1804.967) (-1805.147) [-1802.955] (-1805.241) -- 0:00:33
656500 -- [-1803.311] (-1807.036) (-1808.262) (-1803.001) * (-1801.959) [-1809.191] (-1802.155) (-1806.113) -- 0:00:32
657000 -- (-1805.328) (-1802.636) (-1806.294) [-1804.386] * (-1805.560) (-1805.275) (-1803.960) [-1806.036] -- 0:00:32
657500 -- (-1806.364) (-1805.988) [-1806.779] (-1805.387) * (-1803.943) (-1807.903) (-1805.911) [-1804.253] -- 0:00:32
658000 -- (-1803.207) [-1806.644] (-1805.426) (-1805.037) * (-1803.892) (-1809.429) (-1803.875) [-1803.580] -- 0:00:32
658500 -- (-1805.322) (-1804.176) (-1807.425) [-1803.733] * (-1806.329) (-1803.482) [-1804.170] (-1805.493) -- 0:00:32
659000 -- (-1807.434) (-1805.921) (-1803.205) [-1805.854] * (-1804.733) (-1806.168) [-1804.243] (-1806.947) -- 0:00:32
659500 -- [-1805.407] (-1806.736) (-1807.994) (-1805.488) * [-1803.726] (-1802.666) (-1804.240) (-1807.706) -- 0:00:32
660000 -- (-1802.618) (-1809.388) (-1804.146) [-1804.545] * (-1803.369) (-1804.453) (-1804.740) [-1804.728] -- 0:00:32
Average standard deviation of split frequencies: 0.008848
660500 -- (-1804.588) (-1805.574) (-1804.278) [-1803.333] * (-1806.574) (-1805.833) [-1805.317] (-1804.679) -- 0:00:32
661000 -- (-1804.046) [-1804.835] (-1803.634) (-1803.306) * (-1805.729) [-1806.347] (-1804.256) (-1804.678) -- 0:00:32
661500 -- (-1803.838) (-1803.608) (-1803.379) [-1805.578] * (-1803.939) (-1804.314) [-1803.715] (-1809.345) -- 0:00:32
662000 -- (-1809.570) [-1804.040] (-1804.141) (-1803.422) * [-1802.664] (-1806.165) (-1802.810) (-1804.173) -- 0:00:32
662500 -- (-1804.684) (-1803.560) [-1803.668] (-1803.339) * (-1802.411) [-1803.607] (-1804.842) (-1807.247) -- 0:00:32
663000 -- [-1805.419] (-1804.093) (-1803.243) (-1804.787) * (-1804.587) (-1804.384) [-1802.821] (-1802.713) -- 0:00:32
663500 -- (-1803.514) (-1803.841) [-1802.687] (-1803.705) * (-1802.970) (-1805.533) (-1808.554) [-1803.085] -- 0:00:32
664000 -- (-1804.791) (-1804.358) [-1806.798] (-1805.233) * (-1803.449) [-1802.956] (-1803.563) (-1803.292) -- 0:00:32
664500 -- [-1805.033] (-1802.989) (-1803.505) (-1807.107) * (-1804.584) (-1805.382) (-1805.530) [-1803.384] -- 0:00:32
665000 -- (-1803.963) [-1805.986] (-1803.433) (-1807.376) * (-1802.741) (-1803.823) (-1803.197) [-1803.183] -- 0:00:32
Average standard deviation of split frequencies: 0.008635
665500 -- [-1804.150] (-1803.607) (-1803.450) (-1804.863) * [-1802.578] (-1805.090) (-1804.092) (-1805.377) -- 0:00:32
666000 -- (-1806.917) (-1803.438) (-1803.997) [-1803.768] * (-1803.660) (-1806.961) [-1803.978] (-1806.332) -- 0:00:32
666500 -- (-1804.039) (-1803.033) [-1805.052] (-1804.703) * [-1802.971] (-1804.848) (-1802.818) (-1807.247) -- 0:00:32
667000 -- (-1802.952) [-1801.988] (-1804.932) (-1805.619) * (-1803.638) (-1804.868) (-1802.797) [-1806.091] -- 0:00:31
667500 -- (-1803.817) (-1803.193) (-1806.348) [-1806.475] * (-1804.953) [-1804.862] (-1803.252) (-1808.132) -- 0:00:31
668000 -- (-1807.192) (-1806.492) [-1805.281] (-1804.596) * (-1803.999) (-1804.565) (-1804.732) [-1805.102] -- 0:00:31
668500 -- (-1807.039) [-1806.855] (-1804.579) (-1804.151) * (-1806.488) (-1801.945) (-1802.491) [-1804.352] -- 0:00:31
669000 -- (-1803.602) (-1807.260) [-1804.732] (-1804.850) * [-1808.401] (-1802.980) (-1803.977) (-1807.133) -- 0:00:31
669500 -- (-1804.242) [-1803.627] (-1804.837) (-1802.619) * (-1804.760) (-1804.204) (-1804.206) [-1804.946] -- 0:00:31
670000 -- (-1806.833) (-1804.213) [-1804.708] (-1807.730) * (-1807.399) (-1802.599) (-1805.473) [-1803.244] -- 0:00:32
Average standard deviation of split frequencies: 0.008294
670500 -- [-1803.942] (-1806.029) (-1803.331) (-1807.547) * [-1804.401] (-1802.856) (-1804.324) (-1806.017) -- 0:00:31
671000 -- (-1804.959) (-1807.062) [-1804.724] (-1804.295) * [-1802.046] (-1803.416) (-1803.812) (-1803.844) -- 0:00:31
671500 -- (-1804.016) (-1805.188) [-1803.838] (-1805.394) * (-1803.610) (-1804.845) (-1808.972) [-1803.405] -- 0:00:31
672000 -- [-1807.106] (-1804.333) (-1804.181) (-1802.296) * (-1805.307) [-1803.126] (-1805.214) (-1806.366) -- 0:00:31
672500 -- [-1807.246] (-1806.640) (-1804.217) (-1804.259) * [-1804.641] (-1804.734) (-1805.266) (-1809.765) -- 0:00:31
673000 -- (-1803.210) [-1808.073] (-1804.355) (-1803.186) * (-1804.610) [-1804.734] (-1806.831) (-1804.920) -- 0:00:31
673500 -- [-1807.755] (-1803.377) (-1803.268) (-1804.164) * (-1806.187) [-1804.272] (-1807.409) (-1807.959) -- 0:00:31
674000 -- (-1806.914) [-1803.186] (-1803.239) (-1809.267) * (-1803.888) (-1802.411) (-1803.980) [-1806.993] -- 0:00:31
674500 -- (-1806.261) (-1804.534) (-1806.345) [-1806.138] * (-1804.299) [-1806.972] (-1804.630) (-1803.177) -- 0:00:31
675000 -- (-1807.840) (-1802.977) (-1806.931) [-1805.382] * (-1807.401) (-1805.002) [-1803.106] (-1806.312) -- 0:00:31
Average standard deviation of split frequencies: 0.008368
675500 -- (-1804.069) (-1806.108) [-1802.965] (-1803.030) * (-1807.391) (-1805.619) (-1804.173) [-1807.095] -- 0:00:31
676000 -- (-1803.930) (-1802.381) (-1803.955) [-1803.585] * [-1804.039] (-1803.662) (-1807.235) (-1811.658) -- 0:00:31
676500 -- [-1804.531] (-1807.151) (-1803.880) (-1802.768) * [-1804.809] (-1804.109) (-1806.957) (-1803.702) -- 0:00:31
677000 -- [-1803.921] (-1806.035) (-1806.064) (-1804.199) * (-1804.960) (-1807.330) (-1806.282) [-1805.213] -- 0:00:31
677500 -- (-1805.245) [-1805.812] (-1808.151) (-1803.347) * [-1803.711] (-1803.986) (-1806.500) (-1804.329) -- 0:00:30
678000 -- (-1805.707) (-1804.623) [-1804.428] (-1802.881) * [-1803.483] (-1804.817) (-1804.263) (-1806.151) -- 0:00:30
678500 -- (-1803.310) (-1805.737) (-1806.357) [-1807.667] * (-1803.060) [-1804.970] (-1804.402) (-1804.765) -- 0:00:30
679000 -- (-1804.601) (-1804.007) (-1806.381) [-1809.387] * [-1803.538] (-1807.569) (-1806.991) (-1803.920) -- 0:00:31
679500 -- (-1803.287) [-1803.996] (-1809.910) (-1803.390) * [-1806.516] (-1804.749) (-1806.689) (-1805.149) -- 0:00:31
680000 -- [-1804.791] (-1806.620) (-1806.306) (-1806.121) * (-1805.505) (-1806.126) (-1805.780) [-1803.448] -- 0:00:31
Average standard deviation of split frequencies: 0.008726
680500 -- (-1804.808) (-1806.908) (-1807.785) [-1804.920] * (-1803.555) (-1804.370) (-1805.194) [-1804.950] -- 0:00:30
681000 -- [-1804.449] (-1804.234) (-1806.223) (-1805.309) * (-1803.070) [-1804.340] (-1803.393) (-1804.971) -- 0:00:30
681500 -- (-1806.622) (-1804.268) [-1805.269] (-1808.544) * (-1802.270) (-1806.149) [-1802.726] (-1807.898) -- 0:00:30
682000 -- (-1806.319) [-1803.895] (-1807.374) (-1803.783) * (-1803.173) (-1803.169) [-1802.655] (-1803.413) -- 0:00:30
682500 -- (-1804.826) (-1803.624) (-1805.563) [-1805.455] * (-1803.777) (-1804.516) (-1804.041) [-1804.938] -- 0:00:30
683000 -- (-1805.116) [-1803.559] (-1806.454) (-1803.527) * (-1803.419) (-1804.183) [-1802.973] (-1803.711) -- 0:00:30
683500 -- (-1804.778) [-1803.152] (-1803.466) (-1806.743) * (-1804.529) [-1803.509] (-1803.036) (-1804.299) -- 0:00:30
684000 -- (-1803.867) (-1803.934) (-1802.888) [-1809.069] * (-1804.874) (-1803.492) [-1802.772] (-1804.232) -- 0:00:30
684500 -- (-1802.969) [-1803.046] (-1803.638) (-1804.236) * (-1805.700) (-1806.665) (-1804.538) [-1806.096] -- 0:00:30
685000 -- [-1803.864] (-1803.510) (-1802.994) (-1804.297) * [-1804.762] (-1808.679) (-1804.423) (-1805.448) -- 0:00:30
Average standard deviation of split frequencies: 0.008246
685500 -- [-1803.192] (-1805.924) (-1806.729) (-1805.802) * (-1803.713) (-1804.342) [-1803.770] (-1804.953) -- 0:00:30
686000 -- (-1805.782) (-1803.466) [-1804.758] (-1805.798) * (-1803.690) [-1809.550] (-1804.066) (-1805.005) -- 0:00:30
686500 -- (-1806.029) (-1808.480) [-1805.752] (-1803.301) * (-1807.462) [-1802.894] (-1804.523) (-1805.636) -- 0:00:30
687000 -- (-1806.243) (-1809.232) (-1809.394) [-1803.254] * (-1806.381) (-1804.203) [-1802.843] (-1805.821) -- 0:00:30
687500 -- (-1805.149) (-1806.728) (-1807.235) [-1803.455] * (-1806.319) (-1804.004) (-1804.094) [-1804.179] -- 0:00:30
688000 -- [-1803.832] (-1802.902) (-1805.801) (-1803.905) * (-1806.188) (-1804.231) (-1804.330) [-1803.160] -- 0:00:29
688500 -- (-1802.641) [-1802.420] (-1804.829) (-1804.065) * (-1805.292) (-1804.309) (-1806.124) [-1804.741] -- 0:00:30
689000 -- (-1805.340) (-1802.824) (-1804.887) [-1807.971] * (-1805.288) (-1805.170) (-1804.407) [-1803.554] -- 0:00:30
689500 -- [-1805.031] (-1804.081) (-1805.187) (-1807.973) * (-1803.125) (-1803.313) [-1802.874] (-1803.595) -- 0:00:30
690000 -- (-1802.970) [-1804.098] (-1809.004) (-1804.652) * [-1807.050] (-1807.591) (-1802.695) (-1802.906) -- 0:00:30
Average standard deviation of split frequencies: 0.008054
690500 -- [-1803.997] (-1803.231) (-1810.829) (-1804.928) * (-1804.520) (-1803.243) (-1802.816) [-1804.145] -- 0:00:30
691000 -- (-1807.371) (-1802.935) [-1802.546] (-1804.471) * (-1806.026) [-1804.834] (-1803.576) (-1804.676) -- 0:00:29
691500 -- (-1804.160) (-1804.181) (-1805.900) [-1805.950] * [-1806.113] (-1806.607) (-1802.475) (-1803.501) -- 0:00:29
692000 -- (-1805.733) (-1802.082) [-1804.649] (-1804.346) * (-1804.019) (-1811.078) (-1804.895) [-1803.588] -- 0:00:29
692500 -- (-1809.053) (-1803.175) (-1804.819) [-1802.868] * (-1804.680) [-1805.641] (-1805.065) (-1805.714) -- 0:00:29
693000 -- [-1808.071] (-1803.469) (-1805.519) (-1804.832) * (-1805.959) (-1805.493) [-1805.863] (-1806.143) -- 0:00:29
693500 -- (-1808.719) [-1807.166] (-1804.682) (-1805.139) * (-1805.543) (-1806.329) [-1806.971] (-1806.664) -- 0:00:29
694000 -- (-1807.047) (-1806.719) (-1804.227) [-1804.174] * (-1805.236) [-1803.514] (-1804.603) (-1803.411) -- 0:00:29
694500 -- (-1805.271) (-1805.568) (-1801.938) [-1807.095] * (-1804.049) [-1802.965] (-1806.490) (-1805.221) -- 0:00:29
695000 -- (-1803.299) (-1808.161) (-1803.821) [-1811.180] * [-1805.360] (-1803.653) (-1808.242) (-1802.718) -- 0:00:29
Average standard deviation of split frequencies: 0.008263
695500 -- (-1807.227) (-1807.676) [-1801.841] (-1804.814) * (-1807.579) (-1804.565) (-1805.446) [-1803.278] -- 0:00:29
696000 -- (-1804.095) (-1803.852) [-1806.874] (-1804.224) * (-1809.738) (-1804.988) (-1809.861) [-1804.289] -- 0:00:29
696500 -- [-1804.336] (-1803.325) (-1802.851) (-1804.333) * (-1804.174) (-1803.457) [-1806.453] (-1805.868) -- 0:00:29
697000 -- (-1803.223) (-1804.430) [-1804.254] (-1804.285) * (-1805.358) (-1803.408) [-1805.688] (-1803.552) -- 0:00:29
697500 -- [-1803.054] (-1802.727) (-1804.267) (-1803.794) * (-1807.477) [-1803.352] (-1804.342) (-1803.995) -- 0:00:29
698000 -- (-1803.354) (-1803.217) (-1805.663) [-1803.235] * (-1810.405) (-1803.707) (-1804.550) [-1806.200] -- 0:00:29
698500 -- [-1803.867] (-1802.837) (-1802.179) (-1803.623) * (-1803.494) (-1805.780) [-1804.532] (-1805.746) -- 0:00:29
699000 -- (-1803.047) [-1805.150] (-1804.577) (-1806.771) * [-1807.919] (-1810.726) (-1805.049) (-1806.222) -- 0:00:29
699500 -- [-1803.844] (-1803.508) (-1807.473) (-1802.911) * [-1806.095] (-1809.362) (-1802.709) (-1805.572) -- 0:00:29
700000 -- [-1804.959] (-1803.920) (-1803.985) (-1803.456) * (-1805.044) (-1802.884) (-1809.565) [-1803.800] -- 0:00:29
Average standard deviation of split frequencies: 0.007535
700500 -- [-1803.740] (-1803.129) (-1805.003) (-1804.722) * [-1803.221] (-1805.094) (-1808.634) (-1804.552) -- 0:00:29
701000 -- (-1807.216) (-1807.664) (-1803.869) [-1802.679] * (-1802.524) [-1803.483] (-1805.587) (-1803.297) -- 0:00:29
701500 -- (-1806.373) (-1803.527) (-1809.478) [-1805.044] * [-1805.777] (-1805.257) (-1806.585) (-1805.292) -- 0:00:28
702000 -- (-1806.000) (-1805.131) [-1803.384] (-1806.731) * (-1804.432) (-1805.436) [-1803.480] (-1803.560) -- 0:00:28
702500 -- (-1807.628) (-1807.377) [-1808.721] (-1804.365) * [-1803.948] (-1805.318) (-1803.255) (-1804.314) -- 0:00:28
703000 -- (-1804.814) (-1806.888) (-1805.090) [-1805.145] * (-1804.898) (-1811.240) [-1803.210] (-1807.965) -- 0:00:28
703500 -- [-1803.390] (-1803.209) (-1802.731) (-1807.497) * [-1806.884] (-1809.324) (-1811.294) (-1806.180) -- 0:00:28
704000 -- (-1803.344) (-1807.887) (-1803.282) [-1803.724] * (-1806.220) (-1803.858) [-1803.327] (-1808.113) -- 0:00:28
704500 -- (-1804.715) [-1802.446] (-1805.421) (-1805.942) * [-1803.503] (-1803.913) (-1803.959) (-1806.558) -- 0:00:28
705000 -- (-1809.463) (-1803.882) [-1805.429] (-1805.984) * (-1803.947) (-1804.138) [-1805.206] (-1804.402) -- 0:00:28
Average standard deviation of split frequencies: 0.007879
705500 -- (-1803.245) (-1806.133) (-1804.652) [-1804.360] * [-1804.335] (-1803.568) (-1804.908) (-1803.899) -- 0:00:28
706000 -- [-1804.080] (-1806.228) (-1804.307) (-1803.837) * (-1806.072) (-1803.183) [-1804.650] (-1804.994) -- 0:00:28
706500 -- (-1803.460) [-1803.932] (-1805.152) (-1805.292) * (-1808.245) [-1802.900] (-1803.261) (-1806.189) -- 0:00:28
707000 -- (-1805.597) (-1807.696) (-1804.137) [-1803.396] * [-1807.952] (-1806.465) (-1803.546) (-1811.895) -- 0:00:28
707500 -- (-1803.343) (-1803.913) [-1804.143] (-1803.917) * (-1804.139) (-1804.515) [-1804.460] (-1807.000) -- 0:00:28
708000 -- (-1805.047) (-1808.098) [-1802.873] (-1809.797) * (-1804.030) [-1803.420] (-1804.644) (-1809.040) -- 0:00:28
708500 -- (-1802.867) [-1802.526] (-1803.596) (-1807.030) * [-1803.228] (-1803.636) (-1812.752) (-1808.454) -- 0:00:28
709000 -- (-1803.456) [-1804.185] (-1803.406) (-1803.089) * (-1810.751) (-1806.306) (-1806.061) [-1802.922] -- 0:00:28
709500 -- (-1805.580) (-1804.168) [-1802.258] (-1803.579) * (-1808.925) (-1804.907) (-1803.733) [-1806.066] -- 0:00:28
710000 -- (-1804.446) [-1803.640] (-1803.342) (-1804.550) * [-1804.077] (-1804.009) (-1803.658) (-1804.354) -- 0:00:28
Average standard deviation of split frequencies: 0.007429
710500 -- [-1803.240] (-1803.134) (-1804.206) (-1802.444) * (-1803.077) (-1802.878) (-1802.916) [-1804.748] -- 0:00:28
711000 -- [-1802.167] (-1803.540) (-1804.411) (-1806.055) * (-1803.238) (-1803.178) (-1802.996) [-1802.700] -- 0:00:28
711500 -- (-1804.124) (-1804.439) (-1807.907) [-1807.928] * (-1803.383) [-1804.308] (-1802.724) (-1802.333) -- 0:00:27
712000 -- (-1804.088) [-1804.593] (-1804.336) (-1808.059) * (-1805.355) (-1804.893) (-1804.733) [-1803.343] -- 0:00:27
712500 -- (-1805.830) [-1802.720] (-1805.171) (-1806.741) * [-1804.480] (-1805.077) (-1804.256) (-1803.418) -- 0:00:27
713000 -- (-1806.179) (-1804.022) (-1808.605) [-1803.823] * (-1805.551) (-1804.522) [-1803.607] (-1805.106) -- 0:00:27
713500 -- (-1806.294) (-1804.390) (-1805.079) [-1804.052] * (-1803.835) (-1802.881) [-1804.443] (-1803.844) -- 0:00:27
714000 -- (-1802.304) (-1803.317) (-1805.412) [-1802.716] * (-1804.277) (-1803.134) [-1804.967] (-1813.629) -- 0:00:27
714500 -- (-1803.995) [-1804.307] (-1808.933) (-1803.296) * [-1803.947] (-1804.340) (-1803.132) (-1804.203) -- 0:00:27
715000 -- [-1804.499] (-1803.889) (-1803.013) (-1805.795) * [-1803.759] (-1805.634) (-1804.845) (-1807.672) -- 0:00:27
Average standard deviation of split frequencies: 0.007111
715500 -- (-1803.265) [-1804.209] (-1803.079) (-1803.620) * (-1805.611) [-1807.835] (-1803.249) (-1803.443) -- 0:00:27
716000 -- [-1802.345] (-1803.999) (-1804.906) (-1802.708) * (-1806.357) (-1803.671) (-1806.547) [-1805.116] -- 0:00:27
716500 -- [-1804.470] (-1803.215) (-1804.841) (-1804.753) * [-1806.200] (-1803.802) (-1805.747) (-1804.664) -- 0:00:27
717000 -- (-1805.191) [-1802.985] (-1805.565) (-1803.008) * (-1805.459) (-1803.416) (-1804.917) [-1803.356] -- 0:00:27
717500 -- (-1804.840) (-1805.683) (-1805.560) [-1803.850] * (-1803.525) (-1802.842) (-1806.337) [-1803.174] -- 0:00:27
718000 -- (-1805.758) [-1803.260] (-1805.276) (-1809.048) * (-1806.408) (-1804.432) (-1804.237) [-1805.178] -- 0:00:27
718500 -- [-1803.437] (-1804.290) (-1803.475) (-1804.108) * (-1803.585) (-1803.594) (-1807.894) [-1803.238] -- 0:00:27
719000 -- [-1804.525] (-1802.953) (-1803.903) (-1804.034) * [-1802.845] (-1805.692) (-1803.944) (-1805.324) -- 0:00:27
719500 -- (-1806.101) (-1805.165) [-1805.599] (-1805.036) * (-1810.728) (-1804.519) (-1803.183) [-1803.500] -- 0:00:27
720000 -- (-1806.483) [-1804.786] (-1807.292) (-1804.442) * (-1802.958) (-1809.562) [-1803.430] (-1802.917) -- 0:00:27
Average standard deviation of split frequencies: 0.006934
720500 -- (-1803.695) (-1805.032) [-1809.269] (-1802.576) * (-1803.783) (-1804.749) (-1805.555) [-1804.645] -- 0:00:27
721000 -- (-1803.764) (-1802.357) (-1813.059) [-1804.880] * (-1808.193) [-1805.336] (-1805.788) (-1804.226) -- 0:00:27
721500 -- (-1804.004) (-1803.280) [-1809.324] (-1807.789) * (-1809.643) (-1803.989) [-1803.815] (-1804.112) -- 0:00:27
722000 -- (-1804.534) (-1804.457) (-1802.741) [-1808.539] * (-1805.024) (-1803.770) (-1806.062) [-1803.403] -- 0:00:26
722500 -- (-1802.797) [-1803.149] (-1803.528) (-1805.307) * [-1808.276] (-1804.548) (-1804.516) (-1803.186) -- 0:00:26
723000 -- (-1804.081) (-1806.525) [-1806.902] (-1804.215) * (-1805.580) [-1804.944] (-1804.721) (-1804.938) -- 0:00:26
723500 -- [-1805.526] (-1805.847) (-1803.892) (-1802.811) * [-1808.842] (-1803.176) (-1805.237) (-1803.786) -- 0:00:26
724000 -- (-1803.287) [-1803.033] (-1805.900) (-1804.768) * (-1806.987) (-1803.234) (-1805.763) [-1802.535] -- 0:00:26
724500 -- (-1805.294) [-1804.787] (-1805.919) (-1809.253) * (-1803.801) (-1808.966) [-1805.562] (-1803.079) -- 0:00:26
725000 -- [-1803.722] (-1805.590) (-1802.781) (-1807.193) * (-1805.360) (-1808.073) (-1804.458) [-1804.649] -- 0:00:26
Average standard deviation of split frequencies: 0.006753
725500 -- [-1805.294] (-1804.725) (-1802.693) (-1804.358) * (-1805.531) (-1805.756) (-1802.843) [-1804.061] -- 0:00:26
726000 -- (-1804.659) [-1803.481] (-1803.864) (-1804.267) * (-1804.781) (-1805.960) [-1804.152] (-1803.191) -- 0:00:26
726500 -- [-1802.153] (-1804.134) (-1804.210) (-1808.327) * (-1804.109) [-1802.742] (-1805.300) (-1806.696) -- 0:00:26
727000 -- [-1807.252] (-1803.228) (-1805.285) (-1805.421) * (-1803.328) [-1803.382] (-1806.766) (-1808.730) -- 0:00:26
727500 -- (-1805.084) [-1803.104] (-1805.454) (-1805.673) * (-1804.241) [-1803.946] (-1804.406) (-1805.294) -- 0:00:26
728000 -- (-1803.233) (-1803.859) [-1804.472] (-1805.022) * (-1804.578) (-1804.154) (-1804.666) [-1803.408] -- 0:00:26
728500 -- (-1804.748) (-1804.448) [-1803.364] (-1803.594) * (-1805.181) (-1805.664) [-1804.345] (-1809.410) -- 0:00:26
729000 -- [-1805.750] (-1803.724) (-1802.968) (-1802.825) * [-1805.270] (-1805.091) (-1804.481) (-1805.146) -- 0:00:26
729500 -- [-1803.437] (-1804.743) (-1804.225) (-1803.281) * [-1806.397] (-1805.129) (-1807.838) (-1804.529) -- 0:00:26
730000 -- [-1804.617] (-1807.274) (-1804.564) (-1803.127) * (-1804.305) (-1805.152) [-1805.799] (-1803.758) -- 0:00:26
Average standard deviation of split frequencies: 0.006581
730500 -- [-1805.395] (-1805.313) (-1802.567) (-1804.437) * (-1807.065) (-1806.168) [-1806.252] (-1803.284) -- 0:00:26
731000 -- [-1806.465] (-1803.702) (-1806.362) (-1802.982) * (-1805.624) (-1810.441) [-1803.018] (-1805.121) -- 0:00:26
731500 -- [-1804.643] (-1803.354) (-1804.738) (-1803.461) * [-1806.591] (-1803.495) (-1803.682) (-1805.851) -- 0:00:26
732000 -- (-1804.135) [-1803.398] (-1807.641) (-1805.526) * [-1804.562] (-1805.065) (-1803.974) (-1804.973) -- 0:00:25
732500 -- (-1802.907) [-1804.526] (-1809.423) (-1803.323) * [-1803.885] (-1805.901) (-1804.428) (-1808.355) -- 0:00:25
733000 -- (-1803.548) (-1806.358) (-1803.494) [-1803.360] * (-1803.060) (-1805.692) (-1805.347) [-1804.729] -- 0:00:25
733500 -- (-1803.267) (-1803.517) [-1804.615] (-1804.835) * (-1803.395) [-1803.585] (-1802.563) (-1806.346) -- 0:00:25
734000 -- (-1804.247) (-1804.030) [-1803.621] (-1806.313) * (-1804.064) (-1803.891) [-1803.416] (-1806.249) -- 0:00:25
734500 -- [-1807.606] (-1806.218) (-1805.283) (-1804.142) * (-1804.812) [-1804.715] (-1804.681) (-1806.141) -- 0:00:25
735000 -- (-1806.825) (-1804.298) (-1809.914) [-1803.335] * (-1805.366) (-1805.638) (-1802.993) [-1804.369] -- 0:00:25
Average standard deviation of split frequencies: 0.006533
735500 -- (-1809.595) (-1804.040) [-1803.668] (-1804.669) * (-1806.123) (-1803.925) (-1802.946) [-1803.853] -- 0:00:25
736000 -- [-1804.859] (-1805.076) (-1803.487) (-1803.450) * (-1805.103) (-1804.166) (-1803.290) [-1805.226] -- 0:00:25
736500 -- [-1803.738] (-1803.883) (-1802.146) (-1804.022) * (-1804.780) (-1805.921) [-1803.424] (-1803.228) -- 0:00:25
737000 -- (-1805.083) (-1805.701) (-1803.036) [-1804.356] * [-1804.152] (-1802.477) (-1803.902) (-1805.359) -- 0:00:25
737500 -- [-1806.779] (-1808.222) (-1804.247) (-1807.670) * (-1805.176) (-1807.293) [-1802.560] (-1806.965) -- 0:00:25
738000 -- [-1803.463] (-1810.022) (-1805.502) (-1803.799) * [-1803.308] (-1812.262) (-1804.450) (-1805.253) -- 0:00:25
738500 -- (-1805.775) (-1802.751) (-1811.281) [-1802.527] * (-1803.264) (-1806.847) (-1803.055) [-1803.007] -- 0:00:25
739000 -- (-1808.241) [-1803.020] (-1804.008) (-1803.518) * (-1803.930) [-1804.844] (-1802.908) (-1802.546) -- 0:00:25
739500 -- (-1808.192) (-1803.312) (-1806.546) [-1803.633] * (-1803.571) [-1803.712] (-1802.713) (-1803.773) -- 0:00:25
740000 -- (-1805.728) [-1803.289] (-1810.135) (-1808.497) * (-1804.001) [-1804.282] (-1803.332) (-1803.931) -- 0:00:25
Average standard deviation of split frequencies: 0.006365
740500 -- (-1806.312) (-1802.366) [-1806.382] (-1805.771) * [-1801.860] (-1803.050) (-1805.010) (-1804.675) -- 0:00:25
741000 -- (-1803.463) (-1807.024) [-1802.552] (-1804.214) * (-1803.974) (-1803.977) [-1805.836] (-1805.068) -- 0:00:25
741500 -- (-1806.536) (-1802.901) (-1805.662) [-1804.469] * (-1803.115) [-1805.262] (-1803.036) (-1803.420) -- 0:00:25
742000 -- (-1805.407) (-1805.172) (-1806.217) [-1806.234] * (-1802.565) [-1805.333] (-1803.908) (-1803.641) -- 0:00:25
742500 -- (-1804.162) (-1806.418) [-1803.960] (-1803.464) * [-1806.442] (-1804.951) (-1805.589) (-1804.154) -- 0:00:24
743000 -- (-1804.372) (-1803.753) [-1806.470] (-1803.362) * (-1807.400) (-1804.396) [-1804.173] (-1803.454) -- 0:00:24
743500 -- (-1804.411) [-1802.227] (-1807.727) (-1804.897) * (-1803.636) [-1803.718] (-1804.599) (-1803.771) -- 0:00:24
744000 -- [-1804.444] (-1805.568) (-1803.921) (-1805.093) * (-1802.484) (-1808.462) (-1805.871) [-1804.390] -- 0:00:24
744500 -- (-1804.119) (-1807.049) [-1803.367] (-1803.806) * (-1804.828) [-1807.564] (-1804.268) (-1807.147) -- 0:00:24
745000 -- (-1808.488) (-1804.730) [-1803.071] (-1803.118) * (-1804.737) [-1806.653] (-1807.737) (-1803.284) -- 0:00:24
Average standard deviation of split frequencies: 0.006445
745500 -- (-1804.115) [-1803.594] (-1805.102) (-1803.161) * [-1804.746] (-1804.614) (-1805.956) (-1804.644) -- 0:00:24
746000 -- (-1808.661) [-1803.802] (-1807.167) (-1803.493) * (-1805.109) [-1805.218] (-1804.178) (-1808.312) -- 0:00:24
746500 -- [-1803.453] (-1803.365) (-1802.969) (-1803.002) * [-1803.525] (-1804.864) (-1805.687) (-1805.821) -- 0:00:24
747000 -- (-1805.250) [-1806.270] (-1803.261) (-1803.205) * (-1805.942) (-1805.542) [-1808.207] (-1806.410) -- 0:00:24
747500 -- [-1802.689] (-1802.819) (-1805.206) (-1803.381) * [-1805.512] (-1802.803) (-1803.599) (-1809.585) -- 0:00:24
748000 -- (-1803.885) (-1805.940) [-1803.794] (-1809.527) * (-1806.335) [-1803.997] (-1804.332) (-1807.179) -- 0:00:24
748500 -- (-1803.335) [-1804.903] (-1805.248) (-1803.616) * (-1805.203) [-1804.867] (-1804.693) (-1805.387) -- 0:00:24
749000 -- (-1803.231) [-1804.891] (-1804.420) (-1803.655) * [-1804.563] (-1804.838) (-1802.352) (-1806.360) -- 0:00:24
749500 -- (-1803.482) (-1805.542) (-1803.433) [-1803.234] * [-1803.516] (-1804.417) (-1804.448) (-1804.607) -- 0:00:24
750000 -- (-1805.550) (-1807.347) (-1804.593) [-1802.764] * [-1806.046] (-1804.889) (-1805.842) (-1805.792) -- 0:00:24
Average standard deviation of split frequencies: 0.006154
750500 -- (-1802.306) (-1811.199) [-1804.226] (-1805.032) * (-1805.483) (-1805.150) (-1802.508) [-1808.635] -- 0:00:24
751000 -- [-1803.764] (-1804.264) (-1807.002) (-1804.780) * (-1805.071) [-1804.587] (-1806.413) (-1803.829) -- 0:00:24
751500 -- (-1803.027) [-1805.144] (-1803.615) (-1803.297) * (-1806.812) (-1806.476) [-1805.755] (-1804.009) -- 0:00:24
752000 -- [-1805.093] (-1809.256) (-1803.240) (-1805.620) * (-1807.184) (-1804.446) (-1805.166) [-1803.288] -- 0:00:24
752500 -- (-1804.618) [-1803.299] (-1803.648) (-1803.859) * [-1805.163] (-1806.927) (-1805.056) (-1803.434) -- 0:00:24
753000 -- (-1808.881) [-1803.808] (-1806.118) (-1804.836) * (-1805.634) (-1804.123) (-1804.061) [-1803.218] -- 0:00:23
753500 -- (-1808.857) (-1803.898) [-1804.725] (-1804.798) * [-1803.893] (-1804.972) (-1803.389) (-1805.547) -- 0:00:23
754000 -- [-1804.460] (-1804.346) (-1802.955) (-1806.850) * (-1803.567) [-1804.360] (-1803.261) (-1806.034) -- 0:00:23
754500 -- (-1816.885) (-1805.923) (-1803.408) [-1804.018] * (-1806.559) (-1804.709) (-1807.207) [-1804.114] -- 0:00:23
755000 -- (-1809.860) [-1805.187] (-1803.598) (-1804.991) * (-1805.129) (-1803.666) [-1805.362] (-1803.129) -- 0:00:23
Average standard deviation of split frequencies: 0.005986
755500 -- (-1808.503) (-1803.221) [-1802.394] (-1803.577) * (-1807.039) [-1805.720] (-1803.814) (-1805.083) -- 0:00:23
756000 -- (-1807.622) (-1808.523) [-1802.841] (-1803.137) * (-1803.740) [-1804.778] (-1803.670) (-1802.780) -- 0:00:23
756500 -- [-1807.229] (-1805.662) (-1803.175) (-1802.347) * (-1805.250) [-1804.290] (-1804.518) (-1803.279) -- 0:00:23
757000 -- (-1803.760) (-1803.841) [-1803.532] (-1807.257) * (-1809.682) [-1805.159] (-1807.809) (-1805.266) -- 0:00:23
757500 -- [-1803.675] (-1804.516) (-1803.607) (-1803.915) * [-1802.483] (-1803.984) (-1807.770) (-1802.849) -- 0:00:23
758000 -- (-1804.721) (-1803.924) (-1803.419) [-1802.838] * [-1805.062] (-1803.473) (-1806.779) (-1804.246) -- 0:00:23
758500 -- (-1806.534) (-1804.521) (-1805.108) [-1805.198] * [-1809.682] (-1803.940) (-1803.605) (-1803.531) -- 0:00:23
759000 -- (-1804.808) (-1805.129) (-1806.082) [-1802.552] * (-1804.650) [-1803.859] (-1804.954) (-1805.013) -- 0:00:23
759500 -- (-1804.497) (-1803.811) [-1807.932] (-1806.672) * (-1802.971) (-1807.069) (-1803.539) [-1803.948] -- 0:00:23
760000 -- (-1803.895) (-1809.148) [-1804.889] (-1803.023) * (-1802.795) [-1804.994] (-1802.954) (-1804.372) -- 0:00:23
Average standard deviation of split frequencies: 0.006197
760500 -- (-1804.810) [-1802.846] (-1803.777) (-1805.616) * (-1803.403) (-1804.777) (-1805.817) [-1803.757] -- 0:00:23
761000 -- (-1803.431) (-1803.933) [-1804.381] (-1805.390) * (-1807.061) (-1805.111) (-1806.924) [-1804.760] -- 0:00:23
761500 -- [-1802.921] (-1803.684) (-1803.818) (-1808.645) * [-1808.687] (-1806.253) (-1806.191) (-1803.736) -- 0:00:23
762000 -- (-1803.528) [-1803.808] (-1804.340) (-1803.226) * (-1804.210) [-1804.822] (-1805.295) (-1806.188) -- 0:00:23
762500 -- (-1805.884) (-1803.586) (-1803.011) [-1803.845] * (-1805.765) (-1804.448) (-1803.887) [-1808.807] -- 0:00:23
763000 -- [-1803.432] (-1805.143) (-1802.983) (-1803.354) * [-1805.371] (-1804.359) (-1804.158) (-1803.535) -- 0:00:22
763500 -- [-1803.377] (-1803.818) (-1802.593) (-1803.203) * [-1803.719] (-1804.271) (-1804.450) (-1806.062) -- 0:00:22
764000 -- (-1804.593) (-1803.507) (-1803.178) [-1804.237] * (-1804.833) (-1803.915) [-1804.067] (-1809.146) -- 0:00:22
764500 -- [-1803.641] (-1803.877) (-1803.856) (-1803.808) * (-1809.164) (-1807.150) (-1804.874) [-1804.421] -- 0:00:22
765000 -- (-1804.452) (-1803.385) (-1804.833) [-1803.124] * (-1803.586) (-1803.090) [-1806.355] (-1805.650) -- 0:00:22
Average standard deviation of split frequencies: 0.006400
765500 -- (-1804.133) (-1804.747) [-1802.498] (-1806.392) * [-1803.858] (-1804.195) (-1804.650) (-1805.390) -- 0:00:22
766000 -- [-1804.204] (-1806.548) (-1807.337) (-1805.882) * (-1802.966) (-1803.040) (-1804.110) [-1801.520] -- 0:00:22
766500 -- (-1804.318) (-1804.461) [-1802.797] (-1803.606) * (-1805.378) [-1806.052] (-1804.495) (-1804.599) -- 0:00:22
767000 -- (-1806.653) [-1809.113] (-1802.985) (-1804.549) * (-1803.983) [-1803.658] (-1805.743) (-1807.039) -- 0:00:22
767500 -- [-1803.179] (-1804.517) (-1802.420) (-1803.989) * (-1805.521) (-1805.002) (-1804.407) [-1805.951] -- 0:00:22
768000 -- (-1804.736) (-1804.562) [-1804.445] (-1805.050) * (-1804.377) (-1803.971) [-1803.515] (-1806.105) -- 0:00:22
768500 -- [-1803.210] (-1807.970) (-1805.078) (-1804.834) * (-1803.660) (-1805.830) (-1808.177) [-1804.680] -- 0:00:22
769000 -- [-1803.570] (-1810.561) (-1803.959) (-1805.497) * (-1803.536) [-1803.954] (-1803.958) (-1805.223) -- 0:00:22
769500 -- (-1803.082) [-1803.451] (-1803.500) (-1805.066) * (-1804.426) (-1804.527) [-1803.911] (-1804.008) -- 0:00:22
770000 -- (-1804.674) (-1808.504) [-1807.466] (-1806.686) * [-1805.337] (-1803.988) (-1802.538) (-1804.598) -- 0:00:22
Average standard deviation of split frequencies: 0.006117
770500 -- [-1805.488] (-1807.257) (-1806.062) (-1803.815) * [-1806.481] (-1805.128) (-1803.368) (-1806.066) -- 0:00:22
771000 -- [-1803.902] (-1802.751) (-1805.845) (-1803.586) * [-1805.253] (-1805.681) (-1806.246) (-1804.425) -- 0:00:22
771500 -- (-1802.571) [-1805.463] (-1805.611) (-1804.989) * [-1809.649] (-1809.168) (-1805.151) (-1803.509) -- 0:00:22
772000 -- (-1804.819) [-1802.796] (-1806.381) (-1804.563) * (-1809.582) (-1802.869) (-1807.260) [-1803.296] -- 0:00:22
772500 -- (-1804.203) (-1802.375) [-1806.026] (-1805.908) * (-1805.571) [-1804.597] (-1804.846) (-1803.054) -- 0:00:22
773000 -- (-1804.337) (-1808.828) (-1803.441) [-1804.114] * [-1803.482] (-1805.262) (-1805.853) (-1804.740) -- 0:00:22
773500 -- (-1803.240) (-1809.243) (-1803.245) [-1802.690] * (-1803.458) (-1804.825) (-1806.187) [-1803.372] -- 0:00:21
774000 -- (-1805.348) (-1805.459) (-1809.505) [-1803.611] * (-1803.469) [-1804.663] (-1808.688) (-1803.032) -- 0:00:21
774500 -- (-1804.700) [-1803.103] (-1807.963) (-1804.079) * [-1804.411] (-1804.806) (-1804.744) (-1804.380) -- 0:00:21
775000 -- (-1808.712) (-1803.687) [-1809.069] (-1803.927) * (-1806.292) [-1803.915] (-1806.992) (-1805.093) -- 0:00:21
Average standard deviation of split frequencies: 0.005710
775500 -- (-1805.731) [-1805.912] (-1809.102) (-1804.285) * (-1808.074) [-1802.929] (-1803.284) (-1806.441) -- 0:00:21
776000 -- (-1803.475) (-1803.726) [-1806.289] (-1804.307) * (-1804.175) [-1804.199] (-1802.012) (-1804.259) -- 0:00:21
776500 -- (-1805.263) [-1803.473] (-1803.890) (-1808.140) * (-1804.300) [-1806.161] (-1803.781) (-1806.704) -- 0:00:21
777000 -- (-1804.180) [-1804.491] (-1802.304) (-1808.564) * (-1803.071) [-1805.833] (-1805.371) (-1806.430) -- 0:00:21
777500 -- [-1804.618] (-1804.922) (-1804.104) (-1805.713) * (-1804.333) [-1804.721] (-1803.100) (-1805.010) -- 0:00:21
778000 -- (-1804.141) (-1804.473) [-1802.844] (-1806.986) * [-1802.717] (-1806.930) (-1804.313) (-1805.620) -- 0:00:21
778500 -- (-1805.642) [-1803.810] (-1803.123) (-1809.535) * (-1805.397) (-1804.191) [-1804.213] (-1807.282) -- 0:00:21
779000 -- (-1803.297) [-1804.832] (-1802.531) (-1805.540) * [-1805.080] (-1805.241) (-1806.396) (-1808.421) -- 0:00:21
779500 -- (-1804.574) (-1802.792) [-1803.258] (-1804.598) * [-1804.473] (-1805.216) (-1806.163) (-1804.232) -- 0:00:21
780000 -- (-1805.207) (-1804.905) (-1802.663) [-1804.817] * (-1804.256) (-1811.567) [-1805.025] (-1803.544) -- 0:00:21
Average standard deviation of split frequencies: 0.006038
780500 -- [-1802.891] (-1804.957) (-1803.951) (-1804.338) * (-1812.614) (-1803.074) [-1806.937] (-1803.322) -- 0:00:21
781000 -- (-1803.505) [-1805.443] (-1809.969) (-1804.054) * (-1806.010) (-1803.466) [-1805.504] (-1803.459) -- 0:00:21
781500 -- (-1803.687) [-1809.288] (-1802.919) (-1804.949) * [-1803.125] (-1803.412) (-1805.948) (-1803.833) -- 0:00:21
782000 -- (-1804.153) (-1808.254) (-1804.791) [-1804.968] * (-1808.889) (-1804.036) (-1804.171) [-1803.480] -- 0:00:21
782500 -- (-1803.707) (-1811.593) [-1802.586] (-1804.519) * (-1803.728) (-1803.545) (-1805.870) [-1803.180] -- 0:00:21
783000 -- [-1805.329] (-1806.009) (-1804.025) (-1804.621) * [-1804.084] (-1805.457) (-1805.081) (-1806.830) -- 0:00:21
783500 -- (-1805.225) (-1805.561) (-1804.595) [-1803.849] * [-1803.145] (-1804.745) (-1804.702) (-1803.609) -- 0:00:21
784000 -- [-1803.300] (-1807.134) (-1805.216) (-1803.619) * (-1806.901) [-1805.028] (-1804.168) (-1803.963) -- 0:00:20
784500 -- [-1804.331] (-1803.755) (-1804.526) (-1804.848) * (-1803.340) (-1804.739) [-1803.324] (-1804.988) -- 0:00:20
785000 -- [-1803.534] (-1804.073) (-1804.239) (-1806.532) * [-1806.250] (-1804.942) (-1802.908) (-1803.525) -- 0:00:20
Average standard deviation of split frequencies: 0.005518
785500 -- [-1805.884] (-1805.602) (-1804.495) (-1804.667) * [-1803.089] (-1805.272) (-1802.846) (-1804.064) -- 0:00:20
786000 -- (-1804.479) (-1803.631) (-1803.129) [-1806.779] * (-1804.772) [-1803.526] (-1802.419) (-1804.421) -- 0:00:20
786500 -- (-1802.978) (-1802.718) (-1805.129) [-1805.010] * (-1803.495) (-1804.423) (-1805.583) [-1806.170] -- 0:00:20
787000 -- (-1803.201) (-1805.476) (-1804.031) [-1803.467] * (-1803.437) [-1803.626] (-1807.041) (-1805.417) -- 0:00:20
787500 -- (-1802.365) (-1802.702) (-1803.414) [-1806.095] * (-1803.621) (-1804.310) (-1803.290) [-1804.946] -- 0:00:20
788000 -- [-1808.825] (-1804.265) (-1807.067) (-1806.289) * (-1806.378) [-1803.557] (-1803.275) (-1806.131) -- 0:00:20
788500 -- [-1808.066] (-1805.068) (-1805.120) (-1804.411) * (-1805.815) (-1804.543) [-1805.604] (-1808.107) -- 0:00:20
789000 -- (-1805.584) (-1806.261) [-1803.329] (-1804.216) * [-1804.092] (-1806.371) (-1807.035) (-1809.590) -- 0:00:20
789500 -- (-1804.918) (-1807.664) (-1805.359) [-1808.791] * (-1804.596) (-1804.389) [-1804.559] (-1803.050) -- 0:00:20
790000 -- [-1802.709] (-1804.388) (-1808.786) (-1804.339) * (-1803.486) (-1803.204) [-1804.291] (-1803.893) -- 0:00:20
Average standard deviation of split frequencies: 0.005604
790500 -- (-1802.905) (-1805.259) [-1803.207] (-1804.982) * (-1804.089) (-1803.093) (-1804.184) [-1805.213] -- 0:00:20
791000 -- (-1805.043) [-1805.732] (-1802.925) (-1807.912) * (-1804.801) (-1802.637) [-1803.616] (-1807.333) -- 0:00:20
791500 -- (-1804.074) (-1803.254) (-1803.474) [-1804.723] * (-1803.653) (-1803.423) [-1803.448] (-1806.813) -- 0:00:20
792000 -- (-1807.100) (-1803.744) (-1803.137) [-1804.610] * [-1804.604] (-1803.694) (-1802.499) (-1803.495) -- 0:00:20
792500 -- [-1806.944] (-1808.113) (-1803.021) (-1804.156) * (-1804.112) (-1805.125) (-1802.837) [-1807.628] -- 0:00:20
793000 -- (-1804.451) [-1804.560] (-1805.158) (-1807.451) * (-1802.844) (-1803.045) [-1802.778] (-1806.181) -- 0:00:20
793500 -- (-1805.526) (-1803.599) (-1804.678) [-1804.181] * (-1803.690) (-1804.712) (-1804.356) [-1804.507] -- 0:00:20
794000 -- (-1803.616) (-1802.850) (-1806.765) [-1803.050] * (-1804.402) [-1802.971] (-1803.076) (-1805.635) -- 0:00:19
794500 -- [-1806.116] (-1804.164) (-1804.076) (-1803.660) * (-1805.820) (-1803.606) (-1808.056) [-1803.325] -- 0:00:19
795000 -- [-1804.820] (-1804.388) (-1806.338) (-1802.732) * [-1804.770] (-1804.190) (-1802.769) (-1807.097) -- 0:00:19
Average standard deviation of split frequencies: 0.005567
795500 -- (-1804.675) [-1802.606] (-1803.111) (-1804.998) * (-1803.320) [-1804.543] (-1803.464) (-1805.945) -- 0:00:19
796000 -- (-1806.879) (-1803.615) (-1803.590) [-1804.767] * [-1803.507] (-1809.365) (-1806.306) (-1809.014) -- 0:00:19
796500 -- (-1803.299) (-1802.521) [-1802.851] (-1803.737) * [-1805.370] (-1805.804) (-1803.851) (-1803.970) -- 0:00:19
797000 -- [-1804.142] (-1804.465) (-1803.451) (-1804.366) * [-1808.440] (-1805.924) (-1803.720) (-1805.599) -- 0:00:19
797500 -- (-1804.449) (-1803.593) (-1804.907) [-1804.556] * (-1805.739) (-1803.740) [-1804.060] (-1802.741) -- 0:00:19
798000 -- (-1803.791) [-1803.334] (-1804.247) (-1803.558) * (-1805.414) (-1803.799) (-1805.567) [-1802.269] -- 0:00:19
798500 -- [-1806.158] (-1803.092) (-1807.972) (-1804.081) * [-1805.239] (-1803.378) (-1803.526) (-1802.726) -- 0:00:19
799000 -- (-1805.355) (-1803.556) [-1804.875] (-1805.091) * (-1805.728) [-1803.307] (-1802.586) (-1804.307) -- 0:00:19
799500 -- (-1805.057) (-1804.759) [-1805.398] (-1803.208) * [-1803.928] (-1803.660) (-1804.758) (-1809.634) -- 0:00:19
800000 -- [-1803.634] (-1803.020) (-1804.779) (-1802.882) * (-1806.112) (-1805.649) (-1806.726) [-1804.560] -- 0:00:19
Average standard deviation of split frequencies: 0.005417
800500 -- (-1803.652) (-1803.271) (-1803.157) [-1803.383] * [-1805.056] (-1803.752) (-1803.950) (-1803.963) -- 0:00:19
801000 -- (-1809.451) (-1805.595) (-1802.517) [-1802.227] * (-1804.650) (-1803.726) (-1806.453) [-1802.487] -- 0:00:19
801500 -- (-1806.063) (-1803.097) [-1807.146] (-1803.726) * [-1804.196] (-1802.781) (-1804.775) (-1805.136) -- 0:00:19
802000 -- (-1803.909) (-1803.398) [-1806.660] (-1808.848) * [-1803.676] (-1806.721) (-1804.936) (-1806.008) -- 0:00:19
802500 -- (-1804.024) (-1803.469) [-1809.133] (-1810.221) * (-1803.264) (-1803.812) [-1805.679] (-1804.210) -- 0:00:18
803000 -- (-1802.907) (-1804.254) (-1802.376) [-1804.927] * (-1803.354) [-1804.343] (-1804.236) (-1805.066) -- 0:00:19
803500 -- (-1803.718) (-1804.697) (-1808.616) [-1802.249] * [-1803.090] (-1807.229) (-1806.555) (-1803.631) -- 0:00:19
804000 -- [-1803.428] (-1808.155) (-1804.590) (-1805.010) * (-1805.965) [-1805.099] (-1806.424) (-1805.414) -- 0:00:19
804500 -- (-1804.193) (-1804.122) (-1808.161) [-1803.588] * (-1805.113) (-1806.213) (-1805.700) [-1803.561] -- 0:00:18
805000 -- (-1805.983) [-1806.418] (-1804.611) (-1802.971) * (-1808.102) [-1803.833] (-1803.756) (-1804.065) -- 0:00:18
Average standard deviation of split frequencies: 0.005147
805500 -- [-1804.212] (-1803.785) (-1803.977) (-1806.593) * (-1810.337) [-1802.896] (-1809.611) (-1803.225) -- 0:00:18
806000 -- (-1803.584) (-1802.151) [-1809.384] (-1803.107) * (-1803.523) [-1802.078] (-1807.288) (-1803.730) -- 0:00:18
806500 -- (-1806.792) [-1803.017] (-1804.331) (-1803.379) * [-1803.168] (-1802.766) (-1805.397) (-1806.241) -- 0:00:18
807000 -- (-1808.948) [-1804.756] (-1802.165) (-1803.976) * [-1804.517] (-1802.384) (-1809.426) (-1804.355) -- 0:00:18
807500 -- (-1803.243) (-1804.224) [-1804.226] (-1806.096) * (-1804.012) [-1803.107] (-1803.923) (-1804.645) -- 0:00:18
808000 -- (-1803.746) (-1803.504) [-1803.212] (-1804.863) * (-1805.908) (-1806.590) [-1803.963] (-1807.744) -- 0:00:18
808500 -- (-1806.471) (-1805.555) [-1807.474] (-1805.100) * (-1808.208) [-1805.191] (-1807.140) (-1807.253) -- 0:00:18
809000 -- (-1806.224) (-1803.841) (-1807.107) [-1803.353] * (-1802.840) (-1805.689) [-1803.575] (-1806.631) -- 0:00:18
809500 -- (-1807.323) (-1805.131) [-1808.575] (-1808.329) * (-1807.028) (-1804.894) (-1802.997) [-1802.928] -- 0:00:18
810000 -- (-1806.446) [-1803.363] (-1806.476) (-1807.827) * (-1802.940) [-1804.596] (-1803.327) (-1804.679) -- 0:00:18
Average standard deviation of split frequencies: 0.005582
810500 -- [-1802.761] (-1807.379) (-1805.681) (-1805.539) * (-1803.036) (-1803.682) (-1807.042) [-1803.641] -- 0:00:18
811000 -- (-1804.571) (-1803.935) (-1811.428) [-1803.385] * [-1803.252] (-1807.785) (-1806.250) (-1803.852) -- 0:00:18
811500 -- [-1803.040] (-1804.516) (-1806.904) (-1804.439) * (-1804.151) (-1808.655) (-1805.220) [-1803.456] -- 0:00:18
812000 -- (-1803.540) [-1804.194] (-1803.981) (-1804.493) * (-1805.004) (-1806.071) [-1803.062] (-1802.881) -- 0:00:18
812500 -- (-1807.202) (-1805.356) [-1803.581] (-1804.548) * (-1807.263) (-1808.994) [-1803.620] (-1806.711) -- 0:00:18
813000 -- (-1808.315) (-1807.046) (-1803.589) [-1803.152] * (-1806.399) [-1805.537] (-1806.368) (-1804.533) -- 0:00:17
813500 -- (-1808.818) (-1805.776) (-1804.111) [-1804.293] * (-1804.418) (-1805.923) [-1803.589] (-1805.705) -- 0:00:18
814000 -- (-1802.664) (-1805.012) (-1802.502) [-1805.016] * (-1804.234) (-1803.643) (-1803.030) [-1803.657] -- 0:00:18
814500 -- (-1804.291) [-1804.716] (-1802.979) (-1804.520) * [-1803.375] (-1805.172) (-1803.910) (-1804.553) -- 0:00:17
815000 -- (-1804.628) (-1804.781) [-1804.319] (-1803.147) * (-1803.721) (-1805.027) [-1803.881] (-1803.447) -- 0:00:17
Average standard deviation of split frequencies: 0.005893
815500 -- (-1802.954) (-1804.674) (-1803.238) [-1805.125] * (-1805.588) (-1802.748) [-1804.209] (-1809.917) -- 0:00:17
816000 -- (-1804.028) (-1805.263) [-1803.381] (-1807.583) * (-1804.792) [-1803.232] (-1804.126) (-1801.639) -- 0:00:17
816500 -- (-1804.809) [-1803.255] (-1802.600) (-1808.941) * (-1803.837) [-1803.001] (-1804.385) (-1803.358) -- 0:00:17
817000 -- [-1803.441] (-1805.465) (-1803.255) (-1804.115) * (-1803.135) [-1803.983] (-1804.872) (-1804.584) -- 0:00:17
817500 -- (-1807.008) (-1802.511) [-1803.998] (-1804.724) * [-1805.825] (-1803.166) (-1806.226) (-1802.894) -- 0:00:17
818000 -- (-1804.177) (-1804.389) [-1802.673] (-1804.186) * (-1806.224) (-1805.632) (-1804.282) [-1804.981] -- 0:00:17
818500 -- (-1806.333) [-1803.070] (-1804.389) (-1804.148) * (-1804.137) (-1805.753) (-1805.563) [-1806.224] -- 0:00:17
819000 -- [-1803.187] (-1806.875) (-1805.972) (-1806.796) * (-1806.148) (-1803.280) [-1802.321] (-1807.810) -- 0:00:17
819500 -- (-1805.584) (-1805.911) (-1804.395) [-1803.935] * (-1806.075) (-1803.558) [-1806.318] (-1803.434) -- 0:00:17
820000 -- (-1803.749) (-1805.740) [-1802.556] (-1806.311) * (-1802.252) (-1806.976) (-1803.864) [-1803.655] -- 0:00:17
Average standard deviation of split frequencies: 0.005974
820500 -- [-1806.350] (-1806.836) (-1807.249) (-1804.500) * (-1804.193) [-1805.988] (-1803.610) (-1802.921) -- 0:00:17
821000 -- (-1804.175) (-1807.363) (-1805.092) [-1805.456] * (-1803.359) [-1805.487] (-1805.480) (-1805.189) -- 0:00:17
821500 -- (-1805.063) (-1806.434) [-1804.473] (-1805.955) * (-1803.032) (-1803.867) (-1807.204) [-1805.059] -- 0:00:17
822000 -- [-1804.743] (-1804.820) (-1803.793) (-1805.987) * (-1803.464) (-1802.823) (-1806.069) [-1803.995] -- 0:00:17
822500 -- (-1806.402) (-1803.044) (-1804.111) [-1805.097] * (-1805.455) (-1804.855) (-1807.458) [-1803.680] -- 0:00:17
823000 -- [-1803.797] (-1804.154) (-1803.637) (-1803.599) * (-1806.831) (-1803.860) (-1805.152) [-1803.801] -- 0:00:16
823500 -- (-1806.608) [-1804.761] (-1803.454) (-1805.805) * [-1808.593] (-1803.821) (-1804.659) (-1803.289) -- 0:00:16
824000 -- (-1803.210) (-1803.423) [-1802.500] (-1806.084) * [-1803.860] (-1802.979) (-1803.248) (-1803.879) -- 0:00:16
824500 -- (-1805.176) (-1804.170) (-1809.239) [-1803.945] * [-1804.087] (-1803.164) (-1805.565) (-1803.690) -- 0:00:17
825000 -- (-1805.516) (-1802.686) [-1803.057] (-1802.846) * [-1804.135] (-1806.243) (-1803.255) (-1809.967) -- 0:00:16
Average standard deviation of split frequencies: 0.006050
825500 -- (-1804.902) (-1803.279) [-1803.065] (-1807.063) * (-1802.884) [-1804.725] (-1804.206) (-1806.418) -- 0:00:16
826000 -- [-1804.912] (-1806.406) (-1809.012) (-1806.605) * (-1803.986) (-1803.837) [-1803.039] (-1806.017) -- 0:00:16
826500 -- [-1803.625] (-1803.150) (-1807.138) (-1802.556) * [-1804.494] (-1806.611) (-1804.011) (-1807.517) -- 0:00:16
827000 -- (-1803.910) [-1803.036] (-1805.993) (-1804.657) * (-1803.900) (-1805.417) (-1803.638) [-1805.899] -- 0:00:16
827500 -- [-1803.746] (-1804.054) (-1806.741) (-1804.079) * [-1803.190] (-1804.840) (-1803.682) (-1802.322) -- 0:00:16
828000 -- (-1802.999) (-1804.839) [-1806.953] (-1804.026) * (-1803.898) [-1803.019] (-1803.112) (-1802.866) -- 0:00:16
828500 -- [-1805.357] (-1806.613) (-1808.238) (-1804.499) * (-1805.572) (-1804.868) (-1808.156) [-1803.549] -- 0:00:16
829000 -- (-1806.800) [-1804.047] (-1804.623) (-1803.656) * (-1805.070) (-1811.734) (-1804.677) [-1803.597] -- 0:00:16
829500 -- [-1805.455] (-1806.750) (-1803.490) (-1808.551) * (-1804.503) [-1802.799] (-1806.459) (-1804.695) -- 0:00:16
830000 -- (-1807.563) (-1806.615) [-1803.585] (-1804.798) * (-1804.063) (-1802.696) (-1805.894) [-1804.474] -- 0:00:16
Average standard deviation of split frequencies: 0.006356
830500 -- (-1803.711) [-1806.115] (-1806.662) (-1804.115) * [-1804.853] (-1803.947) (-1804.702) (-1803.925) -- 0:00:16
831000 -- (-1806.537) (-1804.377) [-1804.450] (-1805.230) * (-1806.779) [-1803.738] (-1804.358) (-1810.627) -- 0:00:16
831500 -- (-1803.326) [-1803.005] (-1805.120) (-1803.257) * (-1805.824) (-1804.398) (-1804.244) [-1805.604] -- 0:00:16
832000 -- [-1802.572] (-1804.979) (-1803.733) (-1806.398) * [-1806.041] (-1803.411) (-1803.387) (-1805.946) -- 0:00:16
832500 -- [-1802.821] (-1804.458) (-1804.897) (-1811.002) * (-1810.012) (-1803.426) [-1804.341] (-1804.252) -- 0:00:16
833000 -- (-1803.774) [-1806.072] (-1805.246) (-1807.277) * [-1804.724] (-1803.424) (-1805.351) (-1804.759) -- 0:00:16
833500 -- (-1804.644) [-1803.701] (-1802.046) (-1804.725) * [-1808.467] (-1804.460) (-1805.595) (-1804.431) -- 0:00:15
834000 -- (-1803.014) (-1807.300) (-1803.654) [-1804.222] * (-1803.345) (-1806.035) (-1805.312) [-1803.003] -- 0:00:15
834500 -- [-1803.077] (-1804.483) (-1804.911) (-1803.926) * (-1804.662) (-1805.352) [-1804.267] (-1803.685) -- 0:00:15
835000 -- (-1808.031) (-1803.445) [-1806.287] (-1803.364) * (-1804.672) (-1805.963) [-1803.762] (-1803.416) -- 0:00:15
Average standard deviation of split frequencies: 0.006203
835500 -- (-1804.739) [-1802.705] (-1804.128) (-1807.801) * (-1808.855) (-1804.842) (-1805.920) [-1804.694] -- 0:00:15
836000 -- (-1805.186) (-1802.852) [-1803.586] (-1803.742) * (-1807.239) (-1805.445) (-1808.429) [-1804.068] -- 0:00:15
836500 -- (-1802.833) (-1803.087) [-1805.078] (-1803.359) * (-1807.661) (-1807.740) (-1808.463) [-1804.530] -- 0:00:15
837000 -- [-1803.697] (-1803.848) (-1804.502) (-1804.004) * [-1805.985] (-1804.686) (-1806.376) (-1804.398) -- 0:00:15
837500 -- (-1804.070) (-1806.358) (-1809.067) [-1805.183] * (-1807.857) (-1804.004) [-1805.454] (-1803.923) -- 0:00:15
838000 -- (-1807.678) [-1804.565] (-1807.588) (-1803.157) * (-1807.577) [-1805.006] (-1804.343) (-1805.926) -- 0:00:15
838500 -- (-1805.195) [-1805.799] (-1805.664) (-1805.322) * (-1807.104) [-1805.304] (-1804.396) (-1805.730) -- 0:00:15
839000 -- (-1803.513) (-1805.717) [-1803.926] (-1805.143) * (-1806.170) (-1804.755) (-1804.471) [-1805.884] -- 0:00:15
839500 -- [-1803.504] (-1808.311) (-1805.239) (-1802.857) * (-1804.776) (-1804.451) (-1807.041) [-1804.556] -- 0:00:15
840000 -- (-1802.325) (-1804.550) (-1805.186) [-1803.658] * [-1809.045] (-1804.426) (-1807.417) (-1805.006) -- 0:00:15
Average standard deviation of split frequencies: 0.006280
840500 -- [-1801.757] (-1803.822) (-1802.866) (-1804.496) * (-1806.946) (-1805.285) [-1807.041] (-1806.979) -- 0:00:15
841000 -- (-1802.987) [-1803.429] (-1805.023) (-1804.692) * (-1804.409) [-1803.602] (-1806.015) (-1806.030) -- 0:00:15
841500 -- (-1806.851) (-1803.373) [-1803.607] (-1806.001) * (-1805.078) [-1803.057] (-1804.961) (-1803.063) -- 0:00:15
842000 -- (-1806.304) (-1802.816) (-1803.331) [-1802.107] * (-1803.638) (-1802.999) (-1804.289) [-1804.344] -- 0:00:15
842500 -- (-1802.728) (-1804.281) (-1803.877) [-1802.846] * (-1802.940) (-1808.532) (-1804.748) [-1804.042] -- 0:00:15
843000 -- (-1805.989) (-1807.740) [-1803.445] (-1804.063) * [-1807.171] (-1808.709) (-1807.000) (-1805.362) -- 0:00:15
843500 -- (-1807.471) (-1804.980) [-1804.111] (-1803.206) * (-1805.987) [-1805.612] (-1807.277) (-1805.955) -- 0:00:15
844000 -- (-1803.681) [-1803.120] (-1808.546) (-1802.707) * [-1807.111] (-1804.764) (-1807.329) (-1804.496) -- 0:00:14
844500 -- (-1805.701) (-1803.481) (-1803.479) [-1802.821] * (-1803.298) [-1804.126] (-1804.823) (-1804.830) -- 0:00:14
845000 -- (-1806.365) (-1804.481) [-1803.569] (-1803.880) * (-1803.805) [-1804.383] (-1803.009) (-1803.591) -- 0:00:14
Average standard deviation of split frequencies: 0.006241
845500 -- (-1804.880) (-1804.058) (-1805.260) [-1803.329] * [-1804.018] (-1803.207) (-1803.291) (-1807.031) -- 0:00:14
846000 -- (-1803.290) (-1803.300) (-1805.538) [-1803.400] * (-1804.366) (-1803.630) [-1803.434] (-1805.896) -- 0:00:14
846500 -- (-1803.353) (-1803.049) (-1804.452) [-1803.852] * (-1803.483) [-1803.604] (-1804.766) (-1803.741) -- 0:00:14
847000 -- (-1805.361) (-1803.146) (-1806.260) [-1805.617] * (-1803.083) [-1804.455] (-1804.237) (-1803.567) -- 0:00:14
847500 -- [-1807.885] (-1805.357) (-1810.463) (-1803.535) * (-1803.776) (-1802.723) (-1803.996) [-1803.021] -- 0:00:14
848000 -- (-1811.290) [-1803.437] (-1805.209) (-1804.078) * (-1804.922) [-1804.122] (-1806.442) (-1805.269) -- 0:00:14
848500 -- (-1808.927) [-1802.525] (-1803.212) (-1802.627) * (-1805.179) (-1804.281) (-1807.768) [-1807.811] -- 0:00:14
849000 -- (-1805.885) (-1803.676) [-1803.276] (-1807.399) * (-1812.425) (-1804.499) (-1806.504) [-1811.414] -- 0:00:14
849500 -- (-1804.588) [-1804.381] (-1806.522) (-1803.542) * [-1804.606] (-1805.093) (-1803.316) (-1805.580) -- 0:00:14
850000 -- (-1806.802) (-1804.102) (-1807.290) [-1805.095] * (-1803.754) (-1806.065) (-1804.094) [-1805.872] -- 0:00:14
Average standard deviation of split frequencies: 0.006207
850500 -- (-1804.434) [-1804.122] (-1806.494) (-1807.048) * (-1802.884) (-1807.692) (-1810.463) [-1804.889] -- 0:00:14
851000 -- [-1803.598] (-1803.966) (-1804.843) (-1806.985) * (-1803.149) [-1804.393] (-1804.822) (-1803.426) -- 0:00:14
851500 -- (-1803.919) [-1805.021] (-1804.946) (-1803.417) * (-1803.382) (-1803.555) (-1803.384) [-1805.239] -- 0:00:14
852000 -- (-1805.009) [-1803.882] (-1805.700) (-1802.980) * (-1804.527) [-1807.484] (-1802.750) (-1805.953) -- 0:00:14
852500 -- [-1805.567] (-1802.381) (-1805.505) (-1806.940) * (-1803.560) [-1804.083] (-1807.348) (-1803.390) -- 0:00:14
853000 -- (-1805.084) [-1802.072] (-1805.759) (-1806.227) * (-1804.747) [-1804.150] (-1802.580) (-1805.748) -- 0:00:14
853500 -- (-1805.276) (-1810.236) (-1803.058) [-1803.945] * [-1804.131] (-1805.014) (-1806.050) (-1807.659) -- 0:00:14
854000 -- (-1804.565) (-1807.549) [-1805.141] (-1803.252) * (-1806.227) (-1803.772) [-1803.007] (-1808.722) -- 0:00:14
854500 -- (-1804.950) (-1807.698) [-1803.958] (-1814.539) * [-1802.485] (-1804.119) (-1803.313) (-1803.574) -- 0:00:13
855000 -- (-1803.919) [-1804.410] (-1802.881) (-1803.857) * [-1806.217] (-1805.453) (-1805.008) (-1807.188) -- 0:00:13
Average standard deviation of split frequencies: 0.006058
855500 -- [-1803.108] (-1802.056) (-1803.651) (-1803.079) * (-1805.776) (-1804.066) [-1804.397] (-1805.260) -- 0:00:13
856000 -- (-1810.327) (-1803.560) [-1803.943] (-1803.459) * (-1802.816) (-1805.939) (-1803.260) [-1802.353] -- 0:00:13
856500 -- [-1805.482] (-1802.966) (-1805.967) (-1803.346) * (-1802.201) [-1804.742] (-1806.169) (-1802.690) -- 0:00:13
857000 -- (-1809.076) (-1803.828) [-1803.325] (-1802.782) * (-1802.670) (-1806.799) (-1804.838) [-1804.165] -- 0:00:13
857500 -- (-1808.401) [-1806.370] (-1806.908) (-1802.924) * (-1805.121) (-1804.350) [-1802.351] (-1804.221) -- 0:00:13
858000 -- [-1805.035] (-1803.816) (-1805.743) (-1804.101) * (-1804.888) [-1802.535] (-1802.843) (-1803.707) -- 0:00:13
858500 -- (-1806.558) (-1803.728) [-1801.554] (-1804.032) * [-1804.088] (-1807.513) (-1808.919) (-1805.343) -- 0:00:13
859000 -- (-1803.831) (-1802.570) (-1806.490) [-1801.934] * [-1803.373] (-1803.077) (-1807.328) (-1804.726) -- 0:00:13
859500 -- (-1805.299) (-1805.556) (-1804.662) [-1804.026] * (-1805.220) [-1802.141] (-1805.636) (-1804.804) -- 0:00:13
860000 -- [-1803.538] (-1803.641) (-1801.859) (-1807.893) * (-1806.291) [-1806.346] (-1806.524) (-1803.913) -- 0:00:13
Average standard deviation of split frequencies: 0.005806
860500 -- [-1806.461] (-1802.881) (-1807.421) (-1806.067) * (-1805.735) (-1804.092) (-1805.217) [-1808.732] -- 0:00:13
861000 -- (-1805.391) [-1804.958] (-1803.845) (-1804.227) * (-1805.921) (-1804.863) [-1808.627] (-1806.775) -- 0:00:13
861500 -- (-1803.131) [-1804.877] (-1805.301) (-1804.211) * (-1806.842) (-1805.905) (-1803.263) [-1802.383] -- 0:00:13
862000 -- (-1806.891) (-1802.453) (-1805.355) [-1804.381] * (-1803.720) (-1804.269) [-1803.377] (-1804.374) -- 0:00:13
862500 -- (-1806.912) (-1802.499) [-1804.893] (-1804.391) * (-1805.739) (-1803.619) [-1803.619] (-1806.299) -- 0:00:13
863000 -- (-1806.466) (-1803.807) [-1808.040] (-1803.858) * (-1806.464) [-1802.887] (-1805.259) (-1803.314) -- 0:00:13
863500 -- (-1807.293) (-1804.326) (-1803.458) [-1804.108] * (-1803.945) (-1803.273) [-1806.909] (-1803.516) -- 0:00:13
864000 -- (-1802.759) (-1803.159) [-1803.493] (-1805.213) * (-1805.063) (-1806.315) (-1806.426) [-1805.261] -- 0:00:13
864500 -- [-1803.628] (-1805.819) (-1805.052) (-1804.583) * [-1802.762] (-1806.535) (-1806.161) (-1804.655) -- 0:00:13
865000 -- [-1803.438] (-1804.870) (-1807.721) (-1804.213) * (-1803.282) (-1805.956) (-1804.588) [-1803.109] -- 0:00:12
Average standard deviation of split frequencies: 0.005988
865500 -- (-1802.665) (-1804.622) (-1806.615) [-1804.479] * (-1805.886) [-1803.668] (-1805.963) (-1803.463) -- 0:00:12
866000 -- [-1803.679] (-1805.343) (-1803.629) (-1804.837) * (-1806.752) (-1806.746) (-1805.119) [-1803.955] -- 0:00:12
866500 -- [-1803.756] (-1804.843) (-1803.860) (-1803.661) * (-1810.071) (-1805.634) [-1807.123] (-1804.991) -- 0:00:12
867000 -- (-1803.858) (-1803.567) (-1804.390) [-1803.756] * (-1806.270) (-1804.281) [-1805.691] (-1806.278) -- 0:00:12
867500 -- (-1803.194) (-1806.671) (-1803.997) [-1803.329] * (-1802.967) (-1804.307) [-1804.500] (-1802.480) -- 0:00:12
868000 -- [-1804.572] (-1808.169) (-1806.136) (-1802.943) * [-1806.174] (-1805.050) (-1804.570) (-1803.836) -- 0:00:12
868500 -- (-1804.538) (-1806.788) [-1803.797] (-1803.944) * (-1804.930) (-1804.139) [-1803.028] (-1807.309) -- 0:00:12
869000 -- (-1807.642) (-1804.432) [-1807.837] (-1811.693) * [-1805.818] (-1803.856) (-1804.593) (-1805.627) -- 0:00:12
869500 -- (-1806.084) [-1802.481] (-1804.683) (-1804.984) * (-1805.331) (-1803.836) (-1802.749) [-1803.038] -- 0:00:12
870000 -- (-1804.207) (-1803.013) (-1805.540) [-1802.688] * (-1803.955) [-1804.546] (-1803.739) (-1805.560) -- 0:00:12
Average standard deviation of split frequencies: 0.005956
870500 -- (-1807.502) [-1804.101] (-1805.320) (-1807.350) * (-1804.728) (-1804.923) [-1804.761] (-1805.244) -- 0:00:12
871000 -- (-1807.076) (-1808.289) [-1803.347] (-1804.162) * (-1802.406) (-1805.742) (-1803.875) [-1807.424] -- 0:00:12
871500 -- (-1806.272) (-1804.317) (-1803.558) [-1804.969] * (-1806.295) (-1804.468) (-1807.169) [-1806.609] -- 0:00:12
872000 -- (-1806.385) (-1806.309) [-1802.874] (-1803.413) * (-1804.155) (-1804.690) [-1804.462] (-1804.041) -- 0:00:12
872500 -- (-1804.629) [-1804.585] (-1805.923) (-1803.154) * (-1806.239) (-1803.816) (-1804.498) [-1802.999] -- 0:00:12
873000 -- (-1804.444) [-1803.798] (-1802.827) (-1803.429) * (-1804.401) (-1804.366) [-1803.211] (-1804.662) -- 0:00:12
873500 -- [-1805.802] (-1804.658) (-1803.420) (-1805.255) * (-1805.066) [-1803.957] (-1803.247) (-1807.900) -- 0:00:12
874000 -- (-1804.708) (-1804.266) (-1803.376) [-1805.785] * (-1804.053) [-1804.319] (-1805.236) (-1805.710) -- 0:00:12
874500 -- [-1805.117] (-1802.796) (-1814.206) (-1804.057) * (-1807.048) (-1804.682) [-1804.273] (-1804.043) -- 0:00:12
875000 -- (-1806.416) (-1804.188) (-1806.366) [-1802.885] * (-1805.239) (-1805.860) [-1804.274] (-1803.101) -- 0:00:12
Average standard deviation of split frequencies: 0.005489
875500 -- (-1804.103) (-1803.756) [-1804.000] (-1803.810) * (-1806.153) [-1803.750] (-1803.837) (-1806.307) -- 0:00:11
876000 -- (-1804.256) (-1807.659) [-1805.331] (-1804.759) * (-1804.060) (-1803.677) (-1802.484) [-1803.734] -- 0:00:11
876500 -- [-1803.973] (-1808.541) (-1805.740) (-1806.352) * (-1803.590) (-1806.460) [-1802.982] (-1803.287) -- 0:00:11
877000 -- [-1802.895] (-1804.767) (-1805.269) (-1803.654) * (-1802.691) [-1803.385] (-1804.526) (-1802.148) -- 0:00:11
877500 -- [-1803.536] (-1807.289) (-1803.507) (-1804.202) * (-1804.287) (-1805.648) (-1803.054) [-1802.364] -- 0:00:11
878000 -- (-1804.547) (-1806.116) [-1804.020] (-1807.248) * (-1807.011) (-1805.687) [-1804.894] (-1804.299) -- 0:00:11
878500 -- (-1805.080) [-1805.322] (-1806.539) (-1803.501) * (-1803.644) [-1804.826] (-1807.841) (-1804.309) -- 0:00:11
879000 -- [-1802.871] (-1803.183) (-1805.844) (-1803.506) * [-1805.225] (-1805.358) (-1807.751) (-1802.436) -- 0:00:11
879500 -- (-1813.685) (-1806.309) (-1808.258) [-1802.955] * [-1805.151] (-1804.150) (-1806.248) (-1802.891) -- 0:00:11
880000 -- (-1804.051) [-1804.104] (-1810.235) (-1809.399) * (-1804.374) (-1806.650) [-1803.733] (-1807.855) -- 0:00:11
Average standard deviation of split frequencies: 0.005781
880500 -- (-1805.939) [-1805.173] (-1805.439) (-1808.482) * (-1805.946) [-1803.261] (-1804.177) (-1803.877) -- 0:00:11
881000 -- (-1802.851) (-1802.846) [-1804.290] (-1802.363) * [-1806.205] (-1802.913) (-1804.716) (-1804.367) -- 0:00:11
881500 -- (-1806.232) (-1805.028) (-1806.895) [-1802.701] * (-1803.700) (-1802.739) (-1803.927) [-1802.905] -- 0:00:11
882000 -- (-1803.054) (-1807.840) (-1803.680) [-1803.102] * (-1803.948) [-1803.620] (-1806.492) (-1805.361) -- 0:00:11
882500 -- (-1804.073) (-1806.387) (-1802.572) [-1805.835] * (-1805.369) [-1803.493] (-1804.457) (-1804.458) -- 0:00:11
883000 -- (-1806.755) (-1804.652) (-1803.945) [-1803.179] * (-1804.290) (-1804.111) (-1806.958) [-1802.818] -- 0:00:11
883500 -- (-1803.262) (-1805.119) [-1802.840] (-1804.443) * (-1806.666) [-1804.648] (-1805.127) (-1803.730) -- 0:00:11
884000 -- [-1805.324] (-1805.934) (-1806.116) (-1803.915) * [-1806.400] (-1806.641) (-1804.672) (-1804.749) -- 0:00:11
884500 -- (-1805.138) (-1806.477) (-1803.782) [-1803.629] * [-1806.721] (-1805.640) (-1803.727) (-1803.420) -- 0:00:11
885000 -- [-1804.825] (-1804.111) (-1804.038) (-1804.288) * (-1805.304) (-1804.273) [-1805.870] (-1802.650) -- 0:00:11
Average standard deviation of split frequencies: 0.005959
885500 -- (-1806.155) [-1803.434] (-1802.579) (-1806.752) * [-1805.439] (-1806.773) (-1806.017) (-1805.604) -- 0:00:10
886000 -- (-1807.638) (-1803.183) (-1802.780) [-1803.851] * (-1805.389) [-1803.581] (-1809.433) (-1808.147) -- 0:00:10
886500 -- [-1804.779] (-1804.429) (-1802.776) (-1803.558) * (-1804.051) (-1804.898) [-1807.732] (-1805.079) -- 0:00:10
887000 -- (-1804.674) (-1802.533) (-1803.864) [-1808.029] * [-1803.694] (-1803.460) (-1808.468) (-1806.693) -- 0:00:10
887500 -- [-1804.319] (-1805.953) (-1804.545) (-1808.932) * (-1804.365) (-1806.932) [-1806.395] (-1805.959) -- 0:00:10
888000 -- (-1804.242) (-1804.619) [-1804.518] (-1804.203) * (-1810.708) (-1805.649) [-1804.666] (-1806.000) -- 0:00:10
888500 -- [-1804.709] (-1803.289) (-1804.274) (-1806.537) * (-1803.670) [-1806.479] (-1804.681) (-1805.472) -- 0:00:10
889000 -- (-1806.156) (-1808.131) [-1805.067] (-1806.129) * (-1803.257) [-1807.546] (-1805.797) (-1804.172) -- 0:00:10
889500 -- (-1806.730) (-1804.901) [-1803.165] (-1805.068) * (-1803.089) (-1803.983) [-1805.698] (-1804.266) -- 0:00:10
890000 -- [-1804.674] (-1802.966) (-1804.625) (-1803.233) * (-1803.794) (-1803.778) (-1807.495) [-1805.785] -- 0:00:10
Average standard deviation of split frequencies: 0.005822
890500 -- (-1806.228) (-1802.224) (-1804.246) [-1803.119] * (-1804.222) [-1804.184] (-1807.106) (-1803.822) -- 0:00:10
891000 -- (-1805.931) [-1806.714] (-1803.573) (-1804.727) * [-1804.401] (-1803.162) (-1805.174) (-1804.626) -- 0:00:10
891500 -- [-1803.009] (-1804.681) (-1808.155) (-1804.373) * (-1806.556) (-1804.533) [-1805.350] (-1803.844) -- 0:00:10
892000 -- (-1803.732) (-1808.294) (-1808.018) [-1806.054] * (-1805.809) [-1804.241] (-1804.164) (-1805.983) -- 0:00:10
892500 -- (-1803.612) (-1807.708) (-1803.821) [-1806.387] * [-1806.158] (-1804.261) (-1804.387) (-1803.482) -- 0:00:10
893000 -- (-1802.704) [-1804.225] (-1804.822) (-1806.005) * (-1807.176) (-1803.600) [-1805.264] (-1804.451) -- 0:00:10
893500 -- [-1806.229] (-1805.920) (-1802.855) (-1805.107) * (-1804.328) [-1806.019] (-1810.201) (-1804.886) -- 0:00:10
894000 -- (-1807.132) [-1804.707] (-1805.382) (-1804.056) * (-1804.196) (-1803.219) (-1805.810) [-1803.215] -- 0:00:10
894500 -- (-1805.305) (-1806.523) [-1803.344] (-1804.365) * (-1803.877) [-1804.488] (-1805.108) (-1804.250) -- 0:00:10
895000 -- (-1802.929) (-1804.642) (-1803.000) [-1803.793] * (-1804.258) [-1805.312] (-1806.036) (-1806.646) -- 0:00:10
Average standard deviation of split frequencies: 0.005472
895500 -- [-1806.696] (-1804.259) (-1804.024) (-1805.448) * (-1802.150) (-1803.883) [-1803.817] (-1807.454) -- 0:00:10
896000 -- (-1804.479) (-1806.366) [-1805.326] (-1803.817) * [-1804.479] (-1802.539) (-1802.472) (-1803.629) -- 0:00:09
896500 -- (-1805.114) (-1805.097) (-1805.086) [-1804.907] * (-1810.192) (-1803.565) (-1804.140) [-1803.625] -- 0:00:09
897000 -- (-1803.960) (-1806.047) [-1804.414] (-1803.849) * (-1806.988) (-1803.053) [-1804.990] (-1806.310) -- 0:00:09
897500 -- (-1803.640) (-1805.549) (-1806.815) [-1803.689] * (-1804.173) (-1807.646) (-1802.587) [-1803.839] -- 0:00:09
898000 -- (-1803.817) [-1803.157] (-1806.982) (-1805.427) * (-1805.289) (-1803.707) [-1804.161] (-1805.511) -- 0:00:09
898500 -- (-1804.579) [-1804.316] (-1804.141) (-1802.689) * (-1803.740) [-1804.227] (-1803.788) (-1804.384) -- 0:00:09
899000 -- (-1804.438) (-1804.494) (-1810.845) [-1803.196] * [-1803.356] (-1802.739) (-1803.944) (-1805.054) -- 0:00:09
899500 -- [-1805.129] (-1803.814) (-1806.474) (-1802.695) * (-1802.437) (-1802.854) (-1803.376) [-1804.162] -- 0:00:09
900000 -- (-1805.895) [-1803.384] (-1807.883) (-1808.369) * [-1802.719] (-1802.814) (-1803.732) (-1804.665) -- 0:00:09
Average standard deviation of split frequencies: 0.005443
900500 -- (-1807.373) [-1803.231] (-1803.860) (-1805.135) * [-1803.505] (-1804.245) (-1806.775) (-1804.473) -- 0:00:09
901000 -- (-1805.985) (-1803.259) [-1802.680] (-1804.720) * (-1802.303) [-1805.691] (-1805.804) (-1806.825) -- 0:00:09
901500 -- (-1802.505) (-1805.944) [-1802.341] (-1806.023) * (-1805.963) [-1807.258] (-1806.769) (-1804.461) -- 0:00:09
902000 -- [-1803.570] (-1805.110) (-1804.739) (-1803.731) * (-1813.326) [-1803.292] (-1807.233) (-1803.434) -- 0:00:09
902500 -- (-1803.164) (-1802.144) [-1807.238] (-1806.369) * [-1808.030] (-1805.202) (-1804.660) (-1804.024) -- 0:00:09
903000 -- [-1804.568] (-1804.570) (-1804.504) (-1803.870) * (-1807.975) [-1806.583] (-1806.365) (-1802.798) -- 0:00:09
903500 -- (-1804.672) (-1806.634) (-1808.096) [-1806.150] * (-1807.441) [-1805.193] (-1805.075) (-1805.178) -- 0:00:09
904000 -- (-1807.353) (-1803.717) [-1803.238] (-1803.681) * (-1804.100) (-1804.165) (-1802.766) [-1803.401] -- 0:00:09
904500 -- [-1804.351] (-1804.625) (-1803.632) (-1802.724) * (-1806.594) (-1806.188) (-1807.230) [-1804.694] -- 0:00:09
905000 -- (-1804.106) (-1805.101) (-1805.485) [-1803.377] * (-1804.660) (-1804.273) (-1805.537) [-1803.566] -- 0:00:09
Average standard deviation of split frequencies: 0.005932
905500 -- (-1804.840) (-1804.400) (-1805.391) [-1804.829] * [-1802.889] (-1803.080) (-1808.128) (-1803.129) -- 0:00:09
906000 -- (-1803.289) (-1805.271) (-1810.957) [-1805.384] * (-1802.856) [-1803.382] (-1806.257) (-1812.059) -- 0:00:09
906500 -- (-1803.529) (-1805.602) (-1804.466) [-1804.014] * (-1803.703) (-1803.615) (-1803.202) [-1806.692] -- 0:00:08
907000 -- (-1804.113) [-1803.694] (-1808.300) (-1803.324) * (-1806.963) [-1804.320] (-1806.568) (-1807.099) -- 0:00:08
907500 -- [-1801.928] (-1803.945) (-1806.904) (-1804.930) * [-1803.962] (-1804.074) (-1806.048) (-1807.845) -- 0:00:08
908000 -- (-1803.631) (-1804.490) [-1805.456] (-1802.342) * (-1809.230) [-1803.680] (-1803.913) (-1805.897) -- 0:00:08
908500 -- (-1804.666) [-1805.826] (-1806.467) (-1808.651) * [-1805.098] (-1808.510) (-1802.975) (-1804.049) -- 0:00:08
909000 -- (-1803.060) (-1803.708) [-1806.602] (-1806.201) * (-1809.446) [-1805.005] (-1802.935) (-1805.676) -- 0:00:08
909500 -- (-1803.796) (-1804.442) [-1802.499] (-1810.014) * (-1804.747) [-1803.104] (-1805.132) (-1801.966) -- 0:00:08
910000 -- (-1804.527) [-1804.791] (-1803.082) (-1811.259) * (-1806.843) (-1806.345) (-1804.320) [-1804.208] -- 0:00:08
Average standard deviation of split frequencies: 0.006005
910500 -- [-1804.416] (-1803.228) (-1802.957) (-1804.383) * (-1803.512) (-1806.926) (-1803.129) [-1804.581] -- 0:00:08
911000 -- (-1804.744) [-1803.800] (-1804.263) (-1804.128) * (-1804.145) [-1808.115] (-1803.436) (-1803.039) -- 0:00:08
911500 -- [-1808.582] (-1804.304) (-1804.534) (-1803.716) * (-1806.233) (-1806.516) (-1805.549) [-1803.261] -- 0:00:08
912000 -- (-1805.537) (-1804.485) [-1805.246] (-1803.556) * (-1806.006) (-1803.400) [-1803.754] (-1802.959) -- 0:00:08
912500 -- (-1804.179) (-1802.638) (-1804.903) [-1806.288] * (-1803.217) (-1803.972) [-1807.190] (-1806.409) -- 0:00:08
913000 -- (-1803.179) (-1805.163) (-1804.067) [-1807.005] * [-1805.769] (-1805.829) (-1804.810) (-1804.714) -- 0:00:08
913500 -- (-1805.286) (-1805.333) (-1803.626) [-1805.245] * [-1803.805] (-1803.628) (-1805.704) (-1805.278) -- 0:00:08
914000 -- (-1806.175) [-1803.708] (-1804.701) (-1802.999) * (-1804.585) (-1803.815) [-1803.384] (-1810.117) -- 0:00:08
914500 -- (-1802.681) (-1804.514) [-1806.335] (-1804.048) * [-1803.718] (-1804.389) (-1805.238) (-1803.741) -- 0:00:08
915000 -- (-1803.136) [-1805.752] (-1802.347) (-1806.159) * (-1804.178) (-1805.880) (-1803.367) [-1804.959] -- 0:00:08
Average standard deviation of split frequencies: 0.006484
915500 -- (-1804.626) (-1806.083) [-1803.258] (-1804.627) * (-1805.969) [-1805.072] (-1807.545) (-1806.790) -- 0:00:08
916000 -- (-1807.049) (-1804.920) (-1805.313) [-1804.386] * [-1802.958] (-1804.752) (-1805.302) (-1803.721) -- 0:00:08
916500 -- (-1807.618) (-1805.882) [-1802.590] (-1803.050) * (-1805.268) (-1803.641) [-1805.341] (-1808.580) -- 0:00:08
917000 -- (-1809.149) (-1805.025) (-1803.444) [-1803.361] * (-1810.877) (-1804.201) [-1803.652] (-1806.909) -- 0:00:07
917500 -- [-1804.514] (-1804.946) (-1805.914) (-1806.540) * (-1804.828) (-1803.199) [-1805.312] (-1804.514) -- 0:00:07
918000 -- (-1804.791) (-1803.853) (-1806.369) [-1809.608] * (-1802.646) (-1803.183) (-1805.057) [-1806.314] -- 0:00:07
918500 -- (-1803.275) (-1804.325) [-1807.418] (-1803.955) * (-1805.903) [-1803.484] (-1807.329) (-1804.674) -- 0:00:07
919000 -- (-1804.052) (-1805.181) (-1808.148) [-1803.960] * (-1804.741) [-1803.647] (-1806.542) (-1808.614) -- 0:00:07
919500 -- [-1803.635] (-1805.485) (-1804.094) (-1803.596) * (-1808.142) (-1803.758) (-1808.821) [-1806.706] -- 0:00:07
920000 -- [-1804.501] (-1807.112) (-1805.873) (-1808.235) * (-1804.691) [-1804.376] (-1802.863) (-1804.609) -- 0:00:07
Average standard deviation of split frequencies: 0.006452
920500 -- (-1803.706) [-1803.462] (-1804.007) (-1804.145) * (-1802.703) (-1804.625) (-1804.337) [-1804.260] -- 0:00:07
921000 -- (-1805.834) [-1803.368] (-1803.733) (-1804.251) * (-1804.706) [-1805.829] (-1804.093) (-1804.216) -- 0:00:07
921500 -- (-1807.757) (-1802.954) (-1803.907) [-1804.015] * (-1807.127) (-1806.110) (-1803.311) [-1806.076] -- 0:00:07
922000 -- (-1805.805) (-1803.799) [-1807.481] (-1805.139) * (-1806.257) (-1806.237) [-1803.618] (-1805.566) -- 0:00:07
922500 -- (-1804.538) (-1805.841) [-1804.468] (-1802.916) * (-1807.594) (-1804.886) [-1804.255] (-1802.329) -- 0:00:07
923000 -- (-1803.288) (-1809.013) (-1804.529) [-1804.568] * [-1804.104] (-1803.391) (-1809.552) (-1803.933) -- 0:00:07
923500 -- [-1806.512] (-1805.916) (-1805.386) (-1802.991) * (-1805.071) (-1804.903) [-1802.439] (-1803.389) -- 0:00:07
924000 -- (-1805.357) [-1804.735] (-1807.575) (-1804.249) * (-1803.248) (-1808.717) (-1804.891) [-1804.077] -- 0:00:07
924500 -- [-1806.646] (-1805.117) (-1805.320) (-1807.212) * (-1803.671) (-1804.803) (-1809.676) [-1804.129] -- 0:00:07
925000 -- (-1805.384) (-1803.158) [-1807.548] (-1809.257) * (-1802.955) (-1803.871) (-1805.406) [-1804.105] -- 0:00:07
Average standard deviation of split frequencies: 0.006313
925500 -- (-1805.734) [-1804.661] (-1805.271) (-1803.473) * [-1803.989] (-1803.937) (-1802.414) (-1806.275) -- 0:00:07
926000 -- (-1805.269) [-1803.725] (-1806.330) (-1804.643) * (-1805.165) (-1804.311) (-1805.873) [-1805.337] -- 0:00:07
926500 -- (-1806.443) (-1806.286) (-1810.190) [-1804.326] * [-1805.078] (-1807.384) (-1804.263) (-1804.246) -- 0:00:07
927000 -- (-1803.279) (-1802.224) [-1807.733] (-1802.923) * (-1803.070) (-1805.688) (-1804.060) [-1806.489] -- 0:00:07
927500 -- (-1803.077) [-1805.102] (-1803.831) (-1805.453) * (-1805.069) (-1803.865) (-1804.841) [-1805.036] -- 0:00:06
928000 -- (-1802.427) (-1803.418) (-1803.584) [-1806.065] * [-1803.957] (-1804.018) (-1807.917) (-1805.571) -- 0:00:06
928500 -- [-1802.540] (-1803.283) (-1804.348) (-1807.329) * [-1802.791] (-1803.922) (-1806.488) (-1807.812) -- 0:00:06
929000 -- (-1803.900) (-1804.855) (-1804.300) [-1804.834] * [-1803.549] (-1805.645) (-1806.796) (-1808.036) -- 0:00:06
929500 -- (-1804.199) (-1805.711) (-1803.247) [-1804.968] * (-1806.229) [-1805.956] (-1804.594) (-1806.217) -- 0:00:06
930000 -- [-1802.821] (-1803.926) (-1805.487) (-1806.466) * (-1805.896) [-1805.536] (-1804.497) (-1804.276) -- 0:00:06
Average standard deviation of split frequencies: 0.006585
930500 -- (-1804.745) (-1803.349) (-1809.590) [-1804.292] * [-1804.132] (-1804.600) (-1803.917) (-1804.218) -- 0:00:06
931000 -- (-1804.504) [-1803.060] (-1806.674) (-1808.370) * (-1804.303) (-1803.382) (-1806.783) [-1805.538] -- 0:00:06
931500 -- (-1805.887) [-1804.526] (-1804.063) (-1807.434) * [-1804.519] (-1805.804) (-1808.472) (-1804.620) -- 0:00:06
932000 -- (-1812.171) (-1805.666) (-1804.538) [-1804.696] * (-1805.142) (-1804.263) [-1804.409] (-1806.550) -- 0:00:06
932500 -- (-1812.609) (-1804.592) [-1803.878] (-1802.138) * (-1806.047) [-1804.232] (-1803.425) (-1804.659) -- 0:00:06
933000 -- [-1805.402] (-1804.310) (-1805.393) (-1804.660) * (-1806.160) [-1804.078] (-1803.513) (-1804.721) -- 0:00:06
933500 -- [-1805.992] (-1804.600) (-1805.095) (-1806.591) * (-1805.085) (-1804.264) [-1805.587] (-1803.638) -- 0:00:06
934000 -- (-1805.627) (-1803.473) [-1803.246] (-1804.894) * (-1804.155) (-1806.274) [-1806.515] (-1804.050) -- 0:00:06
934500 -- (-1806.942) [-1804.175] (-1802.726) (-1803.304) * [-1803.058] (-1809.197) (-1812.063) (-1804.343) -- 0:00:06
935000 -- (-1806.459) (-1804.545) [-1802.915] (-1805.103) * [-1804.106] (-1807.463) (-1807.604) (-1804.139) -- 0:00:06
Average standard deviation of split frequencies: 0.006346
935500 -- [-1802.887] (-1804.252) (-1802.824) (-1804.202) * [-1803.179] (-1805.156) (-1804.261) (-1804.182) -- 0:00:06
936000 -- (-1803.939) (-1802.964) (-1805.168) [-1803.337] * [-1804.410] (-1804.648) (-1803.929) (-1806.852) -- 0:00:06
936500 -- (-1803.876) (-1804.622) (-1808.337) [-1804.567] * [-1802.424] (-1804.100) (-1804.329) (-1804.090) -- 0:00:06
937000 -- (-1803.935) (-1804.610) (-1803.967) [-1803.572] * [-1804.486] (-1803.195) (-1804.632) (-1803.449) -- 0:00:06
937500 -- (-1806.250) (-1806.778) [-1803.625] (-1807.478) * (-1805.687) (-1802.820) [-1803.663] (-1804.557) -- 0:00:06
938000 -- (-1804.760) (-1805.381) (-1803.552) [-1809.529] * (-1806.941) [-1806.924] (-1804.050) (-1804.484) -- 0:00:05
938500 -- (-1806.834) (-1806.254) (-1803.403) [-1803.689] * (-1804.036) [-1807.487] (-1807.290) (-1802.909) -- 0:00:05
939000 -- (-1804.137) (-1805.314) (-1803.523) [-1804.911] * (-1804.125) [-1805.289] (-1808.506) (-1804.274) -- 0:00:05
939500 -- (-1803.627) [-1802.522] (-1804.469) (-1805.512) * (-1803.684) (-1803.099) [-1805.166] (-1805.482) -- 0:00:05
940000 -- (-1803.834) (-1806.677) (-1804.530) [-1805.846] * (-1805.560) (-1803.099) (-1805.665) [-1805.104] -- 0:00:05
Average standard deviation of split frequencies: 0.006214
940500 -- (-1803.790) (-1803.797) (-1803.761) [-1802.987] * (-1803.113) (-1804.535) (-1803.230) [-1803.008] -- 0:00:05
941000 -- [-1803.828] (-1808.110) (-1804.168) (-1804.028) * (-1808.885) [-1804.707] (-1804.221) (-1804.044) -- 0:00:05
941500 -- (-1804.474) (-1805.616) [-1802.674] (-1807.370) * (-1809.100) (-1804.514) [-1803.243] (-1803.205) -- 0:00:05
942000 -- [-1804.547] (-1804.596) (-1803.971) (-1803.502) * (-1803.839) (-1802.899) (-1803.042) [-1803.316] -- 0:00:05
942500 -- (-1804.272) (-1804.985) [-1804.901] (-1803.562) * (-1804.353) (-1803.489) (-1805.136) [-1802.681] -- 0:00:05
943000 -- [-1802.175] (-1803.519) (-1805.314) (-1803.691) * (-1804.694) (-1803.422) (-1804.448) [-1804.224] -- 0:00:05
943500 -- (-1802.996) [-1808.215] (-1803.788) (-1802.976) * (-1806.689) (-1802.805) [-1803.912] (-1804.237) -- 0:00:05
944000 -- (-1803.100) [-1806.358] (-1803.064) (-1810.743) * (-1803.234) (-1804.454) [-1803.693] (-1806.822) -- 0:00:05
944500 -- (-1805.661) [-1803.880] (-1803.331) (-1808.674) * (-1805.503) [-1804.371] (-1803.116) (-1805.404) -- 0:00:05
945000 -- (-1803.789) (-1805.738) [-1803.881] (-1806.449) * (-1807.748) (-1804.289) [-1803.955] (-1805.962) -- 0:00:05
Average standard deviation of split frequencies: 0.006179
945500 -- (-1804.514) (-1807.402) (-1802.632) [-1802.656] * (-1809.351) [-1806.474] (-1807.704) (-1805.176) -- 0:00:05
946000 -- [-1807.117] (-1806.646) (-1803.331) (-1803.805) * (-1804.679) (-1805.381) [-1803.815] (-1805.281) -- 0:00:05
946500 -- (-1804.262) (-1805.750) [-1804.520] (-1805.042) * (-1809.790) (-1806.463) (-1805.270) [-1802.460] -- 0:00:05
947000 -- (-1804.071) (-1803.624) [-1804.012] (-1806.506) * (-1811.321) (-1803.005) [-1804.653] (-1803.041) -- 0:00:05
947500 -- (-1803.753) (-1803.981) (-1806.068) [-1803.818] * (-1806.994) (-1802.189) [-1802.174] (-1806.056) -- 0:00:05
948000 -- (-1803.763) (-1803.421) [-1804.289] (-1804.906) * [-1810.160] (-1803.641) (-1804.791) (-1806.731) -- 0:00:04
948500 -- [-1803.465] (-1804.305) (-1803.268) (-1808.686) * (-1806.357) [-1802.398] (-1804.501) (-1807.201) -- 0:00:04
949000 -- (-1804.665) (-1802.609) [-1802.700] (-1807.508) * (-1807.894) [-1804.718] (-1805.122) (-1808.068) -- 0:00:04
949500 -- [-1803.659] (-1804.577) (-1805.260) (-1809.294) * (-1807.404) (-1804.634) [-1802.987] (-1805.880) -- 0:00:04
950000 -- (-1804.000) [-1804.541] (-1809.437) (-1805.723) * (-1805.420) (-1803.029) [-1806.971] (-1803.245) -- 0:00:04
Average standard deviation of split frequencies: 0.005950
950500 -- [-1804.951] (-1805.972) (-1803.972) (-1804.306) * (-1807.022) [-1805.076] (-1805.633) (-1804.575) -- 0:00:04
951000 -- (-1804.011) [-1804.768] (-1808.130) (-1807.603) * (-1802.366) [-1804.799] (-1804.420) (-1802.476) -- 0:00:04
951500 -- (-1803.482) (-1805.941) (-1806.375) [-1803.743] * [-1801.913] (-1804.078) (-1806.476) (-1808.708) -- 0:00:04
952000 -- (-1804.289) [-1805.999] (-1810.515) (-1802.746) * (-1804.685) (-1803.823) (-1805.138) [-1804.432] -- 0:00:04
952500 -- [-1804.215] (-1802.943) (-1810.680) (-1804.181) * (-1804.493) (-1806.730) [-1804.828] (-1805.003) -- 0:00:04
953000 -- (-1805.731) [-1805.247] (-1805.382) (-1803.523) * (-1803.068) (-1808.262) [-1808.974] (-1806.418) -- 0:00:04
953500 -- (-1803.105) (-1803.874) [-1804.426] (-1803.427) * [-1804.888] (-1803.960) (-1805.601) (-1805.000) -- 0:00:04
954000 -- (-1815.433) [-1803.702] (-1806.365) (-1803.154) * (-1805.544) (-1804.675) [-1804.054] (-1804.153) -- 0:00:04
954500 -- (-1805.249) (-1802.267) (-1804.544) [-1805.681] * [-1805.748] (-1803.785) (-1805.067) (-1804.292) -- 0:00:04
955000 -- (-1804.063) [-1806.723] (-1804.399) (-1804.151) * [-1803.950] (-1803.901) (-1802.690) (-1805.665) -- 0:00:04
Average standard deviation of split frequencies: 0.006114
955500 -- (-1804.017) (-1805.006) [-1813.147] (-1804.610) * [-1805.646] (-1803.714) (-1803.959) (-1806.449) -- 0:00:04
956000 -- (-1806.559) (-1807.534) [-1808.105] (-1803.870) * (-1802.584) (-1804.800) (-1804.465) [-1806.789] -- 0:00:04
956500 -- (-1805.490) [-1806.616] (-1804.343) (-1805.569) * (-1808.499) [-1804.244] (-1803.963) (-1806.034) -- 0:00:04
957000 -- (-1803.294) [-1806.179] (-1805.958) (-1803.979) * (-1808.073) [-1804.602] (-1807.690) (-1806.955) -- 0:00:04
957500 -- (-1807.274) (-1804.888) [-1805.046] (-1804.444) * (-1802.781) (-1805.194) (-1803.197) [-1802.216] -- 0:00:04
958000 -- (-1804.271) (-1803.424) [-1807.369] (-1806.820) * (-1805.501) [-1806.171] (-1803.107) (-1808.421) -- 0:00:04
958500 -- (-1803.626) (-1807.033) (-1805.388) [-1807.407] * (-1804.421) (-1807.691) [-1806.852] (-1807.452) -- 0:00:03
959000 -- [-1807.983] (-1804.971) (-1803.486) (-1803.626) * (-1802.880) (-1807.553) (-1803.037) [-1807.801] -- 0:00:03
959500 -- (-1802.842) [-1804.613] (-1802.857) (-1804.714) * (-1805.765) [-1804.908] (-1805.396) (-1804.610) -- 0:00:03
960000 -- (-1803.569) (-1807.861) (-1802.990) [-1802.897] * (-1806.798) (-1805.294) (-1802.863) [-1803.429] -- 0:00:03
Average standard deviation of split frequencies: 0.006575
960500 -- (-1804.821) (-1809.077) (-1807.788) [-1804.215] * (-1803.041) (-1809.971) [-1802.741] (-1804.788) -- 0:00:03
961000 -- (-1803.665) (-1811.871) (-1807.353) [-1802.323] * (-1804.227) (-1808.239) (-1801.950) [-1803.241] -- 0:00:03
961500 -- (-1804.703) (-1805.724) [-1803.023] (-1802.880) * (-1803.921) (-1810.038) (-1803.945) [-1802.654] -- 0:00:03
962000 -- (-1805.992) (-1807.610) (-1805.093) [-1803.842] * [-1805.425] (-1805.500) (-1807.748) (-1802.943) -- 0:00:03
962500 -- (-1805.265) (-1809.350) (-1806.492) [-1803.784] * (-1802.915) [-1804.294] (-1808.759) (-1804.063) -- 0:00:03
963000 -- (-1803.201) (-1805.385) (-1803.324) [-1803.240] * (-1804.753) (-1806.022) [-1805.241] (-1804.037) -- 0:00:03
963500 -- [-1804.449] (-1805.128) (-1804.189) (-1803.371) * [-1803.112] (-1802.994) (-1806.328) (-1804.295) -- 0:00:03
964000 -- (-1802.571) [-1803.178] (-1805.068) (-1803.991) * (-1804.924) (-1804.890) (-1804.784) [-1803.048] -- 0:00:03
964500 -- (-1802.931) (-1804.091) (-1803.515) [-1802.457] * [-1803.517] (-1808.637) (-1804.262) (-1803.589) -- 0:00:03
965000 -- (-1804.774) (-1804.168) (-1805.379) [-1803.649] * (-1803.931) (-1803.432) (-1803.767) [-1803.049] -- 0:00:03
Average standard deviation of split frequencies: 0.006832
965500 -- (-1809.211) (-1806.133) (-1803.878) [-1804.853] * (-1803.597) (-1804.448) (-1808.413) [-1804.538] -- 0:00:03
966000 -- (-1812.237) (-1802.658) (-1804.614) [-1805.016] * (-1803.676) (-1803.581) (-1804.286) [-1805.158] -- 0:00:03
966500 -- [-1807.709] (-1802.930) (-1804.842) (-1805.962) * (-1804.962) (-1803.216) (-1803.538) [-1802.109] -- 0:00:03
967000 -- (-1812.488) (-1803.205) [-1807.586] (-1804.225) * [-1804.917] (-1803.409) (-1804.376) (-1808.330) -- 0:00:03
967500 -- (-1804.520) (-1802.873) (-1805.100) [-1803.542] * (-1805.942) (-1804.918) (-1806.162) [-1804.931] -- 0:00:03
968000 -- (-1805.276) (-1802.501) (-1806.869) [-1802.728] * (-1803.629) [-1803.702] (-1803.211) (-1805.541) -- 0:00:03
968500 -- (-1805.561) (-1803.011) [-1805.119] (-1805.710) * (-1805.390) (-1804.311) (-1802.536) [-1807.707] -- 0:00:03
969000 -- (-1804.307) (-1807.971) [-1805.205] (-1804.925) * [-1804.679] (-1807.431) (-1808.409) (-1806.074) -- 0:00:02
969500 -- (-1805.316) [-1806.082] (-1804.492) (-1805.148) * (-1807.689) [-1807.011] (-1805.693) (-1804.771) -- 0:00:02
970000 -- (-1803.445) (-1806.895) (-1805.151) [-1806.045] * (-1803.300) [-1805.918] (-1803.605) (-1805.942) -- 0:00:02
Average standard deviation of split frequencies: 0.006799
970500 -- [-1802.932] (-1806.789) (-1805.869) (-1805.578) * (-1805.360) (-1804.149) (-1805.593) [-1805.182] -- 0:00:02
971000 -- [-1805.414] (-1803.916) (-1808.460) (-1805.060) * (-1803.918) (-1805.375) (-1807.049) [-1805.989] -- 0:00:02
971500 -- (-1802.413) (-1804.327) (-1804.704) [-1804.329] * (-1802.658) [-1804.819] (-1806.119) (-1805.593) -- 0:00:02
972000 -- [-1805.506] (-1804.449) (-1808.411) (-1803.338) * [-1805.898] (-1804.925) (-1809.952) (-1803.804) -- 0:00:02
972500 -- (-1804.796) [-1805.176] (-1810.105) (-1806.704) * (-1802.940) (-1802.958) (-1805.754) [-1804.140] -- 0:00:02
973000 -- (-1804.929) (-1804.436) (-1806.459) [-1802.914] * (-1805.604) [-1806.011] (-1802.646) (-1804.025) -- 0:00:02
973500 -- (-1809.268) [-1803.888] (-1803.437) (-1803.086) * (-1807.194) (-1807.136) [-1803.193] (-1803.915) -- 0:00:02
974000 -- (-1806.259) (-1803.300) [-1802.725] (-1805.214) * (-1803.686) (-1806.028) (-1803.457) [-1804.554] -- 0:00:02
974500 -- (-1805.110) [-1802.986] (-1804.654) (-1804.785) * (-1807.907) (-1804.582) (-1806.812) [-1802.284] -- 0:00:02
975000 -- (-1807.562) [-1803.481] (-1806.075) (-1806.039) * (-1805.522) (-1803.702) (-1808.434) [-1806.317] -- 0:00:02
Average standard deviation of split frequencies: 0.006665
975500 -- (-1806.333) [-1803.473] (-1804.114) (-1803.214) * (-1802.911) [-1804.968] (-1803.758) (-1805.233) -- 0:00:02
976000 -- (-1803.593) (-1804.106) (-1805.044) [-1803.481] * (-1803.557) (-1805.054) [-1802.824] (-1803.347) -- 0:00:02
976500 -- (-1803.402) [-1807.455] (-1808.838) (-1804.043) * (-1805.819) (-1805.786) [-1804.950] (-1803.722) -- 0:00:02
977000 -- (-1803.422) (-1806.363) [-1805.077] (-1805.315) * (-1804.105) (-1805.826) [-1805.392] (-1807.058) -- 0:00:02
977500 -- (-1803.673) (-1802.812) [-1804.314] (-1806.786) * (-1806.035) (-1808.227) (-1806.421) [-1807.415] -- 0:00:02
978000 -- [-1805.101] (-1807.393) (-1804.067) (-1806.552) * (-1804.094) [-1803.351] (-1804.084) (-1803.065) -- 0:00:02
978500 -- [-1803.904] (-1808.073) (-1804.201) (-1807.244) * (-1805.799) [-1805.147] (-1804.870) (-1804.812) -- 0:00:02
979000 -- [-1807.315] (-1806.379) (-1803.005) (-1805.054) * (-1804.358) [-1804.624] (-1807.828) (-1805.817) -- 0:00:02
979500 -- (-1804.732) (-1803.988) [-1805.051] (-1804.843) * (-1805.816) [-1803.772] (-1804.166) (-1810.536) -- 0:00:01
980000 -- (-1804.949) (-1805.673) (-1803.253) [-1803.620] * (-1804.781) (-1803.105) (-1804.156) [-1804.870] -- 0:00:01
Average standard deviation of split frequencies: 0.006441
980500 -- (-1804.467) [-1804.114] (-1804.424) (-1808.317) * (-1802.827) [-1806.303] (-1805.763) (-1804.381) -- 0:00:01
981000 -- (-1808.455) (-1803.947) [-1803.899] (-1804.359) * (-1804.848) (-1804.870) [-1802.893] (-1803.189) -- 0:00:01
981500 -- [-1804.959] (-1804.188) (-1803.395) (-1805.826) * (-1802.979) (-1806.132) [-1804.075] (-1806.914) -- 0:00:01
982000 -- (-1803.485) [-1802.969] (-1803.407) (-1808.481) * (-1804.191) [-1805.189] (-1803.555) (-1805.634) -- 0:00:01
982500 -- (-1806.827) (-1803.766) (-1804.590) [-1805.614] * (-1804.410) (-1807.613) [-1805.628] (-1802.867) -- 0:00:01
983000 -- [-1803.981] (-1803.652) (-1804.548) (-1807.789) * (-1803.687) (-1808.154) (-1804.255) [-1802.578] -- 0:00:01
983500 -- (-1807.218) [-1807.623] (-1805.395) (-1804.000) * (-1803.405) (-1805.667) (-1803.179) [-1803.240] -- 0:00:01
984000 -- [-1804.487] (-1802.975) (-1806.720) (-1803.055) * (-1803.313) (-1804.701) [-1808.396] (-1804.729) -- 0:00:01
984500 -- (-1804.361) [-1802.277] (-1802.946) (-1803.282) * (-1802.612) (-1802.799) (-1806.195) [-1802.810] -- 0:00:01
985000 -- (-1805.435) (-1805.087) (-1803.622) [-1803.385] * (-1802.982) [-1805.747] (-1806.488) (-1802.997) -- 0:00:01
Average standard deviation of split frequencies: 0.006693
985500 -- (-1805.432) [-1803.899] (-1804.750) (-1803.773) * (-1803.431) (-1803.590) [-1806.624] (-1806.649) -- 0:00:01
986000 -- (-1808.158) [-1803.942] (-1802.774) (-1803.358) * [-1803.605] (-1803.064) (-1804.757) (-1804.653) -- 0:00:01
986500 -- (-1804.433) (-1806.576) (-1802.954) [-1803.143] * (-1804.258) (-1803.197) (-1803.576) [-1803.027] -- 0:00:01
987000 -- (-1805.628) [-1806.459] (-1805.638) (-1807.506) * (-1806.862) (-1806.724) (-1805.561) [-1803.361] -- 0:00:01
987500 -- (-1810.906) [-1805.103] (-1803.692) (-1806.791) * (-1804.067) (-1805.465) (-1804.742) [-1803.450] -- 0:00:01
988000 -- [-1807.631] (-1804.884) (-1806.843) (-1803.300) * (-1805.544) (-1803.497) (-1803.979) [-1804.347] -- 0:00:01
988500 -- (-1809.486) (-1803.896) (-1805.193) [-1804.556] * (-1805.185) (-1806.033) [-1803.109] (-1806.838) -- 0:00:01
989000 -- (-1807.778) [-1804.014] (-1803.849) (-1808.385) * (-1804.826) (-1805.740) (-1805.118) [-1806.881] -- 0:00:01
989500 -- [-1802.834] (-1804.025) (-1804.706) (-1804.956) * [-1804.272] (-1804.111) (-1809.599) (-1803.501) -- 0:00:01
990000 -- [-1805.415] (-1804.642) (-1806.290) (-1805.275) * [-1804.825] (-1804.125) (-1807.984) (-1806.881) -- 0:00:00
Average standard deviation of split frequencies: 0.007043
990500 -- (-1804.089) (-1804.145) [-1803.374] (-1804.504) * (-1811.672) [-1803.604] (-1803.565) (-1805.350) -- 0:00:00
991000 -- (-1804.662) (-1805.963) [-1804.932] (-1804.665) * (-1803.205) (-1805.274) (-1805.995) [-1803.107] -- 0:00:00
991500 -- (-1804.026) [-1805.434] (-1805.508) (-1803.798) * (-1803.232) (-1803.080) (-1804.273) [-1803.502] -- 0:00:00
992000 -- (-1804.846) [-1804.211] (-1804.845) (-1806.919) * [-1802.884] (-1803.759) (-1805.373) (-1805.286) -- 0:00:00
992500 -- [-1811.756] (-1803.661) (-1809.564) (-1806.686) * [-1803.787] (-1805.300) (-1805.019) (-1803.506) -- 0:00:00
993000 -- (-1805.429) (-1809.024) (-1804.403) [-1803.877] * (-1805.437) (-1805.070) (-1806.030) [-1804.303] -- 0:00:00
993500 -- [-1804.990] (-1808.862) (-1803.034) (-1803.259) * (-1802.776) (-1807.715) (-1806.615) [-1803.849] -- 0:00:00
994000 -- (-1804.506) (-1804.321) (-1805.135) [-1804.351] * [-1803.507] (-1806.079) (-1803.875) (-1807.156) -- 0:00:00
994500 -- (-1805.376) [-1804.714] (-1806.752) (-1804.674) * [-1803.511] (-1802.418) (-1805.626) (-1808.527) -- 0:00:00
995000 -- (-1804.198) (-1804.315) [-1804.229] (-1805.901) * (-1808.117) (-1802.960) [-1809.223] (-1805.988) -- 0:00:00
Average standard deviation of split frequencies: 0.006910
995500 -- [-1802.394] (-1802.690) (-1804.607) (-1804.013) * [-1804.981] (-1804.034) (-1802.286) (-1804.371) -- 0:00:00
996000 -- (-1802.802) [-1804.238] (-1803.386) (-1808.893) * [-1804.319] (-1807.533) (-1802.660) (-1804.157) -- 0:00:00
996500 -- [-1805.939] (-1806.430) (-1804.519) (-1803.762) * (-1803.699) [-1804.519] (-1803.671) (-1806.288) -- 0:00:00
997000 -- [-1804.547] (-1803.842) (-1805.503) (-1803.374) * (-1807.043) (-1804.890) (-1805.097) [-1804.581] -- 0:00:00
997500 -- (-1807.822) (-1804.702) [-1805.703] (-1804.013) * [-1804.072] (-1807.067) (-1803.553) (-1804.973) -- 0:00:00
998000 -- (-1804.931) (-1805.432) [-1807.394] (-1804.618) * (-1805.461) (-1805.005) (-1803.917) [-1805.082] -- 0:00:00
998500 -- (-1804.304) (-1804.572) [-1803.678] (-1804.295) * (-1805.383) (-1803.742) (-1804.967) [-1803.447] -- 0:00:00
999000 -- (-1805.486) (-1804.714) (-1806.421) [-1805.500] * (-1806.709) [-1803.378] (-1805.479) (-1807.117) -- 0:00:00
999500 -- (-1805.253) [-1803.238] (-1805.473) (-1807.292) * (-1805.363) [-1804.235] (-1804.194) (-1806.295) -- 0:00:00
1000000 -- (-1805.739) [-1803.443] (-1803.693) (-1807.365) * (-1804.868) (-1803.042) (-1804.137) [-1803.927] -- 0:00:00
Average standard deviation of split frequencies: 0.007255
Analysis completed in 1 mins 36 seconds
Analysis used 94.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1800.87
Likelihood of best state for "cold" chain of run 2 was -1800.90
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 78 %) Dirichlet(Revmat{all})
99.4 % (100 %) Slider(Revmat{all})
24.5 % ( 23 %) Dirichlet(Pi{all})
26.2 % ( 17 %) Slider(Pi{all})
79.6 % ( 51 %) Multiplier(Alpha{1,2})
73.9 % ( 42 %) Multiplier(Alpha{3})
22.2 % ( 24 %) Slider(Pinvar{all})
96.2 % ( 97 %) ExtSPR(Tau{all},V{all})
96.1 % ( 96 %) ExtTBR(Tau{all},V{all})
97.1 % ( 98 %) NNI(Tau{all},V{all})
82.4 % ( 81 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
96.3 % ( 97 %) Nodeslider(V{all})
31.3 % ( 15 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 67 %) Dirichlet(Revmat{all})
99.3 % ( 97 %) Slider(Revmat{all})
23.9 % ( 25 %) Dirichlet(Pi{all})
26.8 % ( 25 %) Slider(Pi{all})
79.8 % ( 59 %) Multiplier(Alpha{1,2})
74.0 % ( 55 %) Multiplier(Alpha{3})
23.0 % ( 31 %) Slider(Pinvar{all})
96.2 % ( 97 %) ExtSPR(Tau{all},V{all})
95.9 % ( 98 %) ExtTBR(Tau{all},V{all})
97.0 % ( 96 %) NNI(Tau{all},V{all})
82.4 % ( 81 %) ParsSPR(Tau{all},V{all})
28.1 % ( 33 %) Multiplier(V{all})
96.1 % ( 95 %) Nodeslider(V{all})
31.9 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166809 0.83 0.69
3 | 166393 167012 0.85
4 | 166876 166124 166786
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.82 0.66 0.53
2 | 166572 0.84 0.69
3 | 167105 166460 0.85
4 | 166710 166729 166424
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1803.80
| 2 1 |
| |
| 1 1 1 1 1 1 |
|2 2 2 2 1 1 1 |
| 1 1 2 1 22 1 1 22 1 2|
| 21 1 2 2 21 2 * * * 22 2 2 2 1 1* 1 |
| 2* 2 1 21 22 * 2 2 22 1 |
| 21 2 1 21 2 2 * 2 12 22 |
| 1 1 1 2 2 1 1 |
| 2 1 1 11 1 1* 21 2 2 1|
| 1 2 1 1 |
|11 2 2 1 2 1 |
| 2 1 1 |
| 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1805.47
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1803.80 -1807.14
2 -1803.85 -1806.52
--------------------------------------
TOTAL -1803.83 -1806.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.688586 0.069424 0.235483 1.201111 0.655738 1354.79 1368.35 1.000
r(A<->C){all} 0.165547 0.018947 0.000036 0.438836 0.129332 242.99 262.27 1.001
r(A<->G){all} 0.167172 0.020414 0.000018 0.450350 0.128395 166.80 227.48 1.000
r(A<->T){all} 0.169434 0.020718 0.000018 0.451463 0.128626 186.58 220.09 1.002
r(C<->G){all} 0.186119 0.023728 0.000044 0.492459 0.144765 226.36 228.99 1.004
r(C<->T){all} 0.162439 0.018665 0.000010 0.430253 0.128915 165.38 193.70 1.000
r(G<->T){all} 0.149291 0.016669 0.000027 0.407213 0.115257 170.17 217.04 1.000
pi(A){all} 0.177276 0.000114 0.156892 0.198564 0.177008 1083.39 1188.77 1.000
pi(C){all} 0.301122 0.000157 0.277351 0.326316 0.300889 1289.12 1324.33 1.000
pi(G){all} 0.301133 0.000160 0.276891 0.325355 0.301391 1221.46 1248.71 1.000
pi(T){all} 0.220469 0.000136 0.196923 0.242528 0.220397 1226.70 1240.04 1.000
alpha{1,2} 0.346114 0.208937 0.000181 1.279147 0.168189 1039.26 1082.04 1.001
alpha{3} 0.487311 0.233305 0.000359 1.407055 0.337227 1314.76 1329.77 1.000
pinvar{all} 0.997482 0.000005 0.993232 0.999930 0.998109 1222.00 1253.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ..**.
7 -- ..***
8 -- ..*.*
9 -- .*.*.
10 -- .**..
11 -- .*..*
12 -- .***.
13 -- .*.**
14 -- .**.*
15 -- ...**
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 664 0.221186 0.001884 0.219853 0.222518 2
7 636 0.211859 0.008480 0.205863 0.217855 2
8 626 0.208528 0.004711 0.205197 0.211859 2
9 613 0.204197 0.018373 0.191206 0.217189 2
10 582 0.193871 0.002827 0.191872 0.195869 2
11 582 0.193871 0.013191 0.184544 0.203198 2
12 579 0.192871 0.003298 0.190540 0.195203 2
13 579 0.192871 0.008009 0.187209 0.198534 2
14 577 0.192205 0.005182 0.188541 0.195869 2
15 566 0.188541 0.006595 0.183877 0.193205 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096066 0.009635 0.000064 0.293145 0.067038 1.000 2
length{all}[2] 0.097504 0.009605 0.000031 0.294309 0.066426 1.001 2
length{all}[3] 0.099480 0.009901 0.000062 0.303195 0.067203 1.000 2
length{all}[4] 0.108350 0.010573 0.000025 0.317772 0.077514 1.000 2
length{all}[5] 0.094033 0.008650 0.000023 0.276315 0.067334 1.001 2
length{all}[6] 0.104152 0.010693 0.000025 0.318074 0.072223 0.999 2
length{all}[7] 0.095729 0.009648 0.000123 0.292166 0.063214 0.998 2
length{all}[8] 0.099343 0.010823 0.000005 0.297474 0.064993 0.999 2
length{all}[9] 0.094042 0.008692 0.000038 0.297572 0.062254 0.998 2
length{all}[10] 0.089337 0.007700 0.000314 0.258960 0.060547 1.001 2
length{all}[11] 0.098119 0.010466 0.000023 0.307239 0.066294 0.999 2
length{all}[12] 0.094435 0.009031 0.000187 0.293375 0.065317 0.998 2
length{all}[13] 0.091819 0.009194 0.000015 0.270737 0.062043 1.000 2
length{all}[14] 0.099083 0.010719 0.000064 0.312016 0.066728 0.999 2
length{all}[15] 0.098688 0.010766 0.000122 0.292054 0.070653 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007255
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
+------------------------------------------------------------------------ C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\------------------------------------------------------------------------ C5 (5)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------- C2 (2)
|
+-------------------------------------------------------------- C3 (3)
|
|------------------------------------------------------------------------ C4 (4)
|
\--------------------------------------------------------------- C5 (5)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (15 trees sampled):
50 % credible set contains 7 trees
90 % credible set contains 14 trees
95 % credible set contains 15 trees
99 % credible set contains 15 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 5 ls = 1959
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
645 ambiguity characters in seq. 1
645 ambiguity characters in seq. 2
1290 ambiguity characters in seq. 3
669 ambiguity characters in seq. 4
645 ambiguity characters in seq. 5
438 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 215 / 215 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 215 / 215 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.095474 0.014850 0.098563 0.056194 0.073648 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -917.349044
Iterating by ming2
Initial: fx= 917.349044
x= 0.09547 0.01485 0.09856 0.05619 0.07365 0.30000 1.30000
1 h-m-p 0.0000 0.0001 468.7074 ++ 901.920733 m 0.0001 12 | 1/7
2 h-m-p 0.0011 0.0145 26.2853 -----------.. | 1/7
3 h-m-p 0.0000 0.0002 419.3383 +++ 867.178737 m 0.0002 42 | 2/7
4 h-m-p 0.0043 0.0295 16.7665 ------------.. | 2/7
5 h-m-p 0.0000 0.0001 365.3986 ++ 856.030588 m 0.0001 72 | 3/7
6 h-m-p 0.0024 0.6165 10.1803 ------------.. | 3/7
7 h-m-p 0.0000 0.0001 298.8830 ++ 846.660634 m 0.0001 102 | 4/7
8 h-m-p 0.0160 8.0000 7.2898 -------------.. | 4/7
9 h-m-p 0.0000 0.0000 212.1440 ++ 845.993345 m 0.0000 133 | 5/7
10 h-m-p 0.3299 8.0000 0.0000 -Y 845.993345 0 0.0206 144 | 5/7
11 h-m-p 0.5957 8.0000 0.0000 ----Y 845.993345 0 0.0006 160
Out..
lnL = -845.993345
161 lfun, 161 eigenQcodon, 805 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.084427 0.102252 0.045271 0.033645 0.062253 0.299980 0.824792 0.406835
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.535292
np = 8
lnL0 = -914.360197
Iterating by ming2
Initial: fx= 914.360197
x= 0.08443 0.10225 0.04527 0.03365 0.06225 0.29998 0.82479 0.40683
1 h-m-p 0.0000 0.0002 458.2491 +++ 879.813979 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0002 246.5698 ++ 869.992782 m 0.0002 25 | 2/8
3 h-m-p 0.0000 0.0000 17594.3996 ++ 859.432840 m 0.0000 36 | 3/8
4 h-m-p 0.0000 0.0000 2431.0996 ++ 849.776100 m 0.0000 47 | 4/8
5 h-m-p 0.0000 0.0000 4023.7804 ++ 845.993357 m 0.0000 58 | 5/8
6 h-m-p 1.6000 8.0000 0.0000 ++ 845.993357 m 8.0000 69 | 5/8
7 h-m-p 0.0008 0.3851 1.0468 +++++ 845.993348 m 0.3851 86 | 6/8
8 h-m-p 1.6000 8.0000 0.0017 ++ 845.993348 m 8.0000 97 | 6/8
9 h-m-p 0.7977 8.0000 0.0169 -------------Y 845.993348 0 0.0000 123 | 6/8
10 h-m-p 0.0160 8.0000 0.0000 C 845.993348 0 0.0160 136 | 6/8
11 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
12 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/8
13 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -845.993348
209 lfun, 627 eigenQcodon, 2090 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.061489 0.032827 0.070947 0.082758 0.026956 0.000100 1.270660 0.596316 0.126200 1.304889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.511708
np = 10
lnL0 = -900.979682
Iterating by ming2
Initial: fx= 900.979682
x= 0.06149 0.03283 0.07095 0.08276 0.02696 0.00011 1.27066 0.59632 0.12620 1.30489
1 h-m-p 0.0000 0.0000 422.1972 ++ 900.422536 m 0.0000 25 | 1/10
2 h-m-p 0.0000 0.0007 186.6399 ++++ 878.863367 m 0.0007 50 | 2/10
3 h-m-p 0.0003 0.0015 109.0335 ++ 865.964881 m 0.0015 72 | 3/10
4 h-m-p 0.0001 0.0004 337.3996 ++ 859.193070 m 0.0004 93 | 4/10
5 h-m-p 0.0000 0.0002 794.1184 ++ 851.465799 m 0.0002 113 | 5/10
6 h-m-p 0.0001 0.0004 696.1641 ++ 850.375338 m 0.0004 132 | 6/10
7 h-m-p 0.0004 0.0022 144.7620 -----------.. | 6/10
8 h-m-p 0.0000 0.0001 208.2505 ++ 845.993348 m 0.0001 176 | 7/10
9 h-m-p 1.6000 8.0000 0.0000 +C 845.993348 0 6.4000 194 | 7/10
10 h-m-p 0.0160 8.0000 0.0053 -------------.. | 7/10
11 h-m-p 0.0160 8.0000 0.0000 ------------Y 845.993348 0 0.0000 249
Out..
lnL = -845.993348
250 lfun, 1000 eigenQcodon, 3750 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -846.003918 S = -845.991051 -0.004926
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:02
did 20 / 52 patterns 0:02
did 30 / 52 patterns 0:02
did 40 / 52 patterns 0:02
did 50 / 52 patterns 0:02
did 52 / 52 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.020150 0.074132 0.075968 0.071474 0.040992 0.000100 0.890972 1.741105
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.750205
np = 8
lnL0 = -904.057808
Iterating by ming2
Initial: fx= 904.057808
x= 0.02015 0.07413 0.07597 0.07147 0.04099 0.00011 0.89097 1.74110
1 h-m-p 0.0000 0.0000 445.5712 ++ 903.527491 m 0.0000 21 | 1/8
2 h-m-p 0.0001 0.0274 32.4412 +++++ 900.242199 m 0.0274 43 | 2/8
3 h-m-p 0.0000 0.0000 92104.6844 ++ 853.818460 m 0.0000 61 | 3/8
4 h-m-p 0.0002 0.0010 111.1652 ++ 853.168325 m 0.0010 78 | 4/8
5 h-m-p 0.0000 0.0000 550.7206 ++ 852.408178 m 0.0000 94 | 5/8
6 h-m-p 0.0001 0.0045 210.5528 +++ 852.141869 m 0.0045 110 | 5/8
7 h-m-p 0.0018 0.1828 541.6175 -CYCCYCYCYC 852.113174 9 0.0000 141 | 5/8
8 h-m-p 0.0013 0.0063 1.9087 -----------.. | 5/8
9 h-m-p 0.0000 0.0001 291.9741 ++ 847.426107 m 0.0001 178 | 6/8
10 h-m-p 0.0007 0.0102 15.8354 ++ 845.993346 m 0.0102 192 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 ++ 845.993346 m 8.0000 205 | 7/8
12 h-m-p 0.0160 8.0000 0.0027 +++++ 845.993346 m 8.0000 220 | 7/8
13 h-m-p 1.2287 8.0000 0.0174 ++ 845.993346 m 8.0000 232 | 7/8
14 h-m-p 1.6000 8.0000 0.0093 ++ 845.993346 m 8.0000 244 | 7/8
15 h-m-p 0.4517 8.0000 0.1648 +++ 845.993346 m 8.0000 257 | 7/8
16 h-m-p 1.2806 6.4032 0.2698 -C 845.993346 0 0.0800 270 | 7/8
17 h-m-p 0.0160 8.0000 4.0729 +
QuantileBeta(0.15, 0.00500, 2.75353) = 9.062795e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.88155) = 3.822263e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.39366) = 1.151421e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
+ 845.993346 m 8.0000 285
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29445) = 5.080487e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29506) = 4.912409e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.29384) = 4.912586e-162 2000 rounds
| 7/8
18 h-m-p 1.6000 8.0000 2.6787
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 17.15055) = 1.237347e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 32.15146) = 5.245049e-162 2000 rounds
N 845.993346 0 1.6000 297
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 6.983066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00848) = 7.226843e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00903) = 6.982934e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.00792) = 6.983198e-162 2000 rounds
| 7/8
19 h-m-p 0.7708 8.0000 5.5606
QuantileBeta(0.15, 0.00500, 34.29445) = 4.912497e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 40.72341) = 4.127419e-162 2000 rounds
N 845.993346 0 3.0831 310
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.680386e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15312) = 3.558634e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15162) = 3.558749e-162 2000 rounds
| 7/8
20 h-m-p 1.6000 8.0000 2.6906
QuantileBeta(0.15, 0.00500, 42.84745) = 3.920421e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 45.80708) = 3.664348e-162 2000 rounds
C 845.993346 0 0.4000 322
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.642718e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07614) = 3.767286e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07688) = 3.642659e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.07540) = 3.642777e-162 2000 rounds
| 7/8
21 h-m-p 0.5075 8.0000 2.1206
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.38107) = 1.991634e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.19673) = 2.082835e-162 2000 rounds
Y 845.993346 0 0.5075 334
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.558691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15237) = 3.680386e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15312) = 3.558634e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.15162) = 3.558749e-162 2000 rounds
| 7/8
22 h-m-p 1.0305 8.0000 1.0444
QuantileBeta(0.15, 0.00500, 48.22860) = 2.081445e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 55.50723) = 1.806046e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.84295) = 2.013352e-162 2000 rounds
N 845.993346 0 4.1221 347
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 2.017760e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45809) = 1.949543e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45650) = 1.949604e-162 2000 rounds
| 7/8
23 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
N 845.993346 0 1.6000 359
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
Out..
lnL = -845.993346
360 lfun, 3960 eigenQcodon, 18000 P(t)
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 51.45730) = 1.949573e-162 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5); MP score: 0
0.046168 0.066758 0.040596 0.075103 0.015627 0.000100 0.900000 0.608941 1.170083 1.300040
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.535563
np = 10
lnL0 = -895.522736
Iterating by ming2
Initial: fx= 895.522736
x= 0.04617 0.06676 0.04060 0.07510 0.01563 0.00011 0.90000 0.60894 1.17008 1.30004
1 h-m-p 0.0000 0.0000 434.6973 ++ 894.880854 m 0.0000 25 | 1/10
2 h-m-p 0.0000 0.0019 97.3941 ++++ 878.661414 m 0.0019 50 | 2/10
3 h-m-p 0.0001 0.0003 365.4730 ++ 858.579001 m 0.0003 72 | 3/10
4 h-m-p 0.0003 0.0015 68.6039 ++ 856.037306 m 0.0015 93 | 4/10
5 h-m-p 0.0000 0.0000 14917.6645 ++ 848.327106 m 0.0000 113 | 5/10
6 h-m-p 0.0000 0.0000 30262.0289 ++ 847.575846 m 0.0000 132 | 6/10
7 h-m-p 0.0033 0.0443 18.6053 ------------.. | 6/10
8 h-m-p 0.0000 0.0000 210.4186 ++ 845.993348 m 0.0000 177 | 7/10
9 h-m-p 0.9865 8.0000 0.0000 ++ 845.993348 m 8.0000 194 | 7/10
10 h-m-p 0.0160 8.0000 0.0034 ---Y 845.993348 0 0.0001 213 | 7/10
11 h-m-p 0.0160 8.0000 0.0001 +++++ 845.993348 m 8.0000 232 | 7/10
12 h-m-p 0.0089 4.4427 0.1576 +++++ 845.993347 m 4.4427 251 | 8/10
13 h-m-p 0.2814 2.3712 0.2924 ----------Y 845.993347 0 0.0000 277 | 8/10
14 h-m-p 0.0160 8.0000 0.0000 +++++ 845.993347 m 8.0000 295 | 8/10
15 h-m-p 0.0002 0.1227 2.5287 +++++ 845.993346 m 0.1227 313 | 9/10
16 h-m-p 1.0000 8.0000 0.0213 Y 845.993346 0 0.5882 328 | 9/10
17 h-m-p 1.6000 8.0000 0.0000 N 845.993346 0 1.6000 342
Out..
lnL = -845.993346
343 lfun, 4116 eigenQcodon, 18865 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -846.035950 S = -845.994008 -0.018551
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:14
did 20 / 52 patterns 0:14
did 30 / 52 patterns 0:14
did 40 / 52 patterns 0:14
did 50 / 52 patterns 0:14
did 52 / 52 patterns 0:14
Time used: 0:14
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0125/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 215
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 1 1 1 1 1 | Tyr TAT 4 4 4 4 4 | Cys TGT 0 0 0 0 0
TTC 2 2 2 2 2 | TCC 2 2 2 2 2 | TAC 2 2 2 2 2 | TGC 1 1 1 1 1
Leu TTA 2 2 2 2 2 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 10 10 10 10 10 | TCG 4 4 4 4 4 | TAG 0 0 0 0 0 | Trp TGG 3 3 3 3 3
----------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 | Pro CCT 2 2 2 2 2 | His CAT 1 1 1 1 1 | Arg CGT 0 0 0 0 0
CTC 4 4 4 4 4 | CCC 3 3 3 3 3 | CAC 4 4 4 4 4 | CGC 2 2 2 2 2
CTA 0 0 0 0 0 | CCA 2 2 2 2 2 | Gln CAA 2 2 2 2 2 | CGA 3 3 3 3 3
CTG 8 8 8 8 8 | CCG 9 9 9 9 9 | CAG 9 9 9 9 9 | CGG 6 6 6 6 6
----------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 | Thr ACT 1 1 1 1 1 | Asn AAT 5 5 5 5 5 | Ser AGT 3 3 3 3 3
ATC 4 4 4 4 4 | ACC 3 3 3 3 3 | AAC 5 5 5 5 5 | AGC 0 0 0 0 0
ATA 1 1 1 1 1 | ACA 1 1 1 1 1 | Lys AAA 0 0 0 0 0 | Arg AGA 2 2 2 2 2
Met ATG 2 2 2 2 2 | ACG 5 5 5 5 5 | AAG 2 2 2 2 2 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 | Ala GCT 8 8 8 8 8 | Asp GAT 4 4 4 4 4 | Gly GGT 8 8 8 8 8
GTC 3 3 3 3 3 | GCC 15 15 15 15 15 | GAC 5 5 5 5 5 | GGC 3 3 3 3 3
GTA 3 3 3 3 3 | GCA 4 4 4 4 4 | Glu GAA 4 4 4 4 4 | GGA 3 3 3 3 3
GTG 15 15 15 15 15 | GCG 4 4 4 4 4 | GAG 7 7 7 7 7 | GGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907544_1_127_MLBR_RS00630
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
#2: NC_002677_1_NP_301219_1_91_ML0125
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
#3: NZ_LVXE01000095_1_2920_A3216_RS14065
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
#4: NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
#5: NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 5 | Tyr Y TAT 20 | Cys C TGT 0
TTC 10 | TCC 10 | TAC 10 | TGC 5
Leu L TTA 10 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 50 | TCG 20 | TAG 0 | Trp W TGG 15
------------------------------------------------------------------------------
Leu L CTT 15 | Pro P CCT 10 | His H CAT 5 | Arg R CGT 0
CTC 20 | CCC 15 | CAC 20 | CGC 10
CTA 0 | CCA 10 | Gln Q CAA 10 | CGA 15
CTG 40 | CCG 45 | CAG 45 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 5 | Asn N AAT 25 | Ser S AGT 15
ATC 20 | ACC 15 | AAC 25 | AGC 0
ATA 5 | ACA 5 | Lys K AAA 0 | Arg R AGA 10
Met M ATG 10 | ACG 25 | AAG 10 | AGG 0
------------------------------------------------------------------------------
Val V GTT 20 | Ala A GCT 40 | Asp D GAT 20 | Gly G GGT 40
GTC 15 | GCC 75 | GAC 25 | GGC 15
GTA 15 | GCA 20 | Glu E GAA 20 | GGA 15
GTG 75 | GCG 20 | GAG 35 | GGG 10
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14419 C:0.26977 A:0.15814 G:0.42791
position 2: T:0.28372 C:0.29767 A:0.25116 G:0.16744
position 3: T:0.20465 C:0.26977 A:0.12558 G:0.40000
Average T:0.21085 C:0.27907 A:0.17829 G:0.33178
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 7): -845.993345 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.299980 1.300040
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010907544_1_127_MLBR_RS00630: 0.000004, NC_002677_1_NP_301219_1_91_ML0125: 0.000004, NZ_LVXE01000095_1_2920_A3216_RS14065: 0.000004, NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535: 0.000004, NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29998
omega (dN/dS) = 1.30004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 482.0 163.0 1.3000 0.0000 0.0000 0.0 0.0
6..2 0.000 482.0 163.0 1.3000 0.0000 0.0000 0.0 0.0
6..3 0.000 482.0 163.0 1.3000 0.0000 0.0000 0.0 0.0
6..4 0.000 482.0 163.0 1.3000 0.0000 0.0000 0.0 0.0
6..5 0.000 482.0 163.0 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
check convergence..
lnL(ntime: 5 np: 8): -845.993348 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.517412 0.380649
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010907544_1_127_MLBR_RS00630: 0.000004, NC_002677_1_NP_301219_1_91_ML0125: 0.000004, NZ_LVXE01000095_1_2920_A3216_RS14065: 0.000004, NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535: 0.000004, NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.51741 0.48259
w: 0.38065 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 488.4 156.6 0.6795 0.0000 0.0000 0.0 0.0
6..2 0.000 488.4 156.6 0.6795 0.0000 0.0000 0.0 0.0
6..3 0.000 488.4 156.6 0.6795 0.0000 0.0000 0.0 0.0
6..4 0.000 488.4 156.6 0.6795 0.0000 0.0000 0.0 0.0
6..5 0.000 488.4 156.6 0.6795 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 10): -845.993348 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.558918 0.284548 0.000001 1.286314
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010907544_1_127_MLBR_RS00630: 0.000004, NC_002677_1_NP_301219_1_91_ML0125: 0.000004, NZ_LVXE01000095_1_2920_A3216_RS14065: 0.000004, NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535: 0.000004, NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.55892 0.28455 0.15653
w: 0.00000 1.00000 1.28631
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 488.4 156.6 0.4859 0.0000 0.0000 0.0 0.0
6..2 0.000 488.4 156.6 0.4859 0.0000 0.0000 0.0 0.0
6..3 0.000 488.4 156.6 0.4859 0.0000 0.0000 0.0 0.0
6..4 0.000 488.4 156.6 0.4859 0.0000 0.0000 0.0 0.0
6..5 0.000 488.4 156.6 0.4859 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907544_1_127_MLBR_RS00630)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907544_1_127_MLBR_RS00630)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 8): -845.993346 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 51.457299
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010907544_1_127_MLBR_RS00630: 0.000004, NC_002677_1_NP_301219_1_91_ML0125: 0.000004, NZ_LVXE01000095_1_2920_A3216_RS14065: 0.000004, NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535: 0.000004, NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 51.45730
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..2 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..3 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..4 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..5 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5); MP score: 0
lnL(ntime: 5 np: 10): -845.993346 +0.000000
6..1 6..2 6..3 6..4 6..5
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.366396 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000020
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004);
(NC_011896_1_WP_010907544_1_127_MLBR_RS00630: 0.000004, NC_002677_1_NP_301219_1_91_ML0125: 0.000004, NZ_LVXE01000095_1_2920_A3216_RS14065: 0.000004, NZ_LYPH01000007_1_WP_082911537_1_325_A8144_RS01535: 0.000004, NZ_AP014567_1_WP_010907544_1_129_JK2ML_RS00675: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.36640
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..2 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..3 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..4 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
6..5 0.000 488.4 156.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907544_1_127_MLBR_RS00630)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:14