--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:47:25 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0125/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1803.80         -1807.14
2      -1803.85         -1806.52
--------------------------------------
TOTAL    -1803.83         -1806.88
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.688586    0.069424    0.235483    1.201111    0.655738   1354.79   1368.35    1.000
r(A<->C){all}   0.165547    0.018947    0.000036    0.438836    0.129332    242.99    262.27    1.001
r(A<->G){all}   0.167172    0.020414    0.000018    0.450350    0.128395    166.80    227.48    1.000
r(A<->T){all}   0.169434    0.020718    0.000018    0.451463    0.128626    186.58    220.09    1.002
r(C<->G){all}   0.186119    0.023728    0.000044    0.492459    0.144765    226.36    228.99    1.004
r(C<->T){all}   0.162439    0.018665    0.000010    0.430253    0.128915    165.38    193.70    1.000
r(G<->T){all}   0.149291    0.016669    0.000027    0.407213    0.115257    170.17    217.04    1.000
pi(A){all}      0.177276    0.000114    0.156892    0.198564    0.177008   1083.39   1188.77    1.000
pi(C){all}      0.301122    0.000157    0.277351    0.326316    0.300889   1289.12   1324.33    1.000
pi(G){all}      0.301133    0.000160    0.276891    0.325355    0.301391   1221.46   1248.71    1.000
pi(T){all}      0.220469    0.000136    0.196923    0.242528    0.220397   1226.70   1240.04    1.000
alpha{1,2}      0.346114    0.208937    0.000181    1.279147    0.168189   1039.26   1082.04    1.001
alpha{3}        0.487311    0.233305    0.000359    1.407055    0.337227   1314.76   1329.77    1.000
pinvar{all}     0.997482    0.000005    0.993232    0.999930    0.998109   1222.00   1253.01    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-845.993348
Model 2: PositiveSelection	-845.993348
Model 0: one-ratio	-845.993345
Model 7: beta	-845.993346
Model 8: beta&w>1	-845.993346


Model 0 vs 1	5.999999984851456E-6

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C2
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C3
LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
LHTVSQNPPPTSLARQKRPLRFGooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooo
>C4
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo
>C5
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=653 

C1              VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C2              VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C3              --------------------------------------------------
C4              VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
C5              VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
                                                                  

C1              YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C2              YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C3              --------------------------------------------------
C4              YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
C5              YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
                                                                  

C1              RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C2              RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C3              --------------------------------------------------
C4              RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
C5              RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
                                                                  

C1              RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C2              RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C3              --------------------------------------------------
C4              RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
C5              RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
                                                                  

C1              LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C2              LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C3              ---------------LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C4              LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
C5              LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
                               ***********************************

C1              WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C2              WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C3              WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C4              WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
C5              WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
                **************************************************

C1              VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C2              VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C3              VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C4              VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
C5              VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
                **************************************************

C1              QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C2              QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C3              QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C4              QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
C5              QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
                **************************************************

C1              LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
C2              LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
C3              LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFGoooooooooooo
C4              LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo------------
C5              LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG------------
                ******************************                    

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              oooooooooooooooooooooooooooooooooooooooooooooooooo
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              oooooooooooooooooooooooooooooooooooooooooooooooooo
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              oooooooooooooooooooooooooooooooooooooooooooooooooo
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              oooooooooooooooooooooooooooooooooooooooooooooooooo
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              ---
C2              ---
C3              ooo
C4              ---
C5              ---
                   




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  438 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  438 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [19272]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [19272]--->[14924]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.517 Mb, Max= 31.087 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C2              LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C3              LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C4              LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
C5              LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL
                **************************************************

C1              GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C2              GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C3              GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C4              GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
C5              GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA
                **************************************************

C1              AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C2              AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C3              AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C4              AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
C5              AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI
                **************************************************

C1              LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C2              LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C3              LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C4              LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
C5              LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV
                **************************************************

C1              LHTVSQNPPPTSLARQKRPLRFG
C2              LHTVSQNPPPTSLARQKRPLRFG
C3              LHTVSQNPPPTSLARQKRPLRFG
C4              LHTVSQNPPPTSLARoooooooo
C5              LHTVSQNPPPTSLARQKRPLRFG
                ***************        




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:73 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 98.17 C1	 C4	 98.17
TOP	    3    0	 98.17 C4	 C1	 98.17
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 98.17 C2	 C4	 98.17
TOP	    3    1	 98.17 C4	 C2	 98.17
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    2    3	 96.41 C3	 C4	 96.41
TOP	    3    2	 96.41 C4	 C3	 96.41
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    3    4	 98.17 C4	 C5	 98.17
TOP	    4    3	 98.17 C5	 C4	 98.17
AVG	 0	 C1	  *	 99.54
AVG	 1	 C2	  *	 99.54
AVG	 2	 C3	  *	 99.10
AVG	 3	 C4	  *	 97.73
AVG	 4	 C5	  *	 99.54
TOT	 TOT	  *	 99.09
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C2              GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C3              --------------------------------------------------
C4              GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
C5              GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
                                                                  

C1              CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C2              CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C3              --------------------------------------------------
C4              CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
C5              CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
                                                                  

C1              CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C2              CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C3              --------------------------------------------------
C4              CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
C5              CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
                                                                  

C1              TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C2              TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C3              --------------------------------------------------
C4              TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
C5              TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
                                                                  

C1              GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C2              GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C3              --------------------------------------------------
C4              GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
C5              GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
                                                                  

C1              TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C2              TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C3              --------------------------------------------------
C4              TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
C5              TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
                                                                  

C1              CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C2              CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C3              --------------------------------------------------
C4              CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
C5              CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
                                                                  

C1              CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C2              CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C3              --------------------------------------------------
C4              CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
C5              CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
                                                                  

C1              CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C2              CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C3              --------------------------------------------------
C4              CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
C5              CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
                                                                  

C1              CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C2              CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C3              --------------------------------------------------
C4              CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
C5              CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
                                                                  

C1              CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C2              CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C3              --------------------------------------------------
C4              CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
C5              CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
                                                                  

C1              TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C2              TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C3              --------------------------------------------------
C4              TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
C5              TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
                                                                  

C1              CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
C2              CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
C3              ---------------------------------------------CTTTA
C4              CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACCCTTTA
C5              CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
                                                             *****

C1              TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C2              TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C3              TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C4              TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
C5              TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
                **************************************************

C1              AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C2              AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C3              AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C4              AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
C5              AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
                **************************************************

C1              TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C2              TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C3              TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C4              TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
C5              TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
                **************************************************

C1              TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C2              TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C3              TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C4              TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
C5              TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
                **************************************************

C1              TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C2              TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C3              TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C4              TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
C5              TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
                **************************************************

C1              GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C2              GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C3              GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C4              GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
C5              GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
                **************************************************

C1              AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C2              AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C3              AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C4              AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
C5              AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
                **************************************************

C1              AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C2              AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C3              AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C4              AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
C5              AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
                **************************************************

C1              CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C2              CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C3              CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C4              CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
C5              CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
                **************************************************

C1              GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C2              GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C3              GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C4              GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
C5              GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
                **************************************************

C1              TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C2              TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C3              TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C4              TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
C5              TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
                **************************************************

C1              TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C2              TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C3              TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C4              TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
C5              TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
                **************************************************

C1              CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C2              CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C3              CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
C4              CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGA----------
C5              CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
                ****************************************          

C1              CCCTGCGGTTCGGC------------------------------------
C2              CCCTGCGGTTCGGC------------------------------------
C3              CCCTGCGGTTCGGC------------------------------------
C4              --------------------------------------------------
C5              CCCTGCGGTTCGGC------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
                                                                  

C1              ---------
C2              ---------
C3              ---------
C4              ---------
C5              ---------
                         



>C1
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C2
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C3
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------------------------------------------CTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C4
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACCCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGA----------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C5
GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG
CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACGCTAG
CCCACGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG
TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC
GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGCAAGCGGTTTC
TCGACAACATGGCTCAAGGTCGACTCTTCCTCTACGGACCGCGAACGCTG
CGGAAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGA
CCTCGTGGTCGGTGACCTTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAG
CAAGTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCC
CGCCGCCGTTTTCCGCTGCCGGACGTGCTCTACACCCACCTCCTCGGTGT
CAGGTTGGTCAAACTCCTTTACCGGCTGGAACGCCCATTATTCTTCGCCT
TCCAGTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGC
CTGGGCTTCAATCTTTGCCGTATTTTTACCGATGGTGATTACACGCTTTA
TGCCGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATC
AGTATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGG
TGGGATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCAC
TTCCGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACT
TGCCGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAAT
GTTCCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGC
AGCACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGC
AGGCCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGAC
CAACACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCT
GCGAAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGG
TGCTTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTG
TTGGAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCA
CACCGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAGAAGAGGC
CCCTGCGGTTCGGC------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
--------------------------------------------------
---------
>C1
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C2
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C3
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG
>C4
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARoooooooo
>C5
VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLAHVVRPFAVARLLDPSR
YEVHFACDPRYNNLLGPLPFPHHPIHTVPSKRFLDNMAQGRLFLYGPRTL
RKYVEEDSKLLSEIEPDLVVGDLRWSLSVSARLASIPYIAIANAYWSSHA
RRRFPLPDVLYTHLLGVRLVKLLYRLERPLFFAFQCLPLNWVRRKHGLPS
LGFNLCRIFTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRW
WDSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQN
VPANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLD
QHLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEV
LERHVAGLPQHMENVLHTVSQNPPPTSLARQKRPLRFG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 1959 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790732
      Setting output file names to "/data/3res/ML0125/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 363994164
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0606926922
      Seed = 1397246467
      Swapseed = 1579790732
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 13 unique site patterns
      Division 2 has 13 unique site patterns
      Division 3 has 12 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2637.619777 -- -25.624409
         Chain 2 -- -2637.491466 -- -25.624409
         Chain 3 -- -2637.491466 -- -25.624409
         Chain 4 -- -2636.916146 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2636.916146 -- -25.624409
         Chain 2 -- -2637.577652 -- -25.624409
         Chain 3 -- -2637.491467 -- -25.624409
         Chain 4 -- -2637.491466 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2637.620] (-2637.491) (-2637.491) (-2636.916) * [-2636.916] (-2637.578) (-2637.491) (-2637.491) 
        500 -- [-1817.035] (-1812.922) (-1826.018) (-1812.715) * (-1812.958) (-1820.388) [-1825.387] (-1818.573) -- 0:00:00
       1000 -- (-1811.047) [-1807.140] (-1822.021) (-1810.024) * (-1808.200) (-1814.905) [-1809.770] (-1812.950) -- 0:00:00
       1500 -- (-1807.004) [-1810.446] (-1816.416) (-1807.855) * (-1812.344) (-1801.540) [-1811.150] (-1820.764) -- 0:00:00
       2000 -- (-1809.046) [-1807.768] (-1807.264) (-1809.811) * (-1809.219) (-1807.455) [-1805.801] (-1807.567) -- 0:08:19
       2500 -- (-1806.667) [-1813.234] (-1810.229) (-1806.647) * (-1804.706) (-1803.162) [-1810.081] (-1810.386) -- 0:06:39
       3000 -- (-1808.601) (-1814.814) [-1813.430] (-1813.908) * [-1809.203] (-1805.967) (-1811.267) (-1807.414) -- 0:05:32
       3500 -- [-1810.138] (-1812.338) (-1809.691) (-1812.905) * (-1805.052) [-1807.954] (-1812.740) (-1806.091) -- 0:04:44
       4000 -- [-1806.143] (-1808.325) (-1816.290) (-1809.386) * (-1812.978) [-1807.639] (-1817.614) (-1810.197) -- 0:04:09
       4500 -- [-1813.576] (-1816.116) (-1806.413) (-1814.585) * [-1814.494] (-1809.648) (-1808.886) (-1806.439) -- 0:03:41
       5000 -- (-1805.602) (-1805.729) [-1808.890] (-1811.515) * (-1812.067) (-1807.504) (-1808.928) [-1809.293] -- 0:03:19

      Average standard deviation of split frequencies: 0.087297

       5500 -- (-1809.241) [-1809.982] (-1805.260) (-1808.208) * (-1819.823) (-1804.364) (-1814.157) [-1811.761] -- 0:03:00
       6000 -- (-1812.581) (-1814.450) (-1815.232) [-1807.269] * [-1809.078] (-1810.414) (-1809.229) (-1811.841) -- 0:02:45
       6500 -- (-1807.830) (-1809.723) (-1810.650) [-1809.245] * [-1814.685] (-1805.384) (-1804.359) (-1806.666) -- 0:02:32
       7000 -- (-1813.836) (-1810.162) [-1809.345] (-1805.851) * [-1811.998] (-1806.963) (-1806.454) (-1811.733) -- 0:02:21
       7500 -- (-1808.527) (-1810.135) [-1804.368] (-1808.388) * (-1814.941) (-1813.314) (-1813.043) [-1811.702] -- 0:02:12
       8000 -- [-1809.345] (-1814.141) (-1825.470) (-1809.026) * (-1821.670) (-1808.614) [-1806.676] (-1806.329) -- 0:02:04
       8500 -- (-1816.050) [-1809.794] (-1807.596) (-1808.522) * (-1810.132) (-1804.696) [-1807.465] (-1807.674) -- 0:01:56
       9000 -- (-1811.923) [-1808.912] (-1807.491) (-1809.146) * [-1805.641] (-1804.452) (-1808.956) (-1809.529) -- 0:01:50
       9500 -- (-1807.079) (-1810.187) (-1813.373) [-1809.327] * (-1807.505) (-1808.432) (-1811.341) [-1811.437] -- 0:01:44
      10000 -- [-1806.123] (-1813.986) (-1809.810) (-1809.923) * (-1810.856) (-1803.766) (-1808.205) [-1811.243] -- 0:01:39

      Average standard deviation of split frequencies: 0.068746

      10500 -- (-1808.522) (-1810.467) (-1815.961) [-1809.887] * (-1815.754) [-1803.234] (-1807.834) (-1817.570) -- 0:01:34
      11000 -- (-1811.091) (-1806.581) (-1821.738) [-1808.066] * (-1809.157) [-1805.595] (-1807.565) (-1806.937) -- 0:01:29
      11500 -- (-1812.397) (-1810.673) (-1809.880) [-1812.948] * (-1807.696) (-1806.686) [-1811.434] (-1806.432) -- 0:02:51
      12000 -- (-1809.848) [-1806.226] (-1813.871) (-1809.060) * [-1812.521] (-1809.737) (-1812.774) (-1808.724) -- 0:02:44
      12500 -- (-1812.517) (-1820.812) [-1807.553] (-1819.618) * [-1808.894] (-1804.688) (-1804.256) (-1813.016) -- 0:02:38
      13000 -- (-1813.463) (-1809.703) (-1808.360) [-1805.487] * (-1811.203) (-1805.550) [-1807.361] (-1808.941) -- 0:02:31
      13500 -- (-1805.808) (-1818.645) [-1810.683] (-1813.440) * (-1806.025) [-1804.719] (-1809.658) (-1806.152) -- 0:02:26
      14000 -- (-1804.654) (-1811.585) (-1809.955) [-1804.462] * [-1809.944] (-1806.903) (-1806.938) (-1806.345) -- 0:02:20
      14500 -- [-1802.899] (-1814.077) (-1812.182) (-1807.533) * [-1812.729] (-1806.837) (-1807.167) (-1806.922) -- 0:02:15
      15000 -- (-1803.043) (-1808.565) [-1809.912] (-1810.317) * (-1813.132) (-1804.632) [-1808.999] (-1808.398) -- 0:02:11

      Average standard deviation of split frequencies: 0.052378

      15500 -- (-1803.929) (-1806.340) [-1810.237] (-1811.176) * (-1809.845) [-1806.122] (-1807.871) (-1807.929) -- 0:02:07
      16000 -- [-1804.826] (-1812.299) (-1809.458) (-1815.182) * (-1811.715) [-1804.254] (-1806.882) (-1807.462) -- 0:02:03
      16500 -- [-1803.458] (-1813.362) (-1813.724) (-1812.524) * (-1806.714) (-1803.817) (-1807.600) [-1806.890] -- 0:01:59
      17000 -- (-1804.221) (-1804.522) (-1815.634) [-1810.500] * (-1811.754) (-1803.459) [-1803.892] (-1804.848) -- 0:01:55
      17500 -- [-1803.526] (-1804.747) (-1809.218) (-1818.818) * [-1804.886] (-1803.886) (-1812.575) (-1811.148) -- 0:01:52
      18000 -- (-1804.028) (-1806.083) (-1811.760) [-1809.707] * (-1809.396) (-1803.980) [-1802.720] (-1805.318) -- 0:01:49
      18500 -- [-1810.026] (-1806.035) (-1811.889) (-1806.677) * (-1803.270) (-1805.476) (-1805.004) [-1809.715] -- 0:01:46
      19000 -- (-1806.189) [-1804.931] (-1810.604) (-1810.596) * (-1807.749) (-1805.676) (-1805.667) [-1805.587] -- 0:01:43
      19500 -- (-1810.149) [-1801.980] (-1806.628) (-1813.408) * (-1810.640) (-1803.973) [-1804.440] (-1811.742) -- 0:01:40
      20000 -- (-1807.753) (-1802.440) (-1806.610) [-1807.321] * [-1811.469] (-1803.980) (-1810.523) (-1809.820) -- 0:01:38

      Average standard deviation of split frequencies: 0.059306

      20500 -- [-1804.338] (-1804.316) (-1813.806) (-1806.050) * (-1822.939) [-1804.959] (-1806.621) (-1809.544) -- 0:01:35
      21000 -- (-1803.891) (-1803.345) (-1809.567) [-1810.861] * (-1809.667) (-1805.400) (-1805.655) [-1805.690] -- 0:01:33
      21500 -- (-1804.297) [-1803.365] (-1812.916) (-1806.464) * (-1806.060) [-1806.372] (-1813.801) (-1805.315) -- 0:02:16
      22000 -- (-1805.294) (-1804.210) (-1806.316) [-1810.452] * (-1804.219) (-1804.103) (-1809.512) [-1804.476] -- 0:02:13
      22500 -- (-1805.716) [-1804.147] (-1808.508) (-1811.809) * (-1810.865) (-1803.946) [-1804.572] (-1804.542) -- 0:02:10
      23000 -- (-1806.610) (-1804.023) (-1810.839) [-1806.997] * [-1812.370] (-1804.583) (-1809.797) (-1805.075) -- 0:02:07
      23500 -- (-1808.317) (-1809.010) [-1809.033] (-1812.250) * (-1810.740) (-1803.675) (-1811.188) [-1808.776] -- 0:02:04
      24000 -- [-1804.045] (-1806.530) (-1812.393) (-1816.011) * [-1809.037] (-1804.750) (-1806.939) (-1805.432) -- 0:02:02
      24500 -- (-1806.317) [-1805.146] (-1807.373) (-1815.152) * [-1812.603] (-1811.990) (-1810.480) (-1813.518) -- 0:01:59
      25000 -- (-1806.937) [-1803.181] (-1809.786) (-1813.589) * [-1807.887] (-1809.419) (-1807.101) (-1806.160) -- 0:01:57

      Average standard deviation of split frequencies: 0.061645

      25500 -- (-1808.445) (-1802.779) [-1805.035] (-1805.675) * (-1811.827) (-1804.655) (-1810.248) [-1809.979] -- 0:01:54
      26000 -- [-1805.112] (-1806.218) (-1808.608) (-1812.799) * (-1807.074) (-1804.313) [-1813.648] (-1805.911) -- 0:01:52
      26500 -- (-1808.858) [-1805.407] (-1807.201) (-1811.933) * (-1809.436) (-1803.312) [-1811.798] (-1805.629) -- 0:01:50
      27000 -- (-1803.048) (-1805.943) (-1805.978) [-1806.345] * (-1808.399) (-1805.029) [-1810.849] (-1807.495) -- 0:01:48
      27500 -- (-1806.891) [-1803.993] (-1805.637) (-1806.432) * (-1804.651) (-1804.649) [-1807.898] (-1808.295) -- 0:01:46
      28000 -- (-1803.875) (-1804.365) (-1809.238) [-1809.046] * (-1805.008) (-1805.117) (-1810.483) [-1813.000] -- 0:01:44
      28500 -- (-1803.800) [-1803.266] (-1802.045) (-1812.728) * (-1809.911) [-1806.506] (-1806.724) (-1810.518) -- 0:01:42
      29000 -- (-1804.943) [-1803.046] (-1815.219) (-1807.122) * (-1808.502) (-1802.715) (-1805.684) [-1808.584] -- 0:01:40
      29500 -- (-1810.769) (-1802.478) [-1806.782] (-1812.391) * (-1808.071) [-1802.708] (-1814.339) (-1810.504) -- 0:01:38
      30000 -- (-1805.256) [-1804.141] (-1816.450) (-1807.730) * (-1803.819) (-1803.301) (-1804.100) [-1806.237] -- 0:01:37

      Average standard deviation of split frequencies: 0.039967

      30500 -- (-1803.753) (-1803.339) [-1809.274] (-1814.064) * [-1806.331] (-1804.238) (-1807.892) (-1808.189) -- 0:01:35
      31000 -- (-1804.112) (-1803.128) [-1807.173] (-1810.342) * (-1806.920) (-1804.817) [-1806.931] (-1803.953) -- 0:01:33
      31500 -- (-1803.849) (-1803.291) [-1805.506] (-1805.475) * [-1809.698] (-1803.769) (-1808.046) (-1804.435) -- 0:02:02
      32000 -- (-1805.404) (-1802.766) (-1808.621) [-1808.656] * [-1804.519] (-1805.644) (-1805.154) (-1803.646) -- 0:02:01
      32500 -- (-1803.101) [-1806.311] (-1810.401) (-1809.038) * [-1803.751] (-1804.329) (-1811.270) (-1804.361) -- 0:01:59
      33000 -- [-1803.529] (-1805.130) (-1805.135) (-1811.020) * (-1808.605) [-1804.177] (-1808.793) (-1803.213) -- 0:01:57
      33500 -- (-1807.805) [-1803.549] (-1810.083) (-1811.143) * (-1808.282) (-1803.750) (-1817.244) [-1803.232] -- 0:01:55
      34000 -- [-1808.536] (-1807.604) (-1805.503) (-1803.515) * (-1810.059) (-1803.024) (-1805.668) [-1804.080] -- 0:01:53
      34500 -- (-1807.764) [-1804.725] (-1810.937) (-1806.227) * (-1810.336) (-1804.767) [-1804.710] (-1803.839) -- 0:01:51
      35000 -- (-1804.251) (-1804.638) [-1807.503] (-1812.829) * [-1808.607] (-1805.738) (-1808.832) (-1804.725) -- 0:01:50

      Average standard deviation of split frequencies: 0.044522

      35500 -- (-1807.051) (-1804.387) [-1810.276] (-1813.646) * (-1805.142) [-1805.259] (-1814.776) (-1804.318) -- 0:01:48
      36000 -- (-1805.047) [-1804.336] (-1809.857) (-1813.321) * (-1803.277) (-1805.513) (-1828.236) [-1804.646] -- 0:01:47
      36500 -- (-1805.205) [-1803.503] (-1810.930) (-1813.494) * [-1806.026] (-1804.831) (-1807.086) (-1805.948) -- 0:01:45
      37000 -- (-1804.543) (-1803.157) [-1805.241] (-1812.800) * (-1803.840) [-1804.250] (-1805.736) (-1804.912) -- 0:01:44
      37500 -- (-1812.768) [-1806.109] (-1809.551) (-1809.035) * (-1817.830) (-1808.005) [-1806.341] (-1803.099) -- 0:01:42
      38000 -- [-1806.091] (-1806.845) (-1803.682) (-1805.365) * (-1804.928) (-1806.174) [-1807.875] (-1802.949) -- 0:01:41
      38500 -- (-1805.141) (-1807.933) (-1806.937) [-1804.973] * [-1806.525] (-1805.868) (-1807.746) (-1803.569) -- 0:01:39
      39000 -- [-1804.221] (-1809.341) (-1806.719) (-1811.700) * [-1807.216] (-1805.882) (-1812.058) (-1803.244) -- 0:01:38
      39500 -- [-1803.324] (-1810.011) (-1809.937) (-1805.328) * [-1806.998] (-1804.668) (-1814.896) (-1802.849) -- 0:01:37
      40000 -- (-1803.125) (-1806.858) (-1811.737) [-1804.276] * (-1812.743) [-1806.487] (-1807.876) (-1803.436) -- 0:01:36

      Average standard deviation of split frequencies: 0.053323

      40500 -- [-1803.850] (-1807.666) (-1807.271) (-1808.548) * (-1809.995) [-1807.758] (-1807.591) (-1804.606) -- 0:01:34
      41000 -- (-1804.519) [-1805.461] (-1820.619) (-1809.186) * (-1809.650) [-1804.276] (-1812.133) (-1805.072) -- 0:01:33
      41500 -- (-1803.608) (-1807.672) (-1810.706) [-1802.292] * (-1805.933) (-1805.141) (-1814.974) [-1804.092] -- 0:01:32
      42000 -- (-1807.987) (-1806.545) [-1810.737] (-1807.161) * [-1805.106] (-1804.829) (-1805.791) (-1805.522) -- 0:01:54
      42500 -- (-1805.005) (-1804.899) [-1807.011] (-1808.743) * [-1814.084] (-1802.418) (-1815.478) (-1802.741) -- 0:01:52
      43000 -- [-1807.465] (-1810.799) (-1807.014) (-1809.511) * [-1810.198] (-1802.616) (-1818.279) (-1802.678) -- 0:01:51
      43500 -- (-1807.689) (-1808.763) [-1811.910] (-1805.018) * [-1805.603] (-1805.359) (-1804.684) (-1803.615) -- 0:01:49
      44000 -- [-1807.580] (-1803.398) (-1811.387) (-1812.485) * (-1808.901) (-1806.199) [-1808.495] (-1803.624) -- 0:01:48
      44500 -- [-1805.548] (-1806.607) (-1814.173) (-1810.723) * [-1809.652] (-1806.256) (-1808.165) (-1805.053) -- 0:01:47
      45000 -- (-1807.824) (-1804.788) (-1807.047) [-1805.601] * [-1807.297] (-1807.906) (-1810.000) (-1803.421) -- 0:01:46

      Average standard deviation of split frequencies: 0.047140

      45500 -- (-1804.229) (-1803.546) (-1805.391) [-1807.010] * (-1808.746) (-1802.969) [-1809.177] (-1804.163) -- 0:01:44
      46000 -- (-1806.652) (-1804.319) (-1807.912) [-1804.790] * (-1807.594) (-1804.721) [-1815.101] (-1805.917) -- 0:01:43
      46500 -- (-1805.505) (-1805.718) [-1804.560] (-1808.414) * [-1808.826] (-1805.913) (-1808.590) (-1803.803) -- 0:01:42
      47000 -- (-1804.395) (-1808.315) (-1807.111) [-1806.935] * (-1809.762) [-1804.014] (-1809.810) (-1805.783) -- 0:01:41
      47500 -- [-1812.136] (-1804.981) (-1807.043) (-1812.486) * (-1808.027) [-1804.072] (-1810.825) (-1803.863) -- 0:01:40
      48000 -- (-1803.412) [-1805.647] (-1808.470) (-1809.239) * [-1806.622] (-1803.210) (-1805.615) (-1803.949) -- 0:01:39
      48500 -- (-1807.329) [-1804.775] (-1812.435) (-1814.654) * (-1805.261) (-1803.399) (-1811.126) [-1810.334] -- 0:01:38
      49000 -- (-1804.414) [-1804.020] (-1807.814) (-1812.567) * [-1808.429] (-1803.527) (-1811.529) (-1809.259) -- 0:01:37
      49500 -- [-1804.686] (-1803.817) (-1810.223) (-1806.187) * (-1807.607) (-1803.724) (-1809.942) [-1804.580] -- 0:01:36
      50000 -- (-1805.030) (-1803.435) (-1809.306) [-1807.634] * (-1807.431) [-1804.887] (-1804.666) (-1804.920) -- 0:01:35

      Average standard deviation of split frequencies: 0.048381

      50500 -- (-1804.847) [-1803.607] (-1810.237) (-1812.547) * (-1810.000) [-1802.949] (-1805.902) (-1806.693) -- 0:01:34
      51000 -- (-1804.976) (-1805.008) [-1811.249] (-1808.079) * [-1809.141] (-1802.513) (-1808.112) (-1803.023) -- 0:01:33
      51500 -- (-1803.057) (-1805.659) (-1808.623) [-1810.456] * (-1807.594) [-1802.491] (-1806.567) (-1804.381) -- 0:01:32
      52000 -- (-1803.661) (-1803.817) [-1809.358] (-1822.082) * (-1804.600) (-1804.185) [-1805.701] (-1802.852) -- 0:01:31
      52500 -- (-1804.913) [-1802.922] (-1808.505) (-1807.703) * [-1811.733] (-1804.274) (-1812.088) (-1805.662) -- 0:01:48
      53000 -- [-1803.499] (-1803.178) (-1807.902) (-1809.432) * (-1812.713) (-1803.217) (-1810.576) [-1803.461] -- 0:01:47
      53500 -- [-1803.831] (-1802.403) (-1811.768) (-1807.294) * [-1807.405] (-1802.012) (-1805.910) (-1806.891) -- 0:01:46
      54000 -- (-1804.650) (-1804.614) [-1809.397] (-1812.212) * (-1812.448) [-1802.765] (-1808.493) (-1804.156) -- 0:01:45
      54500 -- (-1805.410) (-1804.587) (-1809.179) [-1809.849] * (-1814.623) (-1802.190) [-1803.096] (-1804.049) -- 0:01:44
      55000 -- (-1805.501) (-1809.037) [-1808.900] (-1811.837) * (-1808.409) [-1802.519] (-1804.912) (-1803.764) -- 0:01:43

      Average standard deviation of split frequencies: 0.048824

      55500 -- (-1803.329) [-1803.335] (-1806.920) (-1804.583) * (-1809.211) (-1803.776) [-1812.564] (-1803.864) -- 0:01:42
      56000 -- (-1805.851) (-1803.450) (-1807.591) [-1806.686] * [-1807.325] (-1805.961) (-1808.843) (-1803.107) -- 0:01:41
      56500 -- (-1805.069) [-1802.960] (-1810.890) (-1813.209) * [-1812.111] (-1807.783) (-1807.035) (-1803.353) -- 0:01:40
      57000 -- (-1807.024) [-1803.483] (-1806.099) (-1808.067) * (-1808.380) (-1809.453) [-1805.213] (-1803.422) -- 0:01:39
      57500 -- (-1803.353) (-1805.657) [-1817.320] (-1808.620) * (-1808.668) [-1806.571] (-1806.700) (-1804.275) -- 0:01:38
      58000 -- (-1803.217) (-1802.545) [-1812.596] (-1805.302) * (-1806.566) [-1804.390] (-1808.437) (-1803.894) -- 0:01:37
      58500 -- (-1804.022) [-1804.489] (-1806.922) (-1806.323) * (-1804.483) [-1803.515] (-1806.412) (-1802.992) -- 0:01:36
      59000 -- (-1804.048) (-1803.071) [-1808.240] (-1809.949) * (-1806.189) (-1807.564) (-1807.355) [-1803.068] -- 0:01:35
      59500 -- (-1805.594) (-1804.400) [-1805.455] (-1803.910) * (-1813.173) (-1807.219) [-1804.567] (-1803.426) -- 0:01:34
      60000 -- (-1808.039) [-1804.014] (-1805.461) (-1806.861) * [-1804.908] (-1805.042) (-1804.512) (-1803.611) -- 0:01:34

      Average standard deviation of split frequencies: 0.041960

      60500 -- [-1808.334] (-1806.408) (-1805.419) (-1803.231) * [-1807.592] (-1806.711) (-1810.870) (-1804.325) -- 0:01:33
      61000 -- [-1806.274] (-1803.344) (-1808.075) (-1804.259) * [-1805.500] (-1810.987) (-1808.720) (-1802.865) -- 0:01:32
      61500 -- (-1805.332) (-1806.803) [-1806.147] (-1803.254) * (-1804.992) (-1805.054) (-1811.043) [-1803.737] -- 0:01:31
      62000 -- (-1806.506) (-1806.841) [-1805.882] (-1804.627) * [-1806.899] (-1804.468) (-1807.541) (-1803.057) -- 0:01:30
      62500 -- (-1804.986) (-1804.005) (-1808.318) [-1803.090] * [-1808.215] (-1803.436) (-1811.096) (-1803.694) -- 0:01:30
      63000 -- (-1805.059) [-1802.642] (-1809.675) (-1804.321) * [-1808.830] (-1803.751) (-1813.359) (-1805.482) -- 0:01:29
      63500 -- (-1804.884) [-1805.189] (-1806.072) (-1803.613) * (-1808.514) [-1806.405] (-1805.508) (-1803.400) -- 0:01:43
      64000 -- (-1804.581) [-1803.281] (-1808.569) (-1803.632) * (-1811.116) (-1808.058) [-1802.211] (-1803.400) -- 0:01:42
      64500 -- [-1804.148] (-1805.121) (-1809.933) (-1805.930) * (-1813.084) [-1803.965] (-1812.591) (-1804.291) -- 0:01:41
      65000 -- (-1803.962) [-1805.940] (-1813.533) (-1807.956) * (-1808.901) (-1804.871) [-1812.062] (-1806.657) -- 0:01:40

      Average standard deviation of split frequencies: 0.039998

      65500 -- (-1803.798) (-1807.996) (-1806.467) [-1802.746] * [-1812.659] (-1804.316) (-1807.080) (-1804.380) -- 0:01:39
      66000 -- [-1807.086] (-1805.157) (-1805.932) (-1803.044) * (-1806.294) [-1808.314] (-1806.806) (-1803.784) -- 0:01:39
      66500 -- [-1803.218] (-1805.981) (-1805.462) (-1805.627) * [-1803.582] (-1805.763) (-1807.768) (-1803.321) -- 0:01:38
      67000 -- (-1806.682) (-1803.413) [-1805.292] (-1810.156) * (-1817.742) (-1805.857) (-1807.433) [-1804.023] -- 0:01:37
      67500 -- (-1804.072) (-1803.457) [-1804.759] (-1808.194) * (-1810.541) (-1807.469) [-1807.204] (-1804.356) -- 0:01:36
      68000 -- (-1803.682) [-1805.730] (-1806.450) (-1804.445) * (-1817.771) (-1804.589) [-1812.738] (-1803.148) -- 0:01:35
      68500 -- (-1805.507) [-1803.322] (-1808.664) (-1803.803) * (-1804.603) (-1807.059) [-1810.921] (-1803.543) -- 0:01:35
      69000 -- (-1804.803) (-1802.701) [-1804.762] (-1805.487) * [-1805.844] (-1806.047) (-1812.811) (-1803.667) -- 0:01:34
      69500 -- (-1806.809) (-1806.122) [-1806.181] (-1805.990) * (-1808.207) (-1805.443) [-1802.663] (-1804.598) -- 0:01:33
      70000 -- [-1803.973] (-1802.385) (-1805.687) (-1803.367) * [-1807.844] (-1805.148) (-1806.157) (-1803.042) -- 0:01:33

      Average standard deviation of split frequencies: 0.046696

      70500 -- (-1804.831) (-1803.119) [-1802.253] (-1802.634) * (-1811.356) [-1804.327] (-1811.246) (-1805.872) -- 0:01:32
      71000 -- (-1805.412) (-1803.317) (-1802.795) [-1802.125] * (-1810.881) (-1803.387) [-1807.440] (-1806.304) -- 0:01:31
      71500 -- [-1811.790] (-1803.385) (-1803.058) (-1802.793) * (-1811.333) [-1803.084] (-1812.235) (-1804.324) -- 0:01:30
      72000 -- [-1803.154] (-1803.288) (-1803.713) (-1803.999) * (-1811.350) [-1802.586] (-1812.554) (-1806.974) -- 0:01:30
      72500 -- (-1803.056) [-1805.073] (-1805.485) (-1804.838) * (-1813.025) (-1802.080) (-1816.242) [-1804.049] -- 0:01:29
      73000 -- [-1802.779] (-1804.548) (-1804.593) (-1804.667) * (-1814.282) (-1803.962) [-1808.589] (-1804.487) -- 0:01:28
      73500 -- [-1805.953] (-1804.977) (-1803.816) (-1803.567) * (-1811.504) (-1804.349) (-1818.908) [-1804.587] -- 0:01:28
      74000 -- (-1805.755) (-1805.945) (-1804.393) [-1807.561] * [-1804.435] (-1802.563) (-1813.476) (-1803.836) -- 0:01:40
      74500 -- [-1807.369] (-1805.613) (-1809.033) (-1806.532) * (-1808.325) [-1802.638] (-1803.785) (-1803.754) -- 0:01:39
      75000 -- [-1811.784] (-1803.458) (-1807.003) (-1804.728) * (-1807.104) (-1806.515) [-1802.783] (-1805.578) -- 0:01:38

      Average standard deviation of split frequencies: 0.047140

      75500 -- (-1810.772) [-1805.378] (-1808.162) (-1805.682) * (-1806.846) (-1804.952) [-1805.558] (-1804.062) -- 0:01:37
      76000 -- (-1810.453) (-1803.877) [-1809.405] (-1804.195) * [-1810.666] (-1805.530) (-1807.537) (-1807.419) -- 0:01:37
      76500 -- (-1803.303) (-1803.711) [-1803.520] (-1803.013) * [-1808.618] (-1807.561) (-1805.356) (-1808.459) -- 0:01:36
      77000 -- (-1803.996) (-1803.642) [-1802.820] (-1803.846) * (-1806.247) (-1808.830) (-1803.374) [-1804.706] -- 0:01:35
      77500 -- [-1805.114] (-1803.487) (-1803.817) (-1807.819) * [-1806.850] (-1807.567) (-1805.375) (-1807.300) -- 0:01:35
      78000 -- [-1803.165] (-1802.927) (-1802.978) (-1807.752) * [-1810.241] (-1805.287) (-1803.713) (-1805.469) -- 0:01:34
      78500 -- [-1803.010] (-1803.111) (-1804.449) (-1807.814) * (-1811.483) (-1805.720) [-1806.997] (-1804.202) -- 0:01:33
      79000 -- (-1802.630) (-1804.319) (-1804.868) [-1808.633] * [-1806.760] (-1805.883) (-1804.550) (-1809.835) -- 0:01:33
      79500 -- (-1811.226) (-1804.334) [-1803.199] (-1805.036) * [-1804.816] (-1805.161) (-1804.954) (-1803.856) -- 0:01:32
      80000 -- (-1812.408) (-1804.841) (-1810.441) [-1807.850] * [-1808.522] (-1805.162) (-1807.486) (-1804.555) -- 0:01:32

      Average standard deviation of split frequencies: 0.040907

      80500 -- [-1803.553] (-1803.916) (-1807.129) (-1803.347) * (-1804.201) (-1807.202) (-1805.832) [-1802.679] -- 0:01:31
      81000 -- (-1805.189) [-1802.751] (-1804.077) (-1803.041) * (-1808.286) (-1805.655) (-1804.069) [-1802.666] -- 0:01:30
      81500 -- [-1807.432] (-1806.256) (-1803.155) (-1804.633) * [-1805.682] (-1806.014) (-1804.166) (-1802.393) -- 0:01:30
      82000 -- (-1806.131) (-1804.376) [-1804.999] (-1803.239) * (-1806.479) (-1805.568) [-1805.092] (-1802.710) -- 0:01:29
      82500 -- (-1809.651) (-1805.094) (-1808.860) [-1806.731] * (-1807.208) (-1804.545) (-1802.387) [-1803.911] -- 0:01:28
      83000 -- (-1808.499) (-1804.473) (-1806.036) [-1807.255] * (-1805.760) (-1804.666) [-1803.516] (-1803.620) -- 0:01:28
      83500 -- [-1804.682] (-1806.899) (-1804.791) (-1804.514) * (-1805.190) (-1807.139) [-1805.963] (-1803.036) -- 0:01:27
      84000 -- (-1805.916) (-1806.500) (-1806.220) [-1804.241] * (-1803.482) (-1804.953) (-1807.708) [-1802.710] -- 0:01:27
      84500 -- (-1803.103) [-1802.204] (-1805.025) (-1804.820) * (-1803.483) (-1805.414) (-1803.778) [-1803.112] -- 0:01:26
      85000 -- [-1805.169] (-1803.568) (-1804.010) (-1805.273) * [-1802.964] (-1809.497) (-1804.381) (-1803.158) -- 0:01:36

      Average standard deviation of split frequencies: 0.038370

      85500 -- (-1807.455) [-1803.534] (-1804.589) (-1810.300) * (-1803.600) (-1805.872) [-1807.830] (-1803.531) -- 0:01:36
      86000 -- (-1804.426) [-1804.290] (-1805.344) (-1806.879) * [-1803.556] (-1805.632) (-1811.187) (-1805.445) -- 0:01:35
      86500 -- (-1804.046) [-1805.059] (-1803.582) (-1808.014) * (-1803.468) [-1803.925] (-1802.862) (-1804.430) -- 0:01:35
      87000 -- (-1803.846) [-1804.912] (-1804.387) (-1805.230) * (-1803.821) (-1803.944) [-1802.364] (-1804.614) -- 0:01:34
      87500 -- [-1802.958] (-1803.437) (-1808.080) (-1805.044) * (-1804.914) (-1807.467) (-1805.203) [-1805.061] -- 0:01:33
      88000 -- (-1807.632) [-1802.938] (-1804.076) (-1805.524) * (-1805.739) (-1805.620) [-1803.311] (-1805.230) -- 0:01:33
      88500 -- (-1809.741) [-1806.155] (-1804.099) (-1804.713) * (-1805.647) (-1809.867) (-1803.498) [-1804.737] -- 0:01:32
      89000 -- (-1808.459) (-1806.414) [-1804.523] (-1806.363) * (-1804.776) [-1805.387] (-1804.314) (-1805.709) -- 0:01:32
      89500 -- (-1808.147) [-1804.873] (-1806.638) (-1807.205) * (-1804.144) (-1803.752) (-1804.995) [-1811.081] -- 0:01:31
      90000 -- (-1808.215) [-1803.300] (-1803.901) (-1805.026) * (-1804.990) [-1803.965] (-1806.456) (-1804.187) -- 0:01:31

      Average standard deviation of split frequencies: 0.035355

      90500 -- (-1802.944) (-1807.145) [-1804.914] (-1804.679) * (-1802.592) (-1805.235) [-1804.046] (-1803.179) -- 0:01:30
      91000 -- [-1802.747] (-1804.965) (-1806.720) (-1803.681) * [-1805.396] (-1803.932) (-1806.305) (-1802.940) -- 0:01:29
      91500 -- (-1804.067) [-1803.511] (-1808.860) (-1807.234) * (-1807.428) (-1804.454) (-1803.365) [-1803.387] -- 0:01:29
      92000 -- [-1803.109] (-1802.397) (-1806.508) (-1803.898) * [-1805.823] (-1804.350) (-1802.966) (-1804.101) -- 0:01:28
      92500 -- [-1804.482] (-1802.653) (-1806.111) (-1803.464) * (-1805.064) [-1803.770] (-1803.606) (-1807.478) -- 0:01:28
      93000 -- (-1804.387) (-1802.692) (-1805.369) [-1803.607] * (-1806.668) [-1806.260] (-1803.362) (-1804.353) -- 0:01:27
      93500 -- (-1803.795) (-1802.716) [-1805.298] (-1804.610) * (-1804.758) (-1805.297) (-1803.507) [-1805.138] -- 0:01:27
      94000 -- (-1803.239) [-1804.727] (-1803.291) (-1807.333) * (-1804.393) (-1803.773) [-1803.384] (-1805.299) -- 0:01:26
      94500 -- [-1803.377] (-1803.566) (-1805.115) (-1810.634) * (-1805.206) (-1803.488) [-1804.182] (-1807.646) -- 0:01:26
      95000 -- (-1809.006) (-1804.928) [-1804.554] (-1804.133) * (-1804.318) [-1805.758] (-1802.538) (-1805.933) -- 0:01:25

      Average standard deviation of split frequencies: 0.032409

      95500 -- (-1803.280) (-1804.317) [-1804.415] (-1803.409) * (-1804.528) [-1803.387] (-1804.381) (-1805.125) -- 0:01:34
      96000 -- (-1803.893) (-1802.642) [-1805.100] (-1804.259) * (-1804.251) (-1802.804) (-1802.951) [-1805.472] -- 0:01:34
      96500 -- (-1803.313) (-1804.961) [-1805.277] (-1805.010) * (-1804.289) [-1805.712] (-1802.491) (-1805.399) -- 0:01:33
      97000 -- [-1803.676] (-1804.908) (-1804.455) (-1807.563) * (-1803.641) (-1803.487) (-1803.428) [-1805.757] -- 0:01:33
      97500 -- (-1802.443) (-1803.510) [-1803.102] (-1804.747) * (-1803.136) [-1803.550] (-1803.487) (-1805.002) -- 0:01:32
      98000 -- [-1802.714] (-1804.770) (-1810.620) (-1804.459) * (-1803.409) [-1803.237] (-1805.471) (-1803.698) -- 0:01:32
      98500 -- (-1802.673) [-1802.900] (-1809.267) (-1804.509) * (-1803.418) [-1804.816] (-1803.911) (-1803.791) -- 0:01:31
      99000 -- (-1804.390) (-1804.189) [-1803.280] (-1805.018) * [-1805.227] (-1807.441) (-1805.446) (-1804.773) -- 0:01:31
      99500 -- (-1808.460) [-1804.851] (-1806.118) (-1806.733) * (-1803.376) (-1807.264) [-1804.777] (-1807.746) -- 0:01:30
      100000 -- (-1803.420) (-1804.140) [-1804.679] (-1803.911) * (-1804.250) (-1805.529) [-1804.977] (-1805.180) -- 0:01:30

      Average standard deviation of split frequencies: 0.029970

      100500 -- (-1804.060) (-1808.705) (-1803.711) [-1804.291] * [-1806.057] (-1805.336) (-1805.712) (-1803.588) -- 0:01:29
      101000 -- (-1806.989) (-1810.639) (-1809.553) [-1803.613] * (-1802.810) (-1805.757) [-1808.669] (-1802.669) -- 0:01:29
      101500 -- (-1805.468) (-1807.062) [-1806.489] (-1804.997) * (-1802.732) (-1804.366) [-1804.742] (-1802.792) -- 0:01:28
      102000 -- (-1811.206) (-1803.484) (-1805.500) [-1809.694] * (-1803.958) (-1805.041) (-1805.505) [-1804.423] -- 0:01:28
      102500 -- [-1805.324] (-1805.107) (-1804.735) (-1809.528) * (-1806.706) [-1804.247] (-1806.033) (-1802.781) -- 0:01:27
      103000 -- (-1804.213) (-1805.792) (-1808.306) [-1804.300] * [-1804.695] (-1807.172) (-1804.420) (-1806.260) -- 0:01:27
      103500 -- (-1805.423) (-1805.181) (-1807.513) [-1807.328] * (-1806.990) (-1805.295) [-1802.407] (-1804.563) -- 0:01:26
      104000 -- (-1804.874) [-1804.748] (-1803.153) (-1806.170) * (-1806.704) (-1803.899) [-1802.908] (-1805.534) -- 0:01:26
      104500 -- (-1804.195) (-1808.265) (-1802.430) [-1805.454] * [-1805.488] (-1803.779) (-1805.908) (-1804.884) -- 0:01:25
      105000 -- (-1803.972) [-1804.916] (-1803.898) (-1807.329) * [-1804.007] (-1805.237) (-1805.904) (-1804.058) -- 0:01:25

      Average standard deviation of split frequencies: 0.032020

      105500 -- (-1804.306) [-1803.733] (-1806.355) (-1809.970) * (-1810.357) (-1803.996) [-1805.122] (-1808.289) -- 0:01:24
      106000 -- (-1804.566) (-1803.788) [-1804.922] (-1806.922) * [-1804.207] (-1804.468) (-1806.948) (-1805.723) -- 0:01:24
      106500 -- (-1803.945) (-1806.609) (-1804.006) [-1805.269] * (-1807.569) [-1804.147] (-1804.710) (-1802.817) -- 0:01:32
      107000 -- [-1803.911] (-1804.964) (-1804.307) (-1805.606) * [-1803.947] (-1806.386) (-1804.836) (-1804.370) -- 0:01:31
      107500 -- (-1808.320) (-1805.163) [-1804.396] (-1803.672) * [-1806.202] (-1806.130) (-1805.452) (-1804.225) -- 0:01:31
      108000 -- (-1802.406) (-1807.390) [-1804.838] (-1811.121) * [-1803.478] (-1806.620) (-1804.889) (-1804.878) -- 0:01:30
      108500 -- (-1805.589) [-1806.143] (-1802.941) (-1807.881) * (-1806.787) [-1804.224] (-1802.454) (-1806.118) -- 0:01:30
      109000 -- [-1804.907] (-1806.497) (-1806.399) (-1806.126) * (-1805.879) (-1803.411) (-1803.111) [-1804.302] -- 0:01:29
      109500 -- (-1802.122) [-1803.388] (-1804.509) (-1803.478) * (-1808.289) (-1803.577) (-1803.059) [-1803.291] -- 0:01:29
      110000 -- (-1801.976) (-1807.088) (-1804.689) [-1803.633] * (-1812.050) (-1805.783) (-1802.799) [-1804.507] -- 0:01:29

      Average standard deviation of split frequencies: 0.032374

      110500 -- (-1806.045) (-1805.355) (-1805.163) [-1805.059] * [-1805.607] (-1802.958) (-1805.959) (-1803.546) -- 0:01:28
      111000 -- (-1805.203) [-1805.278] (-1805.954) (-1808.071) * (-1803.131) (-1804.718) (-1805.817) [-1805.634] -- 0:01:28
      111500 -- (-1807.736) [-1805.828] (-1803.719) (-1805.341) * [-1805.689] (-1804.784) (-1805.134) (-1804.307) -- 0:01:27
      112000 -- (-1805.509) [-1806.022] (-1806.310) (-1804.568) * (-1805.444) (-1804.356) (-1808.293) [-1802.619] -- 0:01:27
      112500 -- (-1809.203) (-1803.053) (-1805.040) [-1806.423] * (-1805.601) (-1802.954) (-1806.866) [-1804.368] -- 0:01:26
      113000 -- (-1804.945) (-1804.634) [-1804.116] (-1803.868) * (-1808.025) (-1803.529) [-1803.913] (-1802.454) -- 0:01:26
      113500 -- [-1803.052] (-1804.856) (-1806.201) (-1803.286) * (-1803.341) [-1803.570] (-1804.120) (-1803.653) -- 0:01:25
      114000 -- (-1802.866) (-1803.428) (-1805.262) [-1803.956] * (-1806.876) [-1803.515] (-1809.072) (-1803.895) -- 0:01:25
      114500 -- [-1803.554] (-1806.426) (-1803.257) (-1803.097) * (-1807.226) (-1803.190) [-1803.299] (-1804.259) -- 0:01:25
      115000 -- (-1804.435) (-1807.816) [-1805.259] (-1804.702) * [-1805.611] (-1807.369) (-1805.074) (-1802.913) -- 0:01:24

      Average standard deviation of split frequencies: 0.030885

      115500 -- (-1805.163) (-1802.962) (-1805.006) [-1806.992] * (-1806.729) [-1803.242] (-1803.228) (-1809.478) -- 0:01:24
      116000 -- (-1804.067) [-1804.872] (-1804.192) (-1803.887) * (-1804.723) (-1806.260) [-1805.546] (-1806.389) -- 0:01:23
      116500 -- [-1802.062] (-1804.490) (-1813.050) (-1805.246) * (-1804.377) (-1805.717) (-1809.020) [-1803.727] -- 0:01:23
      117000 -- [-1803.277] (-1804.907) (-1813.815) (-1802.915) * (-1804.378) (-1804.408) [-1805.262] (-1807.920) -- 0:01:23
      117500 -- (-1804.720) (-1804.385) (-1804.341) [-1804.385] * [-1804.181] (-1805.167) (-1803.802) (-1803.941) -- 0:01:30
      118000 -- (-1805.447) (-1805.927) [-1803.605] (-1803.884) * (-1804.999) [-1803.271] (-1803.758) (-1804.467) -- 0:01:29
      118500 -- [-1806.455] (-1809.497) (-1804.973) (-1805.265) * (-1803.569) (-1808.051) (-1804.444) [-1804.142] -- 0:01:29
      119000 -- (-1805.977) (-1807.593) (-1804.141) [-1804.830] * (-1804.008) [-1805.417] (-1802.196) (-1803.938) -- 0:01:28
      119500 -- (-1805.213) (-1803.469) [-1806.054] (-1804.088) * [-1803.595] (-1804.085) (-1808.958) (-1804.136) -- 0:01:28
      120000 -- (-1806.717) (-1810.272) (-1803.873) [-1803.428] * (-1802.442) (-1804.525) [-1805.783] (-1804.650) -- 0:01:28

      Average standard deviation of split frequencies: 0.027347

      120500 -- (-1805.715) [-1802.887] (-1804.593) (-1805.870) * (-1803.202) [-1806.542] (-1804.575) (-1803.471) -- 0:01:27
      121000 -- (-1806.899) (-1803.059) [-1803.162] (-1803.681) * (-1802.580) (-1804.968) (-1806.585) [-1803.301] -- 0:01:27
      121500 -- (-1805.397) (-1805.068) (-1803.784) [-1804.427] * (-1804.825) (-1805.822) [-1803.448] (-1804.493) -- 0:01:26
      122000 -- (-1804.104) [-1804.674] (-1805.438) (-1810.119) * (-1804.947) [-1803.040] (-1804.588) (-1804.945) -- 0:01:26
      122500 -- (-1807.051) (-1806.186) (-1809.387) [-1806.458] * [-1805.927] (-1807.425) (-1804.126) (-1804.731) -- 0:01:25
      123000 -- (-1807.171) (-1805.557) [-1803.801] (-1802.984) * (-1802.613) [-1804.267] (-1804.952) (-1805.370) -- 0:01:25
      123500 -- [-1803.978] (-1805.470) (-1805.012) (-1805.175) * (-1802.613) [-1804.008] (-1803.127) (-1805.041) -- 0:01:25
      124000 -- (-1804.181) (-1803.799) (-1808.060) [-1805.626] * [-1803.805] (-1804.309) (-1805.562) (-1806.576) -- 0:01:24
      124500 -- (-1805.133) [-1803.798] (-1808.324) (-1806.537) * (-1804.919) (-1805.697) [-1805.857] (-1805.848) -- 0:01:24
      125000 -- (-1806.279) [-1804.175] (-1805.213) (-1803.550) * (-1803.790) (-1809.664) (-1804.203) [-1804.886] -- 0:01:24

      Average standard deviation of split frequencies: 0.026189

      125500 -- (-1802.755) (-1807.117) [-1803.619] (-1804.235) * (-1809.285) (-1805.897) [-1803.182] (-1803.056) -- 0:01:23
      126000 -- (-1803.681) [-1804.229] (-1802.823) (-1804.451) * [-1807.049] (-1805.714) (-1803.616) (-1804.703) -- 0:01:23
      126500 -- (-1807.156) (-1803.455) (-1804.053) [-1803.163] * (-1806.550) (-1803.910) (-1805.526) [-1805.108] -- 0:01:22
      127000 -- (-1803.097) (-1805.888) (-1807.327) [-1803.208] * (-1803.243) [-1803.440] (-1808.701) (-1805.259) -- 0:01:22
      127500 -- [-1803.086] (-1804.565) (-1806.177) (-1802.756) * [-1803.574] (-1802.339) (-1803.840) (-1804.353) -- 0:01:22
      128000 -- (-1802.801) [-1803.569] (-1805.474) (-1811.598) * (-1803.574) (-1803.998) (-1803.667) [-1803.956] -- 0:01:28
      128500 -- (-1802.340) (-1808.272) [-1804.254] (-1804.934) * (-1803.630) (-1803.606) [-1806.127] (-1804.003) -- 0:01:28
      129000 -- (-1802.709) (-1805.853) [-1803.381] (-1808.138) * (-1804.896) (-1809.416) [-1803.347] (-1803.131) -- 0:01:27
      129500 -- (-1803.840) (-1805.236) (-1804.473) [-1810.983] * (-1807.295) (-1804.859) (-1803.669) [-1801.934] -- 0:01:27
      130000 -- (-1805.294) (-1804.221) [-1803.507] (-1813.597) * (-1804.518) [-1802.688] (-1803.427) (-1802.219) -- 0:01:27

      Average standard deviation of split frequencies: 0.025254

      130500 -- (-1802.777) (-1805.178) [-1803.608] (-1805.813) * (-1805.307) (-1805.961) [-1803.546] (-1804.859) -- 0:01:26
      131000 -- [-1802.311] (-1803.303) (-1803.926) (-1805.387) * (-1803.217) (-1808.566) [-1803.369] (-1804.561) -- 0:01:26
      131500 -- (-1803.510) (-1803.323) [-1803.161] (-1810.356) * (-1803.605) [-1806.805] (-1803.928) (-1806.373) -- 0:01:25
      132000 -- (-1803.882) [-1804.151] (-1803.743) (-1803.352) * (-1804.945) (-1804.269) (-1804.752) [-1802.408] -- 0:01:25
      132500 -- (-1804.198) (-1804.146) [-1802.619] (-1804.884) * (-1802.891) (-1808.042) (-1804.755) [-1805.306] -- 0:01:25
      133000 -- [-1805.143] (-1804.841) (-1803.215) (-1803.942) * (-1803.097) [-1807.959] (-1804.669) (-1804.550) -- 0:01:24
      133500 -- [-1803.688] (-1803.497) (-1803.478) (-1805.402) * (-1804.248) [-1803.466] (-1805.286) (-1806.483) -- 0:01:24
      134000 -- (-1803.764) [-1803.989] (-1803.041) (-1805.222) * (-1802.429) (-1804.024) [-1805.500] (-1804.285) -- 0:01:24
      134500 -- (-1804.858) [-1804.846] (-1808.266) (-1811.529) * (-1803.422) [-1806.588] (-1807.300) (-1803.889) -- 0:01:23
      135000 -- [-1804.222] (-1804.131) (-1807.397) (-1806.019) * [-1802.339] (-1804.162) (-1804.878) (-1803.916) -- 0:01:23

      Average standard deviation of split frequencies: 0.024957

      135500 -- (-1805.562) (-1805.059) [-1805.454] (-1803.506) * (-1804.596) [-1805.580] (-1805.326) (-1804.566) -- 0:01:22
      136000 -- [-1803.392] (-1803.956) (-1802.763) (-1804.423) * [-1805.657] (-1804.016) (-1809.453) (-1807.973) -- 0:01:22
      136500 -- (-1803.572) (-1805.210) [-1802.770] (-1805.183) * (-1803.693) [-1804.652] (-1808.527) (-1804.627) -- 0:01:22
      137000 -- (-1804.303) (-1806.377) [-1804.039] (-1804.680) * [-1803.761] (-1803.835) (-1806.288) (-1804.765) -- 0:01:21
      137500 -- (-1804.048) [-1808.320] (-1805.962) (-1806.910) * (-1806.103) [-1803.852] (-1809.553) (-1806.151) -- 0:01:21
      138000 -- (-1803.579) (-1808.387) (-1803.564) [-1804.619] * (-1802.608) [-1803.892] (-1807.777) (-1804.002) -- 0:01:21
      138500 -- [-1803.652] (-1804.862) (-1807.551) (-1803.292) * [-1803.851] (-1805.123) (-1809.360) (-1810.809) -- 0:01:20
      139000 -- (-1804.554) (-1808.934) [-1806.969] (-1801.731) * (-1802.516) (-1804.692) [-1805.878] (-1803.584) -- 0:01:26
      139500 -- (-1804.752) (-1804.896) (-1804.646) [-1802.341] * [-1804.065] (-1804.741) (-1803.848) (-1808.673) -- 0:01:26
      140000 -- [-1804.936] (-1804.129) (-1803.123) (-1804.020) * (-1806.058) (-1806.984) (-1803.817) [-1803.967] -- 0:01:26

      Average standard deviation of split frequencies: 0.022788

      140500 -- (-1806.930) [-1805.090] (-1806.196) (-1802.720) * [-1804.400] (-1810.938) (-1803.631) (-1802.608) -- 0:01:25
      141000 -- (-1804.086) (-1804.821) [-1804.877] (-1804.703) * (-1803.742) (-1809.441) [-1804.934] (-1802.681) -- 0:01:25
      141500 -- (-1803.397) (-1805.580) [-1804.607] (-1808.476) * [-1803.727] (-1810.936) (-1807.003) (-1802.409) -- 0:01:24
      142000 -- (-1805.980) [-1802.834] (-1806.093) (-1803.100) * (-1806.157) (-1803.304) (-1806.534) [-1804.992] -- 0:01:24
      142500 -- (-1803.287) (-1805.390) [-1806.094] (-1805.137) * (-1809.866) [-1804.199] (-1804.464) (-1805.536) -- 0:01:24
      143000 -- (-1803.171) (-1806.152) (-1806.909) [-1803.852] * (-1806.951) (-1805.667) [-1804.461] (-1806.928) -- 0:01:23
      143500 -- (-1804.141) [-1803.883] (-1811.009) (-1805.852) * (-1806.013) [-1804.409] (-1804.649) (-1805.680) -- 0:01:23
      144000 -- [-1804.063] (-1805.367) (-1805.319) (-1804.575) * (-1809.740) (-1805.230) (-1804.406) [-1803.861] -- 0:01:23
      144500 -- (-1803.405) (-1806.564) [-1806.518] (-1804.453) * [-1804.516] (-1804.504) (-1804.174) (-1808.008) -- 0:01:22
      145000 -- (-1805.795) [-1806.564] (-1806.795) (-1804.216) * (-1805.250) [-1804.766] (-1805.427) (-1811.698) -- 0:01:22

      Average standard deviation of split frequencies: 0.021310

      145500 -- (-1806.405) (-1810.689) (-1803.290) [-1804.293] * (-1804.358) [-1805.194] (-1804.328) (-1807.907) -- 0:01:22
      146000 -- (-1806.149) [-1804.412] (-1803.478) (-1803.663) * (-1804.016) (-1805.511) (-1804.589) [-1804.914] -- 0:01:21
      146500 -- (-1805.294) (-1808.289) [-1806.386] (-1803.918) * (-1805.330) (-1804.851) [-1804.404] (-1805.370) -- 0:01:21
      147000 -- [-1802.312] (-1806.308) (-1804.675) (-1803.285) * (-1802.867) (-1806.089) [-1802.440] (-1805.222) -- 0:01:21
      147500 -- [-1805.222] (-1804.750) (-1805.453) (-1805.771) * (-1804.252) (-1806.738) (-1805.012) [-1805.446] -- 0:01:20
      148000 -- [-1802.897] (-1804.636) (-1805.605) (-1807.603) * (-1804.098) (-1805.396) [-1805.490] (-1804.083) -- 0:01:20
      148500 -- [-1805.636] (-1805.482) (-1803.723) (-1806.996) * (-1807.154) (-1805.924) [-1803.717] (-1804.665) -- 0:01:20
      149000 -- (-1802.956) (-1804.196) [-1805.839] (-1807.140) * [-1804.931] (-1803.734) (-1805.996) (-1803.197) -- 0:01:19
      149500 -- (-1803.371) (-1803.203) [-1805.525] (-1803.726) * (-1804.578) [-1805.098] (-1812.722) (-1805.273) -- 0:01:25
      150000 -- (-1804.005) (-1803.603) [-1803.248] (-1804.932) * (-1804.783) [-1802.871] (-1804.723) (-1806.924) -- 0:01:25

      Average standard deviation of split frequencies: 0.018147

      150500 -- (-1808.063) (-1803.122) (-1803.560) [-1802.789] * [-1804.742] (-1804.001) (-1807.348) (-1804.477) -- 0:01:24
      151000 -- [-1804.377] (-1803.565) (-1803.615) (-1803.002) * [-1804.494] (-1803.468) (-1804.722) (-1806.136) -- 0:01:24
      151500 -- (-1803.726) (-1804.868) [-1803.494] (-1805.409) * (-1804.346) [-1803.400] (-1805.637) (-1806.683) -- 0:01:24
      152000 -- [-1804.078] (-1804.856) (-1804.771) (-1804.677) * (-1805.697) (-1804.547) [-1803.921] (-1806.419) -- 0:01:23
      152500 -- (-1802.977) (-1805.316) [-1804.771] (-1804.312) * (-1802.758) [-1802.036] (-1804.566) (-1806.328) -- 0:01:23
      153000 -- (-1802.984) (-1804.758) [-1805.108] (-1804.366) * (-1802.824) [-1804.813] (-1809.639) (-1803.605) -- 0:01:23
      153500 -- (-1803.400) (-1804.478) (-1805.441) [-1803.257] * (-1805.142) (-1804.852) [-1806.598] (-1804.615) -- 0:01:22
      154000 -- (-1803.524) (-1806.415) (-1808.293) [-1804.080] * (-1803.421) (-1803.573) (-1803.637) [-1805.493] -- 0:01:22
      154500 -- [-1803.766] (-1806.163) (-1808.022) (-1809.302) * (-1804.284) (-1804.056) (-1805.244) [-1803.836] -- 0:01:22
      155000 -- (-1804.123) (-1807.747) [-1803.560] (-1804.750) * (-1804.937) (-1805.381) (-1805.984) [-1804.236] -- 0:01:21

      Average standard deviation of split frequencies: 0.016922

      155500 -- [-1803.702] (-1804.141) (-1805.018) (-1804.235) * (-1805.801) (-1804.941) (-1803.469) [-1806.237] -- 0:01:21
      156000 -- (-1804.539) [-1804.682] (-1807.424) (-1805.269) * (-1809.273) (-1806.288) (-1805.549) [-1805.931] -- 0:01:21
      156500 -- [-1803.336] (-1803.670) (-1807.613) (-1805.856) * (-1806.338) (-1804.216) [-1804.449] (-1804.375) -- 0:01:20
      157000 -- [-1804.233] (-1805.937) (-1805.783) (-1804.838) * (-1803.931) (-1805.833) (-1804.469) [-1803.080] -- 0:01:20
      157500 -- [-1804.990] (-1803.042) (-1804.321) (-1804.755) * (-1806.503) [-1804.349] (-1809.512) (-1804.294) -- 0:01:20
      158000 -- (-1806.642) (-1803.337) [-1804.446] (-1807.419) * (-1804.883) [-1804.907] (-1804.907) (-1804.766) -- 0:01:19
      158500 -- (-1809.520) [-1803.337] (-1812.512) (-1804.373) * [-1803.346] (-1805.203) (-1804.235) (-1803.642) -- 0:01:19
      159000 -- (-1806.965) (-1803.851) (-1803.800) [-1807.513] * (-1803.109) (-1807.707) [-1802.700] (-1802.653) -- 0:01:19
      159500 -- [-1802.632] (-1804.628) (-1803.611) (-1803.114) * [-1803.163] (-1804.290) (-1802.726) (-1803.342) -- 0:01:19
      160000 -- [-1801.514] (-1805.557) (-1804.146) (-1802.429) * (-1803.502) (-1806.547) (-1805.163) [-1803.646] -- 0:01:24

      Average standard deviation of split frequencies: 0.018191

      160500 -- (-1802.204) (-1803.427) [-1807.098] (-1802.508) * (-1803.214) (-1804.662) [-1805.915] (-1810.684) -- 0:01:23
      161000 -- [-1802.724] (-1804.215) (-1807.255) (-1802.898) * (-1803.259) (-1808.021) [-1804.889] (-1811.654) -- 0:01:23
      161500 -- [-1802.445] (-1804.333) (-1805.536) (-1803.173) * (-1802.787) [-1805.129] (-1803.059) (-1805.122) -- 0:01:23
      162000 -- (-1802.591) (-1803.504) [-1804.531] (-1807.555) * (-1803.297) [-1804.267] (-1804.822) (-1803.507) -- 0:01:22
      162500 -- (-1802.475) (-1809.015) [-1805.351] (-1806.339) * (-1802.645) (-1803.994) [-1804.898] (-1804.171) -- 0:01:22
      163000 -- (-1802.307) (-1808.281) [-1803.568] (-1804.861) * (-1805.475) (-1804.303) (-1803.515) [-1803.762] -- 0:01:22
      163500 -- (-1803.643) (-1803.713) (-1803.925) [-1807.119] * (-1808.668) (-1802.799) (-1806.585) [-1809.232] -- 0:01:21
      164000 -- (-1803.898) (-1804.732) (-1803.452) [-1808.906] * (-1803.872) [-1803.991] (-1807.223) (-1807.647) -- 0:01:21
      164500 -- (-1802.965) (-1806.506) [-1803.052] (-1803.355) * (-1805.797) [-1804.096] (-1804.233) (-1807.831) -- 0:01:21
      165000 -- [-1804.760] (-1808.784) (-1802.615) (-1804.806) * (-1804.077) (-1804.695) [-1802.619] (-1808.906) -- 0:01:20

      Average standard deviation of split frequencies: 0.016471

      165500 -- (-1803.673) (-1804.517) [-1805.898] (-1807.620) * [-1802.620] (-1803.766) (-1802.631) (-1804.681) -- 0:01:20
      166000 -- [-1803.991] (-1804.868) (-1804.024) (-1806.303) * (-1804.592) (-1804.160) [-1802.622] (-1804.932) -- 0:01:20
      166500 -- (-1802.840) [-1803.951] (-1803.814) (-1806.310) * (-1804.284) (-1804.559) [-1802.448] (-1804.888) -- 0:01:20
      167000 -- [-1805.606] (-1805.136) (-1803.750) (-1807.831) * (-1807.108) (-1805.373) (-1803.172) [-1807.595] -- 0:01:19
      167500 -- (-1805.888) (-1802.870) (-1806.604) [-1806.161] * (-1803.410) (-1804.927) (-1803.183) [-1805.051] -- 0:01:19
      168000 -- (-1806.024) [-1803.809] (-1804.057) (-1804.759) * (-1802.810) (-1806.231) [-1803.198] (-1805.817) -- 0:01:19
      168500 -- (-1806.735) (-1804.600) [-1804.175] (-1808.949) * [-1802.767] (-1808.131) (-1804.541) (-1804.314) -- 0:01:18
      169000 -- [-1802.598] (-1803.273) (-1806.072) (-1804.746) * [-1806.422] (-1811.610) (-1805.305) (-1804.102) -- 0:01:18
      169500 -- [-1803.257] (-1805.338) (-1804.892) (-1803.118) * (-1806.878) [-1804.949] (-1803.668) (-1804.028) -- 0:01:18
      170000 -- (-1803.180) [-1802.594] (-1803.984) (-1803.322) * (-1807.688) [-1807.425] (-1804.498) (-1803.660) -- 0:01:18

      Average standard deviation of split frequencies: 0.018230

      170500 -- [-1803.669] (-1804.057) (-1804.248) (-1804.605) * [-1802.616] (-1807.805) (-1803.654) (-1807.754) -- 0:01:22
      171000 -- (-1805.669) [-1808.960] (-1804.336) (-1812.946) * [-1803.478] (-1807.232) (-1809.343) (-1809.604) -- 0:01:22
      171500 -- (-1804.252) [-1805.512] (-1805.738) (-1809.806) * (-1803.070) [-1802.926] (-1803.188) (-1804.293) -- 0:01:22
      172000 -- (-1804.776) [-1803.576] (-1806.948) (-1806.361) * (-1803.070) (-1803.056) [-1806.622] (-1803.471) -- 0:01:21
      172500 -- (-1803.527) [-1804.382] (-1806.596) (-1805.034) * (-1805.119) (-1804.969) (-1804.733) [-1805.553] -- 0:01:21
      173000 -- (-1804.195) (-1803.752) [-1804.445] (-1803.972) * [-1802.909] (-1802.459) (-1807.618) (-1805.916) -- 0:01:21
      173500 -- [-1809.178] (-1805.207) (-1803.648) (-1803.282) * (-1804.581) (-1802.763) [-1806.076] (-1804.858) -- 0:01:20
      174000 -- (-1803.949) (-1804.507) [-1804.065] (-1803.303) * (-1803.799) [-1802.806] (-1805.961) (-1803.798) -- 0:01:20
      174500 -- (-1804.128) (-1808.844) [-1805.109] (-1804.190) * [-1804.300] (-1804.221) (-1810.297) (-1803.274) -- 0:01:20
      175000 -- [-1805.274] (-1803.146) (-1804.727) (-1804.095) * [-1803.824] (-1803.022) (-1808.527) (-1803.323) -- 0:01:20

      Average standard deviation of split frequencies: 0.015535

      175500 -- (-1804.213) (-1804.640) (-1803.177) [-1803.947] * [-1803.904] (-1805.293) (-1806.019) (-1805.635) -- 0:01:19
      176000 -- (-1808.906) (-1805.137) [-1804.994] (-1804.278) * (-1802.936) (-1804.677) [-1804.005] (-1805.418) -- 0:01:19
      176500 -- (-1807.830) [-1806.258] (-1808.427) (-1803.309) * (-1803.768) [-1804.777] (-1804.976) (-1806.904) -- 0:01:19
      177000 -- (-1807.991) (-1804.625) (-1804.907) [-1803.894] * (-1803.718) [-1807.733] (-1805.304) (-1805.127) -- 0:01:19
      177500 -- (-1806.558) [-1803.260] (-1803.919) (-1804.904) * (-1805.492) (-1807.593) [-1803.663] (-1803.383) -- 0:01:18
      178000 -- (-1804.774) (-1803.212) [-1804.339] (-1806.083) * (-1804.358) (-1807.093) (-1803.065) [-1804.816] -- 0:01:18
      178500 -- (-1805.934) (-1804.176) [-1806.650] (-1805.923) * (-1810.153) (-1805.439) [-1802.874] (-1803.995) -- 0:01:18
      179000 -- (-1803.609) (-1803.023) [-1806.379] (-1805.791) * (-1804.691) (-1804.692) (-1803.882) [-1806.787] -- 0:01:17
      179500 -- (-1804.217) (-1803.896) (-1805.065) [-1805.855] * [-1804.401] (-1807.657) (-1804.127) (-1805.107) -- 0:01:17
      180000 -- (-1805.722) [-1803.719] (-1806.672) (-1804.159) * (-1803.180) [-1807.444] (-1806.050) (-1805.513) -- 0:01:17

      Average standard deviation of split frequencies: 0.018265

      180500 -- (-1804.792) [-1804.800] (-1804.797) (-1804.819) * (-1803.437) (-1805.583) [-1802.974] (-1805.487) -- 0:01:17
      181000 -- (-1805.384) (-1805.934) [-1803.822] (-1803.780) * [-1804.173] (-1804.108) (-1805.977) (-1806.424) -- 0:01:16
      181500 -- [-1805.502] (-1810.810) (-1805.262) (-1803.695) * (-1804.201) (-1803.890) (-1805.660) [-1804.183] -- 0:01:21
      182000 -- (-1804.101) [-1805.038] (-1806.738) (-1804.738) * [-1803.892] (-1804.590) (-1806.628) (-1805.625) -- 0:01:20
      182500 -- (-1803.516) (-1804.407) [-1806.014] (-1808.555) * (-1803.912) (-1804.053) [-1804.815] (-1806.695) -- 0:01:20
      183000 -- (-1808.861) [-1805.896] (-1808.816) (-1804.609) * (-1803.768) [-1804.731] (-1807.912) (-1805.007) -- 0:01:20
      183500 -- (-1809.053) [-1805.829] (-1807.954) (-1804.616) * (-1805.542) [-1806.168] (-1806.108) (-1804.021) -- 0:01:20
      184000 -- (-1810.023) (-1804.921) (-1807.526) [-1804.643] * (-1806.263) (-1806.908) [-1805.701] (-1803.942) -- 0:01:19
      184500 -- (-1809.049) (-1802.413) (-1803.492) [-1805.277] * (-1804.929) [-1803.959] (-1806.345) (-1805.591) -- 0:01:19
      185000 -- (-1806.736) (-1805.010) [-1802.931] (-1804.104) * [-1803.620] (-1807.802) (-1804.598) (-1804.034) -- 0:01:19

      Average standard deviation of split frequencies: 0.017234

      185500 -- (-1807.438) (-1808.667) (-1804.654) [-1804.121] * [-1803.227] (-1804.781) (-1805.505) (-1803.218) -- 0:01:19
      186000 -- (-1806.834) [-1801.729] (-1802.843) (-1804.312) * [-1805.099] (-1803.897) (-1806.845) (-1802.750) -- 0:01:18
      186500 -- (-1803.959) (-1805.071) [-1804.106] (-1803.515) * (-1803.377) [-1803.724] (-1807.747) (-1802.673) -- 0:01:18
      187000 -- (-1808.457) [-1802.504] (-1805.562) (-1804.149) * [-1802.595] (-1805.841) (-1803.812) (-1804.615) -- 0:01:18
      187500 -- [-1804.848] (-1802.240) (-1803.078) (-1808.567) * (-1803.830) [-1803.858] (-1803.276) (-1804.466) -- 0:01:18
      188000 -- (-1806.188) [-1803.129] (-1804.375) (-1803.083) * (-1805.337) (-1804.131) [-1802.786] (-1804.004) -- 0:01:17
      188500 -- (-1802.659) [-1803.366] (-1805.632) (-1806.074) * [-1805.082] (-1802.443) (-1802.469) (-1807.112) -- 0:01:17
      189000 -- (-1802.888) (-1807.134) (-1804.525) [-1802.857] * (-1803.700) [-1802.740] (-1802.436) (-1804.986) -- 0:01:17
      189500 -- [-1804.619] (-1805.261) (-1804.414) (-1803.979) * (-1806.311) (-1805.278) [-1805.237] (-1807.856) -- 0:01:16
      190000 -- (-1804.005) (-1804.413) [-1806.172] (-1803.390) * (-1803.844) [-1806.236] (-1803.451) (-1803.086) -- 0:01:16

      Average standard deviation of split frequencies: 0.016318

      190500 -- [-1804.884] (-1802.622) (-1805.306) (-1803.409) * (-1803.451) [-1806.552] (-1803.480) (-1804.432) -- 0:01:16
      191000 -- (-1805.448) [-1801.753] (-1803.085) (-1804.247) * (-1805.673) (-1808.189) [-1803.643] (-1806.990) -- 0:01:16
      191500 -- (-1803.117) (-1802.189) (-1802.749) [-1804.892] * (-1807.307) (-1803.847) [-1804.124] (-1808.010) -- 0:01:15
      192000 -- (-1805.547) (-1802.880) [-1802.519] (-1804.975) * (-1804.269) (-1805.641) (-1804.512) [-1806.791] -- 0:01:15
      192500 -- (-1803.120) (-1804.968) [-1802.603] (-1803.888) * (-1805.573) [-1802.799] (-1803.698) (-1803.898) -- 0:01:19
      193000 -- (-1803.536) [-1802.531] (-1803.337) (-1803.007) * [-1805.659] (-1803.130) (-1805.247) (-1803.515) -- 0:01:19
      193500 -- (-1804.981) [-1804.055] (-1804.994) (-1804.007) * (-1806.806) [-1802.197] (-1804.795) (-1806.472) -- 0:01:19
      194000 -- (-1806.382) (-1805.388) (-1805.752) [-1803.966] * [-1806.888] (-1802.894) (-1803.153) (-1804.979) -- 0:01:18
      194500 -- (-1810.638) [-1806.874] (-1806.638) (-1802.894) * (-1809.474) (-1804.428) [-1803.381] (-1803.705) -- 0:01:18
      195000 -- (-1805.825) (-1804.098) (-1803.540) [-1804.057] * [-1809.701] (-1802.729) (-1804.599) (-1803.896) -- 0:01:18

      Average standard deviation of split frequencies: 0.018760

      195500 -- [-1806.078] (-1805.986) (-1805.717) (-1803.374) * (-1803.568) (-1803.989) (-1805.386) [-1802.951] -- 0:01:18
      196000 -- [-1805.629] (-1803.873) (-1804.630) (-1805.149) * (-1802.577) (-1803.388) (-1804.050) [-1804.447] -- 0:01:17
      196500 -- (-1804.200) (-1806.640) (-1806.422) [-1805.683] * (-1804.461) [-1805.172] (-1805.459) (-1803.256) -- 0:01:17
      197000 -- (-1804.730) (-1807.337) [-1806.418] (-1803.018) * (-1804.277) [-1804.691] (-1803.295) (-1802.999) -- 0:01:17
      197500 -- (-1804.232) [-1805.435] (-1807.548) (-1803.009) * [-1803.362] (-1806.404) (-1803.494) (-1804.281) -- 0:01:17
      198000 -- (-1804.482) (-1802.918) [-1804.231] (-1802.898) * (-1806.418) (-1809.120) [-1808.286] (-1805.195) -- 0:01:16
      198500 -- [-1806.665] (-1802.642) (-1802.846) (-1802.987) * [-1803.012] (-1803.779) (-1810.871) (-1805.179) -- 0:01:16
      199000 -- [-1804.483] (-1804.795) (-1802.768) (-1804.066) * [-1803.929] (-1808.611) (-1803.840) (-1805.886) -- 0:01:16
      199500 -- [-1804.647] (-1802.362) (-1802.678) (-1806.210) * (-1804.680) (-1804.742) [-1805.949] (-1804.348) -- 0:01:16
      200000 -- (-1803.470) (-1804.414) (-1805.517) [-1805.427] * (-1804.583) (-1803.585) [-1803.549] (-1803.146) -- 0:01:16

      Average standard deviation of split frequencies: 0.018794

      200500 -- [-1803.416] (-1803.438) (-1805.648) (-1806.737) * (-1804.645) [-1802.931] (-1804.084) (-1803.623) -- 0:01:15
      201000 -- [-1803.570] (-1804.271) (-1804.039) (-1808.606) * (-1806.528) (-1803.004) [-1805.229] (-1804.187) -- 0:01:15
      201500 -- (-1802.801) (-1804.740) [-1803.194] (-1803.779) * (-1804.411) [-1804.441] (-1803.650) (-1803.649) -- 0:01:15
      202000 -- (-1803.029) [-1803.513] (-1803.639) (-1803.392) * (-1806.642) (-1803.528) [-1803.716] (-1804.298) -- 0:01:15
      202500 -- (-1805.519) [-1805.898] (-1804.427) (-1804.821) * [-1805.416] (-1804.261) (-1803.036) (-1804.276) -- 0:01:14
      203000 -- (-1804.473) [-1806.377] (-1804.048) (-1805.782) * (-1804.257) (-1806.341) [-1803.033] (-1805.362) -- 0:01:18
      203500 -- (-1805.015) [-1807.868] (-1804.661) (-1811.777) * (-1802.360) (-1805.024) [-1807.116] (-1807.286) -- 0:01:18
      204000 -- [-1803.039] (-1803.440) (-1803.560) (-1812.099) * (-1802.390) (-1805.779) [-1803.731] (-1805.839) -- 0:01:18
      204500 -- (-1803.179) [-1802.899] (-1803.197) (-1804.669) * (-1803.384) (-1804.637) [-1803.858] (-1807.836) -- 0:01:17
      205000 -- (-1803.096) (-1805.441) (-1808.256) [-1807.099] * (-1802.933) [-1804.601] (-1805.383) (-1803.440) -- 0:01:17

      Average standard deviation of split frequencies: 0.018307

      205500 -- (-1803.568) (-1806.371) [-1803.545] (-1803.551) * [-1803.869] (-1808.033) (-1803.218) (-1802.380) -- 0:01:17
      206000 -- [-1809.622] (-1805.773) (-1802.554) (-1806.180) * (-1802.795) [-1804.632] (-1805.591) (-1804.254) -- 0:01:17
      206500 -- (-1802.982) [-1806.635] (-1802.608) (-1807.997) * (-1804.278) [-1803.415] (-1803.757) (-1802.177) -- 0:01:16
      207000 -- (-1803.154) (-1803.531) [-1803.612] (-1803.281) * (-1804.028) (-1806.897) (-1804.300) [-1807.005] -- 0:01:16
      207500 -- [-1805.827] (-1805.458) (-1807.151) (-1804.129) * (-1804.082) [-1803.620] (-1806.237) (-1807.266) -- 0:01:16
      208000 -- (-1806.054) [-1803.771] (-1804.252) (-1808.425) * [-1802.786] (-1802.344) (-1804.603) (-1804.851) -- 0:01:16
      208500 -- [-1805.067] (-1804.851) (-1803.557) (-1807.321) * [-1804.365] (-1802.435) (-1805.095) (-1805.653) -- 0:01:15
      209000 -- (-1807.813) (-1805.019) [-1802.857] (-1807.599) * (-1802.022) [-1804.564] (-1806.414) (-1805.101) -- 0:01:15
      209500 -- (-1805.655) (-1805.951) (-1802.975) [-1813.885] * [-1804.514] (-1805.486) (-1804.973) (-1805.379) -- 0:01:15
      210000 -- (-1805.047) (-1805.386) [-1804.874] (-1805.481) * [-1802.702] (-1804.961) (-1804.732) (-1803.407) -- 0:01:15

      Average standard deviation of split frequencies: 0.017454

      210500 -- [-1804.016] (-1803.859) (-1804.298) (-1811.746) * [-1806.561] (-1806.619) (-1803.433) (-1805.436) -- 0:01:15
      211000 -- (-1804.342) [-1803.368] (-1804.610) (-1809.033) * (-1804.528) (-1807.557) (-1805.450) [-1803.740] -- 0:01:14
      211500 -- [-1808.788] (-1805.798) (-1802.786) (-1805.059) * (-1802.048) (-1807.866) [-1802.689] (-1803.884) -- 0:01:14
      212000 -- (-1807.838) [-1803.089] (-1804.987) (-1806.122) * (-1806.103) [-1807.336] (-1808.206) (-1803.817) -- 0:01:14
      212500 -- (-1807.698) (-1802.869) (-1802.716) [-1802.456] * (-1803.605) [-1807.698] (-1804.123) (-1802.865) -- 0:01:14
      213000 -- (-1804.316) [-1804.694] (-1803.278) (-1801.954) * (-1804.391) (-1804.127) [-1803.138] (-1803.513) -- 0:01:13
      213500 -- (-1803.476) [-1803.076] (-1807.686) (-1806.101) * (-1812.383) (-1805.149) (-1808.554) [-1804.166] -- 0:01:17
      214000 -- (-1803.675) (-1802.607) [-1806.070] (-1805.130) * (-1810.752) (-1804.309) [-1807.286] (-1803.801) -- 0:01:17
      214500 -- (-1803.157) (-1802.833) [-1804.409] (-1803.296) * (-1806.465) [-1804.864] (-1802.938) (-1804.708) -- 0:01:16
      215000 -- (-1802.955) (-1804.449) (-1805.409) [-1803.553] * (-1802.893) (-1806.115) [-1803.957] (-1803.564) -- 0:01:16

      Average standard deviation of split frequencies: 0.015713

      215500 -- (-1807.749) [-1804.655] (-1806.736) (-1804.707) * (-1805.520) (-1806.665) [-1804.108] (-1804.206) -- 0:01:16
      216000 -- (-1806.424) (-1805.656) [-1806.015] (-1803.961) * (-1804.831) (-1809.083) [-1803.843] (-1803.314) -- 0:01:16
      216500 -- (-1802.796) (-1806.379) (-1805.062) [-1803.703] * (-1803.168) [-1807.053] (-1803.815) (-1803.137) -- 0:01:15
      217000 -- [-1803.904] (-1804.797) (-1806.966) (-1805.384) * (-1803.017) [-1808.076] (-1804.162) (-1803.125) -- 0:01:15
      217500 -- (-1805.190) (-1804.458) [-1804.006] (-1804.618) * (-1803.757) [-1803.449] (-1807.241) (-1803.288) -- 0:01:15
      218000 -- (-1802.746) (-1803.225) [-1802.297] (-1806.665) * (-1804.696) (-1806.620) (-1805.653) [-1804.495] -- 0:01:15
      218500 -- [-1803.768] (-1804.232) (-1802.328) (-1804.880) * (-1804.542) (-1802.550) (-1805.462) [-1805.137] -- 0:01:15
      219000 -- (-1804.484) (-1805.874) (-1802.541) [-1803.893] * (-1806.194) [-1802.153] (-1803.090) (-1805.191) -- 0:01:14
      219500 -- (-1805.652) (-1804.797) (-1802.850) [-1804.029] * [-1805.924] (-1802.070) (-1804.219) (-1803.168) -- 0:01:14
      220000 -- (-1805.786) (-1806.202) [-1802.550] (-1805.228) * [-1805.414] (-1802.992) (-1804.500) (-1803.369) -- 0:01:14

      Average standard deviation of split frequencies: 0.013672

      220500 -- (-1804.543) (-1807.434) [-1802.847] (-1805.725) * [-1803.556] (-1803.306) (-1803.562) (-1803.751) -- 0:01:14
      221000 -- (-1806.093) (-1803.518) [-1803.171] (-1804.797) * (-1804.713) (-1804.637) (-1803.900) [-1807.200] -- 0:01:14
      221500 -- (-1803.472) (-1802.334) (-1802.645) [-1808.754] * (-1803.266) (-1804.877) [-1805.504] (-1805.137) -- 0:01:13
      222000 -- [-1803.829] (-1802.679) (-1804.453) (-1805.423) * (-1804.816) (-1804.021) [-1804.861] (-1803.317) -- 0:01:13
      222500 -- (-1809.209) (-1804.114) [-1802.668] (-1804.446) * (-1803.694) (-1805.885) (-1805.596) [-1802.577] -- 0:01:13
      223000 -- [-1806.617] (-1803.071) (-1803.064) (-1802.877) * (-1804.207) (-1806.264) (-1805.140) [-1802.117] -- 0:01:13
      223500 -- (-1805.331) [-1802.719] (-1803.564) (-1802.906) * [-1804.478] (-1805.240) (-1804.426) (-1807.018) -- 0:01:12
      224000 -- (-1804.730) (-1806.372) [-1808.542] (-1804.060) * (-1804.872) (-1809.753) (-1803.800) [-1806.331] -- 0:01:12
      224500 -- [-1805.804] (-1803.282) (-1803.427) (-1809.593) * (-1804.591) [-1805.601] (-1803.880) (-1805.847) -- 0:01:15
      225000 -- [-1805.343] (-1806.898) (-1804.848) (-1803.973) * [-1802.750] (-1805.542) (-1804.745) (-1803.688) -- 0:01:15

      Average standard deviation of split frequencies: 0.015018

      225500 -- (-1807.296) (-1809.312) [-1803.730] (-1805.119) * (-1805.608) [-1804.948] (-1807.303) (-1802.726) -- 0:01:15
      226000 -- (-1803.597) (-1806.363) [-1805.587] (-1804.784) * (-1803.536) (-1805.573) (-1803.147) [-1804.196] -- 0:01:15
      226500 -- [-1805.685] (-1807.263) (-1806.990) (-1806.082) * (-1802.470) (-1805.185) (-1804.804) [-1805.667] -- 0:01:15
      227000 -- (-1804.641) [-1803.803] (-1807.516) (-1806.997) * (-1803.504) [-1809.627] (-1807.978) (-1802.948) -- 0:01:14
      227500 -- (-1805.648) (-1804.461) (-1805.612) [-1805.780] * (-1804.093) (-1807.829) (-1804.444) [-1803.148] -- 0:01:14
      228000 -- (-1803.293) [-1803.222] (-1804.013) (-1807.665) * (-1804.304) [-1803.475] (-1803.878) (-1802.901) -- 0:01:14
      228500 -- [-1802.531] (-1803.247) (-1806.122) (-1804.133) * (-1806.994) [-1804.896] (-1802.794) (-1803.951) -- 0:01:14
      229000 -- (-1806.000) (-1803.714) (-1805.738) [-1804.371] * (-1805.902) (-1805.574) (-1803.585) [-1804.769] -- 0:01:14
      229500 -- (-1804.415) [-1804.226] (-1806.025) (-1805.137) * (-1803.859) (-1804.697) [-1803.347] (-1802.275) -- 0:01:13
      230000 -- (-1804.430) (-1804.788) [-1807.528] (-1804.508) * (-1804.924) (-1802.665) (-1805.065) [-1804.181] -- 0:01:13

      Average standard deviation of split frequencies: 0.017575

      230500 -- [-1806.553] (-1808.724) (-1804.694) (-1804.675) * (-1802.574) [-1803.762] (-1804.446) (-1804.050) -- 0:01:13
      231000 -- [-1803.438] (-1804.986) (-1805.088) (-1804.163) * [-1807.632] (-1809.997) (-1809.092) (-1806.471) -- 0:01:13
      231500 -- [-1803.607] (-1804.357) (-1803.835) (-1806.004) * (-1810.610) [-1804.158] (-1803.756) (-1808.337) -- 0:01:13
      232000 -- (-1803.853) (-1802.501) (-1803.399) [-1802.728] * (-1803.240) (-1805.405) [-1805.501] (-1806.064) -- 0:01:12
      232500 -- (-1803.987) (-1804.267) (-1803.633) [-1803.580] * (-1804.575) [-1806.507] (-1804.864) (-1805.690) -- 0:01:12
      233000 -- (-1804.786) [-1803.662] (-1803.685) (-1804.244) * (-1803.474) (-1805.561) (-1801.768) [-1803.970] -- 0:01:12
      233500 -- (-1805.414) [-1805.437] (-1803.930) (-1805.979) * [-1804.026] (-1804.737) (-1805.502) (-1804.330) -- 0:01:12
      234000 -- [-1805.376] (-1805.085) (-1807.593) (-1804.666) * [-1803.545] (-1803.350) (-1807.508) (-1803.968) -- 0:01:12
      234500 -- (-1805.634) [-1803.732] (-1803.287) (-1804.536) * (-1803.178) (-1806.591) [-1808.370] (-1804.201) -- 0:01:11
      235000 -- [-1804.639] (-1804.355) (-1803.356) (-1803.430) * (-1804.458) (-1806.112) [-1804.291] (-1804.363) -- 0:01:14

      Average standard deviation of split frequencies: 0.017578

      235500 -- (-1807.159) (-1803.355) [-1807.798] (-1803.666) * (-1803.068) (-1805.211) [-1803.802] (-1805.025) -- 0:01:14
      236000 -- (-1804.702) [-1803.236] (-1805.483) (-1803.740) * (-1809.182) (-1803.888) (-1803.392) [-1804.992] -- 0:01:14
      236500 -- (-1804.182) (-1804.181) [-1803.777] (-1803.869) * [-1808.887] (-1803.573) (-1803.869) (-1803.124) -- 0:01:14
      237000 -- (-1807.463) [-1803.033] (-1802.946) (-1804.434) * (-1804.973) [-1804.682] (-1803.579) (-1801.912) -- 0:01:14
      237500 -- [-1806.417] (-1804.975) (-1802.631) (-1803.541) * (-1805.556) (-1803.551) (-1803.617) [-1803.637] -- 0:01:13
      238000 -- (-1805.751) (-1804.628) (-1802.858) [-1805.639] * (-1804.957) (-1804.481) [-1802.821] (-1806.153) -- 0:01:13
      238500 -- (-1807.922) (-1805.206) [-1803.497] (-1805.647) * (-1805.797) (-1804.765) [-1804.495] (-1811.217) -- 0:01:13
      239000 -- (-1807.405) (-1807.640) (-1802.637) [-1806.112] * (-1805.683) (-1803.742) [-1807.016] (-1805.479) -- 0:01:13
      239500 -- (-1803.340) [-1803.936] (-1806.471) (-1806.235) * (-1804.111) [-1805.747] (-1807.056) (-1805.088) -- 0:01:13
      240000 -- [-1803.087] (-1803.936) (-1805.530) (-1808.760) * (-1804.650) (-1803.793) (-1804.361) [-1802.867] -- 0:01:12

      Average standard deviation of split frequencies: 0.017629

      240500 -- [-1803.347] (-1806.418) (-1803.537) (-1806.825) * (-1803.927) (-1804.274) [-1803.031] (-1803.184) -- 0:01:12
      241000 -- (-1804.139) (-1804.549) [-1803.193] (-1805.809) * [-1803.739] (-1803.029) (-1804.628) (-1807.724) -- 0:01:12
      241500 -- (-1806.301) (-1804.053) [-1802.333] (-1805.362) * (-1804.353) (-1808.281) (-1803.775) [-1806.709] -- 0:01:12
      242000 -- (-1803.315) [-1803.431] (-1802.304) (-1804.075) * (-1805.284) [-1807.195] (-1803.577) (-1806.723) -- 0:01:12
      242500 -- (-1806.040) [-1802.832] (-1801.701) (-1804.671) * [-1803.943] (-1809.674) (-1804.708) (-1803.824) -- 0:01:11
      243000 -- (-1804.885) (-1805.816) (-1804.829) [-1804.197] * (-1802.797) (-1806.770) (-1806.959) [-1802.545] -- 0:01:11
      243500 -- (-1809.493) (-1804.992) [-1804.656] (-1803.162) * (-1804.850) (-1808.142) (-1803.655) [-1803.875] -- 0:01:11
      244000 -- (-1807.362) (-1803.939) [-1803.725] (-1803.639) * [-1804.678] (-1808.498) (-1805.355) (-1803.549) -- 0:01:11
      244500 -- [-1808.201] (-1802.490) (-1803.142) (-1804.328) * (-1805.760) [-1804.619] (-1806.342) (-1802.151) -- 0:01:11
      245000 -- (-1805.928) [-1804.131] (-1801.985) (-1803.015) * (-1805.493) (-1806.909) [-1804.074] (-1802.989) -- 0:01:10

      Average standard deviation of split frequencies: 0.016097

      245500 -- (-1803.522) [-1803.726] (-1803.080) (-1803.007) * (-1807.953) (-1806.264) (-1803.216) [-1805.814] -- 0:01:10
      246000 -- (-1804.353) (-1804.521) (-1802.952) [-1807.524] * (-1804.925) (-1807.273) (-1803.917) [-1805.101] -- 0:01:13
      246500 -- (-1804.263) (-1802.857) (-1804.215) [-1804.587] * (-1804.838) (-1806.800) [-1803.554] (-1804.207) -- 0:01:13
      247000 -- [-1803.902] (-1803.364) (-1802.809) (-1806.200) * (-1804.949) (-1809.010) [-1803.785] (-1805.629) -- 0:01:13
      247500 -- (-1806.566) (-1805.437) (-1805.162) [-1805.345] * [-1804.323] (-1808.768) (-1806.020) (-1804.173) -- 0:01:12
      248000 -- (-1808.555) (-1805.436) [-1806.287] (-1802.924) * (-1806.493) [-1803.358] (-1807.509) (-1807.479) -- 0:01:12
      248500 -- [-1807.749] (-1805.940) (-1806.331) (-1804.240) * (-1806.000) (-1803.540) (-1805.808) [-1804.854] -- 0:01:12
      249000 -- (-1804.086) (-1803.400) (-1808.622) [-1805.891] * [-1804.752] (-1803.588) (-1803.267) (-1804.576) -- 0:01:12
      249500 -- (-1804.345) (-1803.340) (-1807.179) [-1803.798] * (-1804.055) [-1804.736] (-1803.526) (-1804.860) -- 0:01:12
      250000 -- (-1804.227) (-1805.132) [-1805.973] (-1805.471) * [-1804.301] (-1804.998) (-1806.067) (-1805.682) -- 0:01:12

      Average standard deviation of split frequencies: 0.015421

      250500 -- (-1804.243) (-1804.214) [-1805.955] (-1805.448) * (-1804.393) (-1808.218) [-1803.362] (-1804.991) -- 0:01:11
      251000 -- (-1804.064) (-1803.883) [-1804.118] (-1806.085) * [-1804.167] (-1805.982) (-1803.583) (-1804.342) -- 0:01:11
      251500 -- (-1803.515) (-1805.457) [-1805.561] (-1806.429) * [-1805.896] (-1803.686) (-1803.967) (-1803.124) -- 0:01:11
      252000 -- (-1804.171) [-1807.392] (-1803.283) (-1805.066) * (-1804.426) (-1803.447) (-1803.902) [-1804.285] -- 0:01:11
      252500 -- [-1805.600] (-1803.965) (-1803.845) (-1804.060) * [-1802.785] (-1803.828) (-1806.114) (-1803.998) -- 0:01:11
      253000 -- [-1803.363] (-1803.470) (-1805.143) (-1803.224) * (-1804.833) [-1803.467] (-1802.664) (-1805.199) -- 0:01:10
      253500 -- [-1802.972] (-1805.866) (-1803.578) (-1803.564) * (-1803.728) [-1803.881] (-1803.097) (-1806.330) -- 0:01:10
      254000 -- (-1805.140) (-1806.506) (-1805.536) [-1805.123] * (-1805.581) [-1803.010] (-1802.646) (-1805.080) -- 0:01:10
      254500 -- (-1806.307) (-1806.253) [-1803.032] (-1806.029) * (-1807.032) [-1804.099] (-1803.212) (-1803.517) -- 0:01:10
      255000 -- (-1805.018) (-1804.019) (-1802.944) [-1807.382] * [-1806.079] (-1803.745) (-1803.853) (-1803.160) -- 0:01:10

      Average standard deviation of split frequencies: 0.015100

      255500 -- (-1806.948) (-1805.768) (-1807.099) [-1807.928] * (-1803.271) (-1812.276) [-1807.681] (-1805.079) -- 0:01:09
      256000 -- (-1805.750) (-1804.843) [-1807.308] (-1806.774) * (-1803.871) [-1805.231] (-1803.978) (-1805.672) -- 0:01:12
      256500 -- [-1804.917] (-1804.103) (-1807.371) (-1805.049) * [-1803.770] (-1805.029) (-1805.902) (-1803.581) -- 0:01:12
      257000 -- [-1803.674] (-1810.219) (-1806.757) (-1804.203) * (-1806.738) (-1807.868) [-1805.204] (-1803.430) -- 0:01:12
      257500 -- (-1805.596) (-1806.277) (-1803.439) [-1803.376] * (-1804.727) (-1812.027) [-1804.467] (-1804.142) -- 0:01:12
      258000 -- [-1804.127] (-1805.317) (-1804.122) (-1803.446) * (-1808.395) (-1807.370) [-1803.904] (-1803.889) -- 0:01:11
      258500 -- [-1803.957] (-1802.477) (-1804.125) (-1803.943) * (-1807.473) [-1803.211] (-1803.354) (-1804.384) -- 0:01:11
      259000 -- [-1804.838] (-1803.187) (-1803.913) (-1806.921) * (-1805.390) (-1802.544) [-1803.926] (-1802.746) -- 0:01:11
      259500 -- [-1804.383] (-1804.264) (-1803.933) (-1802.991) * (-1804.578) [-1802.686] (-1803.372) (-1804.171) -- 0:01:11
      260000 -- (-1805.600) [-1803.043] (-1804.789) (-1802.880) * [-1804.138] (-1802.562) (-1807.072) (-1802.337) -- 0:01:11

      Average standard deviation of split frequencies: 0.014468

      260500 -- [-1807.274] (-1803.185) (-1805.051) (-1803.430) * [-1804.269] (-1802.990) (-1804.313) (-1803.103) -- 0:01:10
      261000 -- (-1806.199) [-1803.870] (-1803.176) (-1803.425) * (-1809.024) (-1803.316) [-1802.664] (-1806.102) -- 0:01:10
      261500 -- (-1803.091) (-1804.451) (-1804.108) [-1807.894] * (-1806.146) [-1803.073] (-1806.581) (-1802.774) -- 0:01:10
      262000 -- [-1803.632] (-1803.070) (-1805.756) (-1805.312) * (-1804.509) (-1806.928) (-1803.254) [-1804.575] -- 0:01:10
      262500 -- [-1802.990] (-1802.696) (-1806.322) (-1804.426) * [-1804.958] (-1804.067) (-1803.985) (-1808.662) -- 0:01:10
      263000 -- (-1804.164) [-1809.410] (-1807.804) (-1805.589) * [-1805.812] (-1803.047) (-1803.731) (-1804.246) -- 0:01:10
      263500 -- (-1807.356) (-1809.226) (-1807.824) [-1805.631] * (-1804.991) (-1804.277) (-1803.096) [-1803.789] -- 0:01:09
      264000 -- [-1804.200] (-1804.741) (-1807.217) (-1803.059) * (-1803.767) (-1806.129) [-1802.930] (-1804.531) -- 0:01:09
      264500 -- (-1805.220) (-1802.803) (-1808.218) [-1804.802] * [-1804.855] (-1804.718) (-1803.329) (-1803.979) -- 0:01:09
      265000 -- [-1805.581] (-1805.093) (-1807.264) (-1803.661) * [-1804.357] (-1803.359) (-1803.555) (-1802.709) -- 0:01:09

      Average standard deviation of split frequencies: 0.013114

      265500 -- (-1804.768) (-1804.672) [-1802.945] (-1803.737) * (-1805.605) (-1804.080) [-1803.769] (-1803.956) -- 0:01:09
      266000 -- (-1807.079) (-1804.563) [-1804.093] (-1805.714) * (-1805.145) (-1804.760) (-1802.915) [-1803.576] -- 0:01:08
      266500 -- (-1806.262) [-1804.365] (-1804.416) (-1805.162) * (-1804.225) [-1804.679] (-1803.737) (-1803.651) -- 0:01:08
      267000 -- (-1805.864) (-1802.967) [-1806.273] (-1804.047) * (-1806.148) (-1805.295) (-1803.326) [-1804.654] -- 0:01:11
      267500 -- [-1805.228] (-1803.784) (-1805.753) (-1803.739) * (-1803.052) (-1804.836) [-1805.879] (-1804.941) -- 0:01:11
      268000 -- (-1803.807) [-1805.644] (-1805.274) (-1803.522) * (-1804.056) [-1804.351] (-1805.507) (-1805.911) -- 0:01:11
      268500 -- (-1804.014) (-1804.265) (-1812.480) [-1803.378] * (-1810.498) [-1804.015] (-1805.574) (-1803.997) -- 0:01:10
      269000 -- [-1805.305] (-1803.791) (-1805.271) (-1802.997) * (-1806.157) (-1805.811) (-1804.393) [-1805.296] -- 0:01:10
      269500 -- (-1804.689) [-1804.546] (-1803.548) (-1802.342) * (-1805.505) (-1805.303) (-1805.029) [-1803.498] -- 0:01:10
      270000 -- (-1810.058) (-1804.207) (-1803.063) [-1804.410] * (-1804.840) (-1803.253) (-1803.907) [-1804.090] -- 0:01:10

      Average standard deviation of split frequencies: 0.012888

      270500 -- [-1806.372] (-1806.909) (-1804.162) (-1802.892) * (-1805.284) (-1807.233) (-1804.861) [-1805.425] -- 0:01:10
      271000 -- (-1805.511) [-1803.847] (-1803.157) (-1805.040) * (-1803.369) [-1808.693] (-1802.966) (-1806.224) -- 0:01:09
      271500 -- [-1805.836] (-1805.485) (-1803.202) (-1804.602) * (-1803.548) [-1806.015] (-1803.722) (-1802.830) -- 0:01:09
      272000 -- (-1806.426) [-1804.365] (-1804.471) (-1802.577) * (-1804.883) [-1803.868] (-1803.438) (-1804.267) -- 0:01:09
      272500 -- (-1804.187) (-1808.670) (-1804.419) [-1803.695] * (-1804.883) (-1802.867) (-1803.813) [-1802.453] -- 0:01:09
      273000 -- (-1802.362) [-1803.769] (-1803.963) (-1804.125) * (-1805.249) (-1803.643) (-1804.092) [-1804.931] -- 0:01:09
      273500 -- [-1803.521] (-1803.769) (-1804.253) (-1803.976) * (-1804.785) [-1802.473] (-1803.598) (-1804.108) -- 0:01:09
      274000 -- (-1804.434) (-1810.240) [-1807.707] (-1806.796) * (-1804.906) [-1805.063] (-1804.601) (-1805.746) -- 0:01:08
      274500 -- (-1804.307) (-1803.961) [-1807.769] (-1804.337) * (-1806.126) [-1803.991] (-1810.021) (-1805.237) -- 0:01:08
      275000 -- (-1805.640) (-1806.431) (-1806.575) [-1807.102] * (-1806.126) [-1805.022] (-1804.216) (-1807.089) -- 0:01:08

      Average standard deviation of split frequencies: 0.013322

      275500 -- (-1804.778) [-1806.024] (-1806.527) (-1804.841) * (-1803.386) (-1806.179) [-1804.112] (-1807.101) -- 0:01:08
      276000 -- (-1804.112) (-1805.935) [-1805.912] (-1804.418) * (-1803.397) (-1804.161) (-1804.079) [-1803.897] -- 0:01:08
      276500 -- [-1807.533] (-1805.812) (-1804.641) (-1803.750) * (-1803.452) (-1803.426) [-1803.480] (-1806.469) -- 0:01:08
      277000 -- (-1806.175) (-1803.912) (-1805.790) [-1802.246] * [-1805.596] (-1804.145) (-1803.550) (-1804.863) -- 0:01:07
      277500 -- (-1803.799) [-1802.838] (-1805.385) (-1805.349) * (-1807.753) (-1808.822) [-1805.855] (-1805.872) -- 0:01:10
      278000 -- (-1802.637) (-1806.053) (-1806.547) [-1804.182] * (-1808.894) [-1806.987] (-1803.194) (-1808.329) -- 0:01:10
      278500 -- (-1804.827) [-1804.456] (-1803.711) (-1804.778) * (-1806.307) (-1804.500) [-1804.069] (-1808.558) -- 0:01:09
      279000 -- (-1804.628) (-1803.084) (-1805.313) [-1803.916] * (-1802.911) [-1805.476] (-1808.033) (-1805.977) -- 0:01:09
      279500 -- (-1804.081) [-1803.469] (-1804.393) (-1805.510) * (-1803.082) (-1803.750) [-1805.382] (-1805.304) -- 0:01:09
      280000 -- (-1809.067) (-1805.817) (-1803.305) [-1805.534] * (-1802.509) (-1803.423) [-1806.141] (-1806.372) -- 0:01:09

      Average standard deviation of split frequencies: 0.011421

      280500 -- [-1805.333] (-1803.581) (-1802.632) (-1803.292) * (-1803.654) (-1804.762) [-1803.751] (-1804.863) -- 0:01:09
      281000 -- (-1803.890) (-1804.385) (-1802.336) [-1804.329] * (-1802.505) (-1805.143) [-1803.670] (-1803.200) -- 0:01:09
      281500 -- (-1803.884) (-1806.689) (-1802.717) [-1803.678] * [-1804.672] (-1803.447) (-1803.670) (-1803.945) -- 0:01:08
      282000 -- (-1804.128) (-1806.257) [-1802.996] (-1803.272) * (-1804.312) (-1805.332) (-1806.086) [-1805.865] -- 0:01:08
      282500 -- (-1803.204) (-1806.079) (-1803.590) [-1803.390] * (-1803.542) (-1807.696) (-1804.751) [-1807.554] -- 0:01:08
      283000 -- (-1804.766) (-1803.965) [-1802.723] (-1805.503) * (-1807.578) (-1805.665) (-1804.801) [-1804.229] -- 0:01:08
      283500 -- (-1805.705) [-1803.793] (-1803.471) (-1807.515) * (-1804.033) (-1802.864) (-1805.638) [-1805.488] -- 0:01:08
      284000 -- (-1805.767) (-1804.752) (-1806.575) [-1802.217] * (-1803.676) (-1802.987) [-1804.014] (-1803.733) -- 0:01:08
      284500 -- (-1806.291) [-1803.961] (-1805.741) (-1805.366) * (-1802.863) [-1803.095] (-1804.079) (-1804.780) -- 0:01:07
      285000 -- (-1803.875) [-1804.400] (-1806.828) (-1804.661) * (-1803.163) (-1803.517) [-1803.037] (-1805.317) -- 0:01:07

      Average standard deviation of split frequencies: 0.013186

      285500 -- [-1803.764] (-1805.210) (-1804.282) (-1803.496) * (-1804.275) [-1803.008] (-1804.172) (-1803.980) -- 0:01:07
      286000 -- (-1803.896) (-1803.601) [-1809.778] (-1805.851) * (-1803.028) [-1802.887] (-1803.225) (-1803.861) -- 0:01:07
      286500 -- [-1804.965] (-1803.090) (-1804.064) (-1803.630) * (-1803.734) (-1803.696) (-1805.008) [-1803.410] -- 0:01:07
      287000 -- (-1802.759) [-1804.134] (-1805.876) (-1804.849) * (-1805.669) (-1807.562) [-1803.548] (-1803.360) -- 0:01:07
      287500 -- [-1803.255] (-1803.339) (-1806.240) (-1805.820) * (-1804.704) (-1807.337) [-1803.523] (-1803.092) -- 0:01:06
      288000 -- (-1803.490) [-1804.043] (-1806.193) (-1804.497) * (-1805.098) [-1803.085] (-1803.368) (-1804.081) -- 0:01:06
      288500 -- (-1804.690) [-1803.381] (-1805.385) (-1806.361) * (-1806.783) (-1804.541) [-1804.999] (-1803.641) -- 0:01:09
      289000 -- (-1807.775) [-1805.330] (-1803.983) (-1806.686) * (-1807.051) [-1803.943] (-1802.992) (-1804.408) -- 0:01:08
      289500 -- (-1803.303) (-1804.196) [-1804.534] (-1806.966) * (-1806.612) [-1802.676] (-1803.845) (-1804.206) -- 0:01:08
      290000 -- (-1804.602) (-1809.664) (-1806.559) [-1803.634] * (-1807.242) (-1804.928) [-1803.262] (-1805.753) -- 0:01:08

      Average standard deviation of split frequencies: 0.013948

      290500 -- (-1804.771) (-1806.474) (-1805.058) [-1804.754] * (-1809.972) [-1804.907] (-1804.354) (-1805.700) -- 0:01:08
      291000 -- [-1805.644] (-1803.350) (-1804.175) (-1808.932) * (-1803.923) [-1804.068] (-1803.873) (-1805.022) -- 0:01:08
      291500 -- [-1803.956] (-1809.941) (-1805.309) (-1805.265) * (-1804.964) [-1806.030] (-1805.400) (-1802.943) -- 0:01:08
      292000 -- (-1804.487) (-1810.292) (-1806.415) [-1803.937] * (-1804.372) (-1805.678) (-1803.481) [-1806.786] -- 0:01:07
      292500 -- [-1803.171] (-1804.635) (-1807.115) (-1805.476) * (-1804.491) [-1806.219] (-1804.047) (-1805.171) -- 0:01:07
      293000 -- (-1804.325) [-1804.972] (-1803.242) (-1807.911) * [-1804.648] (-1804.405) (-1810.281) (-1805.397) -- 0:01:07
      293500 -- (-1812.624) [-1803.107] (-1806.882) (-1808.577) * (-1806.510) (-1803.379) [-1809.333] (-1803.821) -- 0:01:07
      294000 -- [-1808.113] (-1806.670) (-1803.685) (-1804.895) * (-1806.011) [-1803.673] (-1803.707) (-1804.788) -- 0:01:07
      294500 -- (-1807.755) (-1804.419) (-1805.919) [-1804.267] * (-1803.314) [-1802.996] (-1805.330) (-1807.120) -- 0:01:07
      295000 -- (-1803.755) (-1804.720) [-1803.515] (-1806.744) * (-1806.779) (-1805.507) (-1806.040) [-1805.676] -- 0:01:06

      Average standard deviation of split frequencies: 0.012422

      295500 -- (-1803.611) [-1803.730] (-1807.526) (-1802.863) * [-1806.634] (-1808.169) (-1812.906) (-1804.346) -- 0:01:06
      296000 -- (-1804.030) [-1804.929] (-1804.536) (-1804.047) * (-1804.868) (-1803.888) (-1804.405) [-1804.221] -- 0:01:06
      296500 -- [-1805.525] (-1804.246) (-1803.403) (-1803.496) * (-1803.570) [-1804.079] (-1807.902) (-1806.316) -- 0:01:06
      297000 -- [-1803.772] (-1804.379) (-1803.584) (-1802.845) * [-1804.241] (-1805.112) (-1804.304) (-1804.656) -- 0:01:06
      297500 -- (-1803.351) (-1804.311) (-1803.236) [-1802.923] * [-1805.529] (-1803.158) (-1807.115) (-1804.563) -- 0:01:06
      298000 -- (-1803.730) (-1803.350) [-1804.030] (-1803.913) * [-1804.062] (-1803.644) (-1803.200) (-1804.260) -- 0:01:05
      298500 -- [-1805.241] (-1805.075) (-1804.502) (-1803.259) * (-1805.148) (-1803.711) [-1803.201] (-1804.541) -- 0:01:05
      299000 -- (-1805.395) (-1804.131) (-1804.810) [-1803.300] * (-1804.521) (-1805.395) (-1804.936) [-1803.333] -- 0:01:07
      299500 -- (-1805.735) (-1803.446) [-1803.729] (-1809.309) * (-1803.736) (-1803.913) (-1803.133) [-1804.260] -- 0:01:07
      300000 -- (-1809.143) [-1805.122] (-1803.604) (-1804.693) * (-1803.659) [-1803.700] (-1804.774) (-1812.704) -- 0:01:07

      Average standard deviation of split frequencies: 0.012543

      300500 -- (-1804.970) [-1807.405] (-1803.246) (-1804.860) * (-1803.562) (-1803.989) (-1804.409) [-1806.001] -- 0:01:07
      301000 -- [-1805.926] (-1806.380) (-1804.539) (-1805.036) * [-1803.216] (-1807.478) (-1806.511) (-1807.174) -- 0:01:07
      301500 -- (-1804.736) (-1806.255) [-1803.434] (-1803.019) * (-1804.348) (-1809.608) [-1803.649] (-1804.461) -- 0:01:07
      302000 -- (-1804.385) [-1804.987] (-1805.663) (-1803.050) * (-1805.642) [-1805.149] (-1806.582) (-1803.222) -- 0:01:07
      302500 -- (-1807.742) (-1802.727) (-1803.279) [-1803.920] * (-1803.569) (-1804.719) [-1805.233] (-1806.110) -- 0:01:06
      303000 -- (-1809.051) (-1803.929) (-1803.346) [-1804.113] * (-1804.738) (-1805.152) (-1804.959) [-1804.469] -- 0:01:06
      303500 -- (-1810.145) [-1803.915] (-1803.011) (-1803.563) * (-1805.295) [-1806.135] (-1804.096) (-1803.419) -- 0:01:06
      304000 -- (-1814.247) (-1803.905) (-1803.400) [-1803.536] * [-1807.256] (-1804.997) (-1804.912) (-1806.096) -- 0:01:06
      304500 -- (-1805.560) [-1804.106] (-1803.369) (-1805.387) * [-1802.728] (-1804.296) (-1805.265) (-1805.400) -- 0:01:06
      305000 -- (-1804.649) (-1808.603) [-1804.635] (-1805.608) * (-1803.871) [-1806.273] (-1805.375) (-1806.649) -- 0:01:06

      Average standard deviation of split frequencies: 0.012016

      305500 -- (-1806.309) (-1804.320) [-1804.979] (-1804.270) * [-1806.874] (-1802.941) (-1804.957) (-1805.133) -- 0:01:05
      306000 -- (-1807.323) [-1804.589] (-1805.338) (-1802.905) * (-1805.325) (-1804.329) [-1803.784] (-1804.702) -- 0:01:05
      306500 -- [-1805.500] (-1805.633) (-1805.979) (-1806.471) * (-1804.473) (-1806.079) [-1803.562] (-1805.953) -- 0:01:05
      307000 -- (-1806.732) (-1807.335) [-1803.760] (-1804.550) * [-1804.686] (-1802.880) (-1804.339) (-1804.514) -- 0:01:05
      307500 -- (-1804.328) (-1807.590) [-1804.187] (-1806.243) * (-1804.522) [-1803.098] (-1802.210) (-1805.662) -- 0:01:05
      308000 -- [-1804.519] (-1804.893) (-1804.930) (-1807.270) * (-1803.076) (-1804.138) [-1803.781] (-1803.814) -- 0:01:05
      308500 -- [-1803.058] (-1804.779) (-1805.310) (-1804.894) * (-1802.400) (-1803.637) [-1802.551] (-1805.386) -- 0:01:05
      309000 -- [-1804.513] (-1804.444) (-1803.705) (-1804.026) * (-1802.978) [-1802.501] (-1803.915) (-1804.415) -- 0:01:04
      309500 -- (-1804.592) (-1804.322) [-1804.230] (-1803.787) * (-1803.760) (-1803.820) (-1806.722) [-1803.752] -- 0:01:04
      310000 -- [-1806.978] (-1806.718) (-1802.968) (-1804.264) * (-1804.307) (-1803.840) [-1806.094] (-1803.751) -- 0:01:06

      Average standard deviation of split frequencies: 0.011836

      310500 -- (-1804.298) (-1803.128) (-1807.631) [-1804.312] * [-1804.783] (-1804.455) (-1805.130) (-1803.890) -- 0:01:06
      311000 -- (-1804.501) (-1803.189) (-1803.466) [-1803.226] * (-1805.703) (-1803.889) [-1803.833] (-1803.003) -- 0:01:06
      311500 -- (-1805.808) (-1804.381) [-1803.705] (-1805.132) * (-1805.087) (-1803.506) (-1803.800) [-1803.272] -- 0:01:06
      312000 -- (-1804.212) (-1804.651) [-1806.409] (-1805.200) * (-1807.847) (-1806.119) (-1811.315) [-1803.923] -- 0:01:06
      312500 -- [-1805.139] (-1804.806) (-1806.392) (-1803.261) * (-1805.410) (-1806.499) (-1804.648) [-1805.946] -- 0:01:06
      313000 -- (-1802.856) (-1804.949) (-1804.898) [-1807.344] * (-1802.788) (-1810.831) (-1803.476) [-1804.911] -- 0:01:05
      313500 -- (-1804.384) [-1804.283] (-1803.449) (-1807.967) * (-1804.288) (-1803.409) [-1806.642] (-1804.633) -- 0:01:05
      314000 -- (-1804.187) (-1803.800) [-1804.251] (-1805.881) * [-1806.104] (-1803.336) (-1804.138) (-1806.139) -- 0:01:05
      314500 -- [-1804.909] (-1804.527) (-1803.243) (-1804.158) * (-1808.681) (-1805.129) [-1804.121] (-1806.426) -- 0:01:05
      315000 -- [-1804.620] (-1803.389) (-1803.243) (-1805.748) * (-1806.509) (-1802.978) (-1807.637) [-1805.527] -- 0:01:05

      Average standard deviation of split frequencies: 0.011636

      315500 -- (-1803.321) (-1805.092) [-1804.708] (-1806.792) * (-1804.897) (-1804.629) [-1804.949] (-1806.149) -- 0:01:05
      316000 -- (-1803.877) (-1803.277) (-1803.501) [-1804.884] * (-1803.861) [-1805.569] (-1802.904) (-1808.966) -- 0:01:04
      316500 -- (-1803.720) [-1803.293] (-1805.061) (-1804.080) * (-1805.632) (-1803.686) [-1803.765] (-1804.319) -- 0:01:04
      317000 -- (-1802.947) [-1803.413] (-1802.990) (-1805.211) * (-1804.792) (-1803.881) [-1804.742] (-1808.426) -- 0:01:04
      317500 -- (-1807.920) [-1802.987] (-1805.785) (-1802.701) * (-1804.402) [-1805.413] (-1802.822) (-1806.884) -- 0:01:04
      318000 -- (-1805.149) (-1803.696) [-1803.872] (-1803.684) * (-1803.957) (-1805.886) [-1805.404] (-1805.048) -- 0:01:04
      318500 -- [-1808.321] (-1806.217) (-1803.255) (-1804.014) * (-1803.641) [-1806.579] (-1805.311) (-1805.550) -- 0:01:04
      319000 -- (-1806.356) (-1803.655) (-1805.597) [-1804.347] * (-1805.352) (-1802.971) [-1805.256] (-1804.852) -- 0:01:04
      319500 -- (-1807.466) [-1803.812] (-1804.326) (-1805.243) * (-1804.661) (-1803.342) (-1804.946) [-1803.451] -- 0:01:03
      320000 -- (-1807.699) (-1803.372) [-1804.023] (-1805.740) * (-1804.000) (-1804.116) (-1802.997) [-1804.118] -- 0:01:03

      Average standard deviation of split frequencies: 0.012055

      320500 -- (-1805.235) (-1802.462) (-1805.300) [-1806.242] * [-1805.286] (-1808.271) (-1802.212) (-1802.985) -- 0:01:05
      321000 -- [-1804.156] (-1805.074) (-1802.413) (-1803.323) * (-1804.827) (-1806.830) (-1807.012) [-1803.986] -- 0:01:05
      321500 -- (-1803.890) (-1806.019) [-1803.273] (-1804.690) * [-1803.199] (-1803.386) (-1805.377) (-1804.822) -- 0:01:05
      322000 -- (-1804.605) (-1806.979) (-1802.296) [-1803.927] * (-1803.564) (-1803.386) [-1804.948] (-1802.814) -- 0:01:05
      322500 -- (-1805.035) (-1802.654) (-1806.495) [-1803.117] * (-1804.364) (-1803.716) (-1806.155) [-1802.535] -- 0:01:05
      323000 -- (-1803.704) [-1804.611] (-1805.242) (-1802.388) * [-1807.276] (-1803.668) (-1804.401) (-1803.563) -- 0:01:04
      323500 -- (-1804.392) (-1803.553) (-1805.578) [-1804.561] * [-1803.099] (-1804.757) (-1804.683) (-1807.415) -- 0:01:04
      324000 -- [-1804.129] (-1807.638) (-1803.461) (-1806.815) * [-1803.967] (-1804.130) (-1807.214) (-1807.197) -- 0:01:04
      324500 -- (-1806.317) [-1802.987] (-1803.896) (-1804.423) * (-1808.754) (-1804.845) (-1803.564) [-1804.654] -- 0:01:04
      325000 -- (-1805.981) [-1803.268] (-1802.841) (-1805.933) * [-1804.797] (-1803.936) (-1804.301) (-1805.740) -- 0:01:04

      Average standard deviation of split frequencies: 0.013014

      325500 -- (-1807.594) (-1804.385) (-1808.854) [-1806.107] * [-1803.542] (-1805.893) (-1804.361) (-1804.358) -- 0:01:04
      326000 -- (-1807.777) (-1804.768) (-1806.885) [-1805.356] * (-1805.051) (-1804.767) [-1804.059] (-1804.886) -- 0:01:04
      326500 -- (-1808.068) [-1803.544] (-1806.721) (-1804.325) * (-1803.289) [-1803.153] (-1803.958) (-1804.738) -- 0:01:03
      327000 -- (-1810.447) (-1805.962) (-1804.153) [-1805.604] * (-1805.161) (-1803.190) (-1803.809) [-1804.739] -- 0:01:03
      327500 -- (-1803.460) (-1806.276) [-1805.964] (-1804.291) * (-1806.012) (-1803.036) [-1804.247] (-1805.444) -- 0:01:03
      328000 -- [-1803.609] (-1804.622) (-1804.105) (-1802.608) * [-1804.629] (-1803.579) (-1806.237) (-1804.221) -- 0:01:03
      328500 -- (-1803.842) (-1804.518) [-1804.539] (-1802.987) * (-1807.187) (-1803.781) (-1803.453) [-1804.470] -- 0:01:03
      329000 -- [-1805.034] (-1805.503) (-1803.218) (-1804.485) * [-1804.990] (-1804.020) (-1803.717) (-1805.335) -- 0:01:03
      329500 -- (-1803.395) (-1805.622) [-1803.959] (-1807.914) * [-1807.233] (-1804.947) (-1803.698) (-1809.816) -- 0:01:03
      330000 -- (-1804.644) (-1803.647) [-1804.911] (-1807.183) * (-1804.964) [-1803.969] (-1807.737) (-1805.318) -- 0:01:02

      Average standard deviation of split frequencies: 0.014256

      330500 -- (-1803.877) [-1802.656] (-1807.027) (-1806.085) * (-1803.231) (-1805.155) [-1804.941] (-1802.067) -- 0:01:04
      331000 -- (-1803.338) [-1803.847] (-1804.982) (-1806.337) * (-1803.711) (-1806.186) (-1804.457) [-1804.066] -- 0:01:04
      331500 -- (-1804.752) (-1805.821) [-1803.675] (-1806.722) * (-1803.096) (-1802.742) (-1803.982) [-1802.729] -- 0:01:04
      332000 -- (-1805.284) [-1804.935] (-1804.743) (-1805.542) * [-1804.468] (-1802.719) (-1802.596) (-1804.060) -- 0:01:04
      332500 -- (-1806.081) [-1802.637] (-1805.222) (-1804.042) * (-1805.531) (-1807.580) (-1803.959) [-1805.433] -- 0:01:04
      333000 -- (-1804.085) (-1802.679) (-1805.671) [-1804.087] * [-1805.704] (-1803.159) (-1803.772) (-1804.203) -- 0:01:04
      333500 -- (-1806.103) [-1805.103] (-1804.161) (-1803.032) * [-1805.579] (-1803.319) (-1805.118) (-1807.938) -- 0:01:03
      334000 -- (-1803.498) [-1802.890] (-1804.950) (-1805.786) * (-1807.430) (-1804.127) [-1806.719] (-1804.296) -- 0:01:03
      334500 -- (-1803.418) [-1802.784] (-1804.006) (-1808.917) * (-1807.831) (-1803.884) [-1805.490] (-1804.597) -- 0:01:03
      335000 -- [-1805.944] (-1805.673) (-1805.396) (-1806.108) * (-1804.405) (-1803.023) (-1805.056) [-1803.177] -- 0:01:03

      Average standard deviation of split frequencies: 0.014872

      335500 -- (-1804.361) (-1802.871) [-1804.516] (-1803.768) * (-1805.278) (-1803.014) (-1804.378) [-1803.907] -- 0:01:03
      336000 -- (-1805.430) [-1805.454] (-1806.587) (-1805.822) * (-1804.023) (-1805.152) [-1804.603] (-1802.603) -- 0:01:03
      336500 -- (-1804.781) (-1805.325) (-1804.502) [-1805.142] * [-1803.425] (-1804.991) (-1805.381) (-1802.720) -- 0:01:03
      337000 -- (-1804.610) [-1803.160] (-1804.585) (-1805.593) * (-1804.542) (-1806.222) (-1805.494) [-1804.427] -- 0:01:02
      337500 -- (-1802.810) (-1805.893) (-1808.577) [-1806.817] * (-1803.199) [-1804.535] (-1804.248) (-1803.534) -- 0:01:02
      338000 -- (-1804.266) (-1805.266) [-1803.773] (-1805.249) * [-1802.776] (-1804.387) (-1803.706) (-1802.716) -- 0:01:02
      338500 -- [-1805.162] (-1805.915) (-1804.008) (-1809.436) * (-1804.803) [-1807.192] (-1803.778) (-1806.987) -- 0:01:02
      339000 -- (-1805.789) (-1803.743) [-1803.737] (-1803.466) * (-1804.755) [-1804.357] (-1804.809) (-1807.133) -- 0:01:02
      339500 -- (-1804.435) (-1805.042) [-1803.703] (-1803.921) * (-1803.020) (-1806.071) [-1807.716] (-1804.271) -- 0:01:02
      340000 -- [-1804.405] (-1804.958) (-1803.977) (-1802.879) * (-1804.263) (-1805.133) [-1812.299] (-1803.611) -- 0:01:02

      Average standard deviation of split frequencies: 0.013561

      340500 -- (-1806.142) (-1804.876) [-1804.693] (-1806.997) * (-1803.370) (-1809.349) (-1804.972) [-1803.006] -- 0:01:03
      341000 -- (-1804.343) (-1809.113) (-1807.989) [-1806.106] * (-1804.250) (-1805.805) [-1805.869] (-1805.358) -- 0:01:03
      341500 -- (-1803.831) [-1803.877] (-1807.790) (-1802.423) * (-1804.921) [-1802.540] (-1803.249) (-1804.672) -- 0:01:03
      342000 -- (-1804.913) (-1803.518) (-1810.126) [-1802.294] * (-1805.626) (-1804.884) [-1805.501] (-1803.683) -- 0:01:03
      342500 -- [-1807.166] (-1803.784) (-1803.340) (-1803.840) * (-1804.602) (-1805.748) (-1806.796) [-1803.217] -- 0:01:03
      343000 -- (-1806.002) [-1805.546] (-1803.646) (-1809.042) * [-1804.202] (-1804.814) (-1810.432) (-1803.548) -- 0:01:03
      343500 -- (-1808.301) [-1807.474] (-1805.292) (-1803.242) * (-1805.781) [-1807.122] (-1807.104) (-1803.157) -- 0:01:03
      344000 -- (-1807.861) [-1804.293] (-1803.748) (-1803.863) * (-1803.787) [-1808.527] (-1804.777) (-1804.509) -- 0:01:02
      344500 -- (-1805.275) (-1803.458) (-1806.427) [-1804.492] * (-1803.610) (-1810.044) [-1803.242] (-1805.460) -- 0:01:02
      345000 -- [-1804.596] (-1804.050) (-1803.875) (-1802.711) * [-1803.747] (-1803.733) (-1805.586) (-1808.756) -- 0:01:02

      Average standard deviation of split frequencies: 0.014987

      345500 -- (-1804.905) [-1804.914] (-1804.444) (-1803.598) * (-1806.164) (-1805.003) (-1803.129) [-1807.256] -- 0:01:02
      346000 -- (-1804.515) [-1803.533] (-1804.796) (-1804.698) * (-1806.470) (-1808.585) [-1802.466] (-1804.364) -- 0:01:02
      346500 -- (-1805.928) (-1804.490) (-1804.104) [-1806.795] * [-1803.780] (-1812.224) (-1803.310) (-1803.099) -- 0:01:02
      347000 -- (-1804.384) (-1806.178) [-1803.196] (-1805.659) * (-1803.885) [-1804.049] (-1803.968) (-1803.156) -- 0:01:02
      347500 -- [-1805.541] (-1805.655) (-1804.385) (-1806.187) * (-1803.717) [-1804.826] (-1804.192) (-1803.193) -- 0:01:01
      348000 -- (-1805.506) (-1805.048) [-1805.343] (-1804.897) * (-1805.223) (-1805.706) [-1803.321] (-1809.718) -- 0:01:01
      348500 -- (-1805.531) (-1807.178) [-1805.081] (-1804.031) * (-1805.764) (-1807.528) (-1805.067) [-1807.513] -- 0:01:01
      349000 -- (-1805.064) [-1808.374] (-1803.596) (-1803.887) * [-1802.873] (-1805.281) (-1803.212) (-1804.394) -- 0:01:01
      349500 -- [-1804.559] (-1805.391) (-1806.690) (-1807.327) * [-1805.799] (-1804.965) (-1804.993) (-1804.880) -- 0:01:01
      350000 -- [-1804.846] (-1805.051) (-1807.472) (-1803.515) * [-1803.688] (-1806.197) (-1806.222) (-1804.376) -- 0:01:01

      Average standard deviation of split frequencies: 0.016132

      350500 -- (-1805.268) (-1805.051) (-1805.196) [-1803.163] * (-1806.807) (-1804.573) [-1806.259] (-1804.389) -- 0:01:03
      351000 -- (-1805.010) (-1804.715) [-1807.665] (-1805.532) * (-1807.064) (-1804.511) (-1805.510) [-1802.730] -- 0:01:02
      351500 -- (-1806.357) (-1806.609) (-1804.746) [-1804.858] * [-1803.555] (-1805.248) (-1805.882) (-1804.448) -- 0:01:02
      352000 -- (-1805.417) (-1806.727) [-1803.704] (-1804.198) * [-1803.539] (-1806.379) (-1805.912) (-1803.414) -- 0:01:02
      352500 -- (-1804.048) [-1804.560] (-1806.245) (-1803.909) * (-1808.269) (-1805.440) (-1807.243) [-1803.906] -- 0:01:02
      353000 -- [-1804.767] (-1802.825) (-1803.877) (-1809.109) * (-1805.067) (-1811.153) [-1805.040] (-1803.640) -- 0:01:02
      353500 -- [-1805.114] (-1807.771) (-1804.017) (-1804.076) * (-1803.996) (-1807.937) (-1802.831) [-1803.052] -- 0:01:02
      354000 -- (-1807.733) (-1808.051) (-1806.956) [-1804.731] * (-1806.001) (-1805.224) (-1802.986) [-1803.424] -- 0:01:02
      354500 -- (-1804.149) (-1807.475) (-1805.731) [-1804.154] * (-1806.213) (-1803.445) [-1804.898] (-1802.909) -- 0:01:01
      355000 -- [-1805.252] (-1807.828) (-1802.818) (-1804.121) * (-1808.236) (-1805.590) [-1804.728] (-1803.632) -- 0:01:01

      Average standard deviation of split frequencies: 0.016155

      355500 -- (-1804.552) (-1806.622) (-1804.390) [-1803.879] * [-1804.137] (-1803.794) (-1804.628) (-1804.000) -- 0:01:01
      356000 -- (-1809.856) (-1805.527) (-1804.910) [-1802.412] * (-1803.560) (-1803.467) [-1810.213] (-1804.082) -- 0:01:01
      356500 -- (-1805.906) (-1808.336) [-1807.347] (-1803.396) * (-1802.753) (-1807.192) [-1803.731] (-1803.800) -- 0:01:01
      357000 -- (-1806.478) (-1805.543) [-1802.781] (-1803.077) * [-1804.690] (-1802.778) (-1803.455) (-1803.824) -- 0:01:01
      357500 -- (-1803.705) (-1805.414) [-1805.539] (-1810.375) * (-1804.683) [-1803.354] (-1804.269) (-1804.676) -- 0:01:01
      358000 -- (-1804.900) (-1805.632) (-1807.890) [-1805.398] * [-1804.049] (-1803.373) (-1804.291) (-1804.697) -- 0:01:00
      358500 -- (-1804.983) (-1805.302) [-1805.810] (-1805.173) * (-1804.261) [-1805.278] (-1804.183) (-1804.757) -- 0:01:00
      359000 -- (-1804.259) (-1805.754) (-1808.314) [-1806.757] * (-1804.695) [-1805.182] (-1805.058) (-1803.974) -- 0:01:00
      359500 -- [-1804.058] (-1805.854) (-1803.993) (-1807.106) * (-1803.751) (-1806.330) [-1805.348] (-1805.383) -- 0:01:00
      360000 -- [-1802.543] (-1808.497) (-1805.673) (-1805.814) * (-1804.726) (-1804.191) [-1802.476] (-1803.809) -- 0:01:00

      Average standard deviation of split frequencies: 0.014900

      360500 -- (-1802.670) [-1803.143] (-1806.437) (-1805.589) * (-1803.894) [-1803.186] (-1802.509) (-1805.485) -- 0:01:00
      361000 -- (-1803.866) (-1805.869) (-1804.048) [-1808.748] * (-1807.527) (-1804.253) [-1805.472] (-1806.849) -- 0:01:01
      361500 -- (-1805.864) (-1805.313) (-1804.634) [-1806.241] * (-1805.105) (-1805.174) [-1805.913] (-1805.653) -- 0:01:01
      362000 -- (-1807.238) [-1803.374] (-1805.806) (-1803.839) * [-1804.294] (-1803.401) (-1804.616) (-1804.418) -- 0:01:01
      362500 -- (-1808.364) (-1806.554) [-1802.765] (-1806.320) * (-1803.864) (-1804.691) [-1804.655] (-1807.066) -- 0:01:01
      363000 -- (-1806.378) [-1804.678] (-1802.274) (-1803.626) * (-1803.824) [-1805.056] (-1805.282) (-1804.992) -- 0:01:01
      363500 -- (-1803.988) (-1802.658) [-1803.564] (-1809.315) * [-1804.037] (-1807.158) (-1804.767) (-1804.112) -- 0:01:01
      364000 -- (-1804.685) (-1807.564) (-1802.494) [-1803.947] * (-1804.397) [-1804.771] (-1803.229) (-1807.648) -- 0:01:01
      364500 -- (-1806.021) (-1804.838) (-1803.639) [-1805.305] * (-1805.618) [-1804.939] (-1803.681) (-1804.339) -- 0:01:01
      365000 -- (-1807.392) [-1803.263] (-1803.978) (-1806.199) * (-1804.884) (-1806.048) [-1803.313] (-1804.746) -- 0:01:00

      Average standard deviation of split frequencies: 0.015198

      365500 -- (-1803.692) [-1804.684] (-1802.480) (-1805.285) * [-1804.195] (-1808.692) (-1805.007) (-1806.787) -- 0:01:00
      366000 -- (-1805.318) (-1804.782) (-1809.827) [-1806.672] * [-1804.891] (-1804.530) (-1805.493) (-1807.237) -- 0:01:00
      366500 -- (-1803.080) (-1804.837) (-1804.063) [-1803.982] * [-1805.702] (-1803.596) (-1809.622) (-1807.666) -- 0:01:00
      367000 -- (-1806.115) [-1803.704] (-1804.600) (-1804.333) * (-1809.149) (-1804.634) (-1804.060) [-1807.226] -- 0:01:00
      367500 -- [-1804.989] (-1803.400) (-1805.819) (-1809.193) * (-1806.448) [-1804.659] (-1806.098) (-1803.931) -- 0:01:00
      368000 -- (-1804.990) (-1803.603) [-1804.759] (-1807.356) * (-1808.404) (-1804.676) [-1803.066] (-1803.271) -- 0:01:00
      368500 -- (-1803.999) [-1804.103] (-1802.656) (-1804.166) * [-1806.147] (-1804.840) (-1804.504) (-1805.649) -- 0:00:59
      369000 -- (-1803.999) (-1806.541) [-1802.929] (-1804.913) * (-1805.663) (-1803.751) (-1804.629) [-1801.779] -- 0:00:59
      369500 -- (-1805.008) (-1806.608) (-1802.568) [-1802.307] * (-1805.202) (-1804.351) (-1804.714) [-1803.647] -- 0:00:59
      370000 -- (-1805.957) [-1806.672] (-1804.135) (-1803.445) * (-1803.854) [-1803.770] (-1807.171) (-1803.224) -- 0:00:59

      Average standard deviation of split frequencies: 0.016279

      370500 -- (-1804.713) (-1806.144) (-1804.497) [-1803.436] * [-1802.126] (-1804.833) (-1805.118) (-1803.093) -- 0:00:59
      371000 -- (-1805.702) (-1804.962) (-1804.482) [-1803.769] * (-1808.513) (-1803.439) [-1804.180] (-1803.788) -- 0:01:01
      371500 -- [-1803.849] (-1804.656) (-1806.053) (-1805.103) * (-1804.370) (-1804.350) (-1803.249) [-1805.171] -- 0:01:00
      372000 -- (-1804.796) (-1803.964) (-1804.679) [-1805.454] * (-1804.587) (-1804.485) (-1804.129) [-1801.856] -- 0:01:00
      372500 -- [-1803.332] (-1803.163) (-1805.566) (-1803.804) * (-1805.269) (-1803.867) [-1805.054] (-1802.606) -- 0:01:00
      373000 -- [-1805.447] (-1805.380) (-1804.126) (-1803.501) * (-1805.109) (-1804.433) (-1806.338) [-1802.113] -- 0:01:00
      373500 -- (-1807.209) [-1805.328] (-1805.503) (-1804.256) * (-1804.084) (-1803.605) (-1804.615) [-1806.822] -- 0:01:00
      374000 -- (-1809.467) [-1804.815] (-1806.047) (-1804.404) * [-1803.708] (-1803.250) (-1803.706) (-1806.832) -- 0:01:00
      374500 -- (-1809.876) (-1803.823) [-1805.389] (-1804.239) * (-1806.762) [-1803.398] (-1805.215) (-1803.767) -- 0:01:00
      375000 -- (-1806.966) [-1805.419] (-1803.206) (-1803.861) * (-1809.588) [-1804.541] (-1804.765) (-1804.270) -- 0:01:00

      Average standard deviation of split frequencies: 0.016800

      375500 -- (-1803.537) (-1803.008) (-1805.995) [-1806.226] * (-1805.936) (-1804.751) (-1805.504) [-1804.282] -- 0:00:59
      376000 -- [-1803.372] (-1803.373) (-1807.192) (-1805.348) * (-1804.461) (-1803.600) [-1805.050] (-1802.885) -- 0:00:59
      376500 -- (-1803.179) (-1803.416) [-1805.322] (-1806.970) * (-1804.661) (-1803.601) (-1806.128) [-1807.025] -- 0:00:59
      377000 -- (-1801.999) [-1803.938] (-1804.250) (-1804.027) * (-1807.177) (-1804.216) [-1803.544] (-1803.783) -- 0:00:59
      377500 -- (-1802.857) (-1803.901) [-1803.703] (-1802.858) * (-1805.479) [-1805.110] (-1804.067) (-1806.125) -- 0:00:59
      378000 -- (-1804.924) (-1802.901) [-1803.842] (-1802.991) * (-1803.846) [-1805.077] (-1805.256) (-1805.455) -- 0:00:59
      378500 -- (-1805.223) (-1806.020) [-1806.778] (-1803.132) * [-1807.242] (-1804.442) (-1804.056) (-1809.185) -- 0:00:59
      379000 -- (-1806.492) (-1804.783) (-1809.435) [-1803.199] * (-1805.070) (-1804.244) (-1803.847) [-1806.446] -- 0:00:58
      379500 -- (-1806.224) (-1802.891) (-1806.326) [-1804.889] * [-1805.112] (-1805.254) (-1803.524) (-1803.695) -- 0:01:00
      380000 -- [-1804.390] (-1801.573) (-1806.012) (-1804.726) * [-1805.587] (-1807.541) (-1804.905) (-1803.564) -- 0:01:00

      Average standard deviation of split frequencies: 0.015851

      380500 -- [-1804.143] (-1804.146) (-1815.064) (-1803.060) * (-1804.862) [-1804.724] (-1808.838) (-1803.029) -- 0:01:00
      381000 -- [-1805.140] (-1803.763) (-1815.483) (-1803.437) * (-1805.262) [-1809.492] (-1805.000) (-1805.938) -- 0:01:00
      381500 -- (-1803.798) (-1803.560) [-1807.105] (-1802.902) * (-1803.769) (-1806.165) (-1804.992) [-1805.658] -- 0:00:59
      382000 -- (-1805.127) [-1804.489] (-1804.243) (-1803.435) * [-1804.809] (-1806.831) (-1803.652) (-1806.777) -- 0:00:59
      382500 -- (-1804.227) [-1805.157] (-1804.317) (-1804.246) * (-1803.012) (-1802.887) (-1805.238) [-1804.272] -- 0:00:59
      383000 -- (-1805.153) (-1804.748) (-1802.758) [-1804.170] * (-1804.364) [-1804.571] (-1804.812) (-1803.559) -- 0:00:59
      383500 -- (-1803.660) [-1802.906] (-1805.938) (-1803.354) * (-1804.303) (-1805.849) (-1804.219) [-1805.624] -- 0:00:59
      384000 -- (-1803.447) (-1805.981) [-1805.391] (-1804.516) * (-1803.326) [-1804.558] (-1804.834) (-1803.336) -- 0:00:59
      384500 -- (-1803.827) (-1803.480) [-1804.306] (-1807.581) * (-1803.925) (-1803.762) (-1805.390) [-1804.322] -- 0:00:59
      385000 -- [-1804.199] (-1809.203) (-1805.287) (-1804.831) * [-1803.845] (-1804.954) (-1803.998) (-1804.521) -- 0:00:59

      Average standard deviation of split frequencies: 0.016121

      385500 -- (-1804.561) [-1803.299] (-1809.424) (-1803.101) * (-1806.476) (-1808.198) [-1807.314] (-1805.513) -- 0:00:58
      386000 -- (-1809.404) (-1805.240) (-1804.897) [-1803.095] * (-1809.206) (-1804.721) (-1804.575) [-1804.147] -- 0:00:58
      386500 -- (-1810.786) (-1803.968) (-1802.994) [-1803.794] * (-1807.713) (-1804.061) (-1803.607) [-1803.945] -- 0:00:58
      387000 -- (-1807.601) (-1805.467) [-1803.571] (-1804.541) * (-1806.219) (-1803.797) (-1803.694) [-1804.195] -- 0:00:58
      387500 -- [-1804.267] (-1805.055) (-1806.437) (-1804.911) * (-1808.901) (-1803.530) (-1806.500) [-1803.924] -- 0:00:58
      388000 -- [-1803.459] (-1807.718) (-1807.007) (-1805.452) * (-1804.182) [-1805.867] (-1804.270) (-1803.673) -- 0:00:58
      388500 -- (-1804.343) [-1806.090] (-1804.287) (-1805.337) * (-1807.926) (-1807.668) (-1802.809) [-1803.015] -- 0:00:59
      389000 -- (-1804.334) [-1803.419] (-1803.072) (-1803.692) * (-1803.979) (-1806.884) (-1804.715) [-1803.344] -- 0:00:59
      389500 -- (-1806.232) (-1805.289) [-1809.217] (-1804.772) * (-1803.745) (-1803.731) (-1804.952) [-1804.091] -- 0:00:59
      390000 -- (-1803.654) (-1803.502) (-1808.403) [-1804.905] * (-1803.161) (-1805.053) (-1804.224) [-1806.316] -- 0:00:59

      Average standard deviation of split frequencies: 0.016411

      390500 -- (-1804.310) (-1805.300) (-1805.883) [-1804.847] * [-1804.439] (-1804.067) (-1805.093) (-1806.584) -- 0:00:59
      391000 -- (-1804.696) [-1803.552] (-1803.795) (-1806.251) * [-1803.687] (-1807.071) (-1804.019) (-1805.405) -- 0:00:59
      391500 -- [-1803.747] (-1805.720) (-1802.815) (-1809.579) * (-1806.830) (-1804.794) [-1803.566] (-1803.922) -- 0:00:59
      392000 -- (-1802.847) (-1805.773) [-1803.323] (-1804.911) * (-1804.939) (-1803.634) [-1803.429] (-1805.776) -- 0:00:58
      392500 -- (-1803.052) (-1806.044) (-1803.512) [-1804.903] * [-1804.122] (-1803.259) (-1802.996) (-1803.743) -- 0:00:58
      393000 -- (-1804.347) (-1804.573) [-1803.276] (-1808.487) * [-1803.223] (-1807.301) (-1804.871) (-1804.944) -- 0:00:58
      393500 -- (-1806.920) (-1804.684) (-1804.226) [-1811.762] * (-1805.633) [-1807.898] (-1804.173) (-1804.248) -- 0:00:58
      394000 -- (-1806.521) (-1807.349) [-1803.871] (-1811.400) * [-1803.592] (-1803.940) (-1805.194) (-1809.808) -- 0:00:58
      394500 -- (-1804.326) (-1810.911) [-1805.933] (-1805.411) * (-1806.042) (-1804.931) (-1804.828) [-1805.472] -- 0:00:58
      395000 -- [-1804.202] (-1811.755) (-1802.335) (-1804.360) * (-1804.733) [-1803.506] (-1805.875) (-1804.495) -- 0:00:58

      Average standard deviation of split frequencies: 0.016190

      395500 -- (-1806.983) (-1805.593) [-1802.607] (-1806.221) * (-1807.524) (-1802.838) [-1803.822] (-1804.470) -- 0:00:58
      396000 -- (-1805.616) (-1804.457) (-1803.475) [-1803.595] * (-1805.864) (-1807.438) [-1803.105] (-1805.977) -- 0:00:57
      396500 -- (-1803.311) [-1803.422] (-1804.145) (-1803.377) * (-1803.518) (-1809.825) [-1803.701] (-1803.699) -- 0:00:57
      397000 -- (-1806.051) (-1806.915) (-1803.393) [-1803.767] * (-1804.420) (-1808.623) [-1804.980] (-1803.342) -- 0:00:57
      397500 -- (-1805.406) [-1805.250] (-1803.107) (-1804.206) * (-1805.330) (-1803.653) [-1806.112] (-1805.322) -- 0:00:59
      398000 -- (-1804.219) (-1804.170) (-1805.003) [-1806.080] * [-1805.204] (-1806.417) (-1804.376) (-1803.964) -- 0:00:58
      398500 -- (-1802.229) [-1805.801] (-1808.149) (-1803.660) * (-1805.034) (-1805.928) [-1803.778] (-1805.464) -- 0:00:58
      399000 -- [-1803.265] (-1805.400) (-1805.836) (-1802.827) * (-1804.792) (-1805.649) (-1803.666) [-1807.991] -- 0:00:58
      399500 -- (-1806.227) (-1805.872) (-1802.681) [-1806.225] * (-1803.623) (-1803.874) [-1803.128] (-1803.426) -- 0:00:58
      400000 -- (-1804.959) (-1803.572) (-1806.935) [-1805.593] * (-1803.759) [-1802.643] (-1802.257) (-1808.819) -- 0:00:58

      Average standard deviation of split frequencies: 0.014354

      400500 -- (-1804.613) (-1803.293) [-1803.246] (-1806.547) * [-1803.823] (-1804.019) (-1803.100) (-1805.370) -- 0:00:58
      401000 -- (-1805.543) (-1804.389) (-1804.006) [-1805.029] * (-1804.045) [-1803.833] (-1804.358) (-1803.560) -- 0:00:58
      401500 -- (-1802.931) [-1803.543] (-1806.023) (-1806.476) * (-1806.646) (-1805.801) [-1805.950] (-1804.917) -- 0:00:58
      402000 -- (-1805.862) [-1805.728] (-1809.719) (-1805.854) * (-1804.547) (-1803.753) (-1805.473) [-1803.767] -- 0:00:58
      402500 -- (-1803.382) (-1807.358) [-1809.691] (-1806.391) * (-1804.055) (-1803.908) [-1806.889] (-1807.223) -- 0:00:57
      403000 -- [-1803.704] (-1805.001) (-1808.952) (-1805.850) * (-1803.560) (-1805.212) (-1806.576) [-1802.423] -- 0:00:57
      403500 -- (-1805.013) (-1802.851) (-1803.350) [-1803.980] * (-1803.992) [-1803.088] (-1802.954) (-1804.543) -- 0:00:57
      404000 -- (-1807.625) (-1803.751) (-1802.897) [-1803.481] * (-1804.522) (-1805.155) (-1806.143) [-1805.351] -- 0:00:57
      404500 -- (-1803.518) (-1803.792) [-1803.413] (-1805.399) * (-1804.888) (-1806.039) (-1805.433) [-1805.985] -- 0:00:57
      405000 -- [-1802.585] (-1807.577) (-1803.611) (-1803.128) * (-1805.264) (-1802.656) [-1804.119] (-1807.066) -- 0:00:57

      Average standard deviation of split frequencies: 0.014398

      405500 -- (-1804.352) [-1804.090] (-1805.095) (-1804.007) * (-1803.979) (-1805.517) [-1803.003] (-1804.044) -- 0:00:57
      406000 -- (-1804.658) (-1804.472) (-1807.978) [-1805.960] * (-1803.152) (-1805.017) [-1803.001] (-1804.979) -- 0:00:57
      406500 -- (-1803.304) [-1806.311] (-1803.322) (-1806.605) * (-1804.358) (-1806.855) [-1805.475] (-1805.720) -- 0:00:58
      407000 -- (-1804.596) (-1806.340) [-1803.248] (-1805.330) * (-1802.633) (-1803.728) (-1804.667) [-1804.857] -- 0:00:58
      407500 -- (-1805.541) (-1807.542) [-1805.665] (-1805.452) * (-1804.020) [-1803.393] (-1807.489) (-1803.559) -- 0:00:58
      408000 -- [-1806.329] (-1807.586) (-1804.805) (-1805.210) * (-1803.260) (-1803.744) [-1806.241] (-1804.165) -- 0:00:58
      408500 -- (-1806.780) (-1808.154) (-1803.253) [-1804.904] * (-1802.773) (-1803.689) [-1805.260] (-1803.185) -- 0:00:57
      409000 -- (-1806.145) (-1804.106) (-1803.423) [-1803.832] * (-1804.494) (-1805.284) [-1803.127] (-1803.651) -- 0:00:57
      409500 -- (-1803.445) (-1806.794) (-1803.817) [-1802.666] * (-1805.251) (-1805.237) [-1804.775] (-1803.576) -- 0:00:57
      410000 -- (-1804.071) [-1811.671] (-1802.964) (-1804.241) * (-1803.574) [-1803.053] (-1803.516) (-1802.784) -- 0:00:57

      Average standard deviation of split frequencies: 0.014464

      410500 -- (-1804.620) (-1805.913) [-1803.732] (-1803.372) * (-1803.688) (-1806.222) [-1803.987] (-1803.410) -- 0:00:57
      411000 -- (-1803.775) (-1807.319) [-1803.318] (-1804.155) * (-1805.048) [-1804.117] (-1805.549) (-1804.731) -- 0:00:57
      411500 -- (-1802.505) [-1802.730] (-1806.033) (-1805.414) * (-1802.732) (-1804.171) [-1803.021] (-1804.125) -- 0:00:57
      412000 -- [-1803.166] (-1802.596) (-1807.197) (-1803.591) * (-1802.779) [-1802.687] (-1803.692) (-1804.410) -- 0:00:57
      412500 -- (-1807.589) (-1802.978) [-1804.667] (-1804.963) * [-1803.224] (-1804.421) (-1803.202) (-1804.839) -- 0:00:56
      413000 -- (-1804.603) [-1804.831] (-1804.983) (-1805.046) * [-1802.310] (-1802.453) (-1803.300) (-1808.071) -- 0:00:56
      413500 -- (-1803.484) (-1803.965) [-1804.597] (-1803.680) * (-1808.425) (-1804.456) [-1804.546] (-1805.194) -- 0:00:56
      414000 -- (-1805.076) (-1804.438) (-1804.299) [-1804.306] * (-1803.058) (-1805.274) [-1803.442] (-1804.558) -- 0:00:56
      414500 -- (-1803.814) (-1803.565) [-1804.489] (-1804.411) * (-1804.375) (-1803.122) [-1804.378] (-1803.979) -- 0:00:56
      415000 -- [-1804.195] (-1803.400) (-1805.139) (-1808.552) * (-1805.541) (-1803.348) (-1805.097) [-1806.322] -- 0:00:56

      Average standard deviation of split frequencies: 0.014958

      415500 -- (-1804.232) [-1803.480] (-1803.263) (-1803.670) * (-1805.304) (-1804.814) [-1802.349] (-1806.707) -- 0:00:57
      416000 -- (-1804.375) [-1803.304] (-1803.908) (-1805.066) * (-1802.795) (-1806.943) (-1806.493) [-1803.679] -- 0:00:57
      416500 -- (-1804.552) (-1805.205) [-1803.814] (-1803.383) * (-1803.245) [-1806.878] (-1804.701) (-1804.419) -- 0:00:57
      417000 -- (-1803.460) [-1805.875] (-1804.563) (-1802.928) * (-1805.734) (-1808.508) (-1805.052) [-1803.543] -- 0:00:57
      417500 -- (-1803.194) (-1804.675) [-1804.697] (-1802.971) * (-1807.141) [-1804.761] (-1806.450) (-1804.634) -- 0:00:57
      418000 -- (-1803.553) [-1803.412] (-1806.279) (-1805.593) * (-1803.989) [-1805.031] (-1805.046) (-1804.304) -- 0:00:57
      418500 -- (-1803.387) [-1807.431] (-1804.370) (-1802.631) * (-1808.471) (-1808.949) (-1807.349) [-1804.455] -- 0:00:56
      419000 -- (-1805.398) (-1802.702) [-1805.535] (-1802.068) * (-1803.738) (-1808.612) (-1806.031) [-1805.349] -- 0:00:56
      419500 -- [-1803.166] (-1802.957) (-1803.997) (-1803.702) * [-1803.929] (-1805.354) (-1803.047) (-1808.214) -- 0:00:56
      420000 -- (-1803.857) (-1805.728) [-1803.841] (-1804.122) * (-1803.325) [-1804.609] (-1802.941) (-1804.166) -- 0:00:56

      Average standard deviation of split frequencies: 0.013896

      420500 -- (-1803.674) [-1806.847] (-1807.030) (-1806.134) * (-1802.796) [-1804.840] (-1807.319) (-1804.647) -- 0:00:56
      421000 -- [-1806.163] (-1804.315) (-1807.959) (-1803.632) * (-1803.701) [-1803.154] (-1803.793) (-1804.532) -- 0:00:56
      421500 -- (-1804.091) (-1803.883) (-1805.056) [-1804.687] * [-1807.938] (-1804.128) (-1803.101) (-1803.245) -- 0:00:56
      422000 -- (-1803.845) [-1804.524] (-1804.381) (-1803.381) * (-1803.392) [-1803.341] (-1805.868) (-1803.278) -- 0:00:56
      422500 -- (-1804.084) [-1805.193] (-1804.950) (-1803.148) * (-1809.757) [-1803.376] (-1806.126) (-1803.293) -- 0:00:56
      423000 -- (-1804.316) (-1803.696) [-1803.583] (-1804.422) * (-1809.959) (-1803.404) (-1804.754) [-1803.629] -- 0:00:55
      423500 -- [-1805.821] (-1806.046) (-1804.014) (-1806.731) * (-1805.533) (-1803.491) [-1805.742] (-1808.070) -- 0:00:55
      424000 -- (-1804.572) [-1802.655] (-1803.334) (-1802.704) * (-1804.058) (-1804.642) (-1806.053) [-1804.260] -- 0:00:55
      424500 -- [-1805.605] (-1802.737) (-1803.017) (-1803.657) * [-1804.210] (-1803.549) (-1806.409) (-1803.178) -- 0:00:55
      425000 -- (-1806.742) [-1802.841] (-1803.524) (-1803.848) * (-1802.993) (-1804.059) [-1805.638] (-1804.258) -- 0:00:55

      Average standard deviation of split frequencies: 0.015050

      425500 -- (-1810.091) (-1805.607) (-1806.688) [-1803.949] * (-1805.632) (-1810.168) (-1805.076) [-1805.849] -- 0:00:56
      426000 -- (-1807.868) (-1807.223) (-1808.510) [-1802.387] * (-1806.710) (-1804.627) (-1810.099) [-1805.063] -- 0:00:56
      426500 -- (-1804.014) [-1802.449] (-1810.253) (-1805.401) * (-1806.538) (-1805.106) (-1802.704) [-1808.881] -- 0:00:56
      427000 -- (-1804.484) (-1807.653) [-1805.937] (-1803.426) * (-1807.068) (-1806.963) [-1803.752] (-1803.337) -- 0:00:56
      427500 -- (-1804.671) (-1802.512) (-1805.081) [-1803.677] * (-1803.290) [-1808.169] (-1804.825) (-1804.097) -- 0:00:56
      428000 -- (-1803.227) (-1805.008) [-1803.066] (-1802.857) * (-1806.100) (-1807.395) [-1802.990] (-1803.911) -- 0:00:56
      428500 -- [-1806.684] (-1803.573) (-1804.888) (-1802.513) * (-1804.460) (-1809.706) [-1804.795] (-1803.593) -- 0:00:56
      429000 -- (-1803.413) [-1804.144] (-1804.238) (-1804.094) * (-1803.113) (-1804.682) [-1803.761] (-1805.142) -- 0:00:55
      429500 -- (-1807.853) (-1804.115) (-1806.528) [-1806.735] * (-1804.750) (-1804.247) [-1805.238] (-1804.764) -- 0:00:55
      430000 -- (-1806.114) (-1805.836) [-1804.767] (-1803.349) * (-1808.359) (-1804.281) [-1805.465] (-1803.488) -- 0:00:55

      Average standard deviation of split frequencies: 0.014886

      430500 -- [-1808.415] (-1806.046) (-1805.690) (-1802.921) * (-1809.639) [-1803.621] (-1804.270) (-1805.976) -- 0:00:55
      431000 -- (-1806.139) [-1804.168] (-1804.447) (-1803.092) * (-1807.906) (-1804.197) (-1804.883) [-1805.542] -- 0:00:55
      431500 -- (-1803.487) [-1806.289] (-1803.021) (-1803.238) * (-1804.364) (-1804.582) (-1804.772) [-1805.724] -- 0:00:55
      432000 -- (-1807.256) (-1804.953) (-1807.192) [-1803.050] * (-1803.580) [-1803.746] (-1804.616) (-1804.811) -- 0:00:55
      432500 -- [-1803.159] (-1803.960) (-1805.600) (-1803.594) * (-1803.987) [-1805.080] (-1806.496) (-1804.892) -- 0:00:55
      433000 -- [-1803.003] (-1803.738) (-1804.668) (-1804.096) * (-1803.514) [-1806.747] (-1806.451) (-1805.893) -- 0:00:54
      433500 -- [-1802.599] (-1803.558) (-1806.369) (-1802.759) * (-1805.400) (-1805.097) [-1804.944] (-1807.581) -- 0:00:54
      434000 -- (-1803.453) (-1803.797) (-1803.943) [-1804.659] * (-1805.924) [-1803.924] (-1805.147) (-1803.888) -- 0:00:54
      434500 -- (-1803.416) (-1810.254) [-1802.161] (-1803.961) * (-1803.761) [-1804.377] (-1808.838) (-1803.227) -- 0:00:54
      435000 -- (-1804.584) [-1805.758] (-1806.286) (-1805.730) * [-1804.262] (-1806.139) (-1806.224) (-1803.183) -- 0:00:54

      Average standard deviation of split frequencies: 0.014704

      435500 -- [-1805.999] (-1805.946) (-1803.503) (-1807.387) * [-1804.766] (-1803.417) (-1805.896) (-1804.109) -- 0:00:54
      436000 -- [-1803.929] (-1802.971) (-1803.363) (-1807.412) * (-1804.266) (-1804.711) (-1805.461) [-1803.741] -- 0:00:55
      436500 -- (-1805.484) (-1803.630) (-1804.018) [-1803.100] * (-1807.873) [-1805.442] (-1803.676) (-1805.155) -- 0:00:55
      437000 -- (-1806.345) (-1805.028) (-1804.701) [-1804.165] * (-1805.911) [-1804.612] (-1803.205) (-1805.215) -- 0:00:55
      437500 -- (-1803.947) (-1804.028) (-1804.317) [-1803.048] * (-1805.918) (-1803.475) (-1805.112) [-1805.535] -- 0:00:55
      438000 -- (-1805.603) (-1805.533) (-1808.425) [-1804.646] * [-1804.177] (-1805.227) (-1803.501) (-1804.073) -- 0:00:55
      438500 -- (-1805.161) (-1809.078) [-1804.991] (-1806.418) * (-1808.387) (-1803.326) (-1804.320) [-1802.679] -- 0:00:55
      439000 -- (-1804.498) (-1804.578) [-1809.545] (-1805.746) * (-1803.780) (-1804.401) (-1805.090) [-1802.814] -- 0:00:54
      439500 -- (-1804.340) (-1806.141) [-1807.474] (-1805.784) * (-1803.681) (-1807.138) (-1802.684) [-1802.650] -- 0:00:54
      440000 -- (-1807.376) (-1803.552) [-1804.592] (-1803.405) * (-1804.358) (-1806.944) [-1804.240] (-1803.402) -- 0:00:54

      Average standard deviation of split frequencies: 0.013479

      440500 -- (-1805.474) (-1803.575) [-1805.549] (-1803.926) * (-1804.553) (-1804.002) (-1803.669) [-1803.570] -- 0:00:54
      441000 -- [-1805.291] (-1806.013) (-1806.552) (-1805.673) * (-1806.489) [-1805.235] (-1805.016) (-1803.443) -- 0:00:54
      441500 -- [-1804.797] (-1803.729) (-1806.180) (-1804.352) * [-1804.428] (-1803.540) (-1806.826) (-1803.355) -- 0:00:54
      442000 -- (-1803.626) [-1803.241] (-1806.108) (-1805.160) * (-1806.599) (-1803.458) (-1803.990) [-1803.857] -- 0:00:54
      442500 -- (-1803.532) (-1803.791) [-1803.510] (-1804.157) * (-1803.547) (-1802.681) (-1805.914) [-1802.372] -- 0:00:54
      443000 -- [-1803.169] (-1804.371) (-1802.642) (-1804.016) * (-1803.581) [-1805.244] (-1807.634) (-1803.228) -- 0:00:54
      443500 -- (-1804.168) [-1803.898] (-1809.429) (-1808.164) * (-1807.462) (-1805.297) (-1805.786) [-1806.472] -- 0:00:53
      444000 -- (-1803.498) (-1803.202) [-1803.451] (-1803.855) * (-1806.435) (-1804.225) [-1805.180] (-1803.953) -- 0:00:53
      444500 -- (-1804.594) (-1803.950) (-1804.236) [-1804.297] * [-1804.291] (-1803.727) (-1805.016) (-1804.820) -- 0:00:53
      445000 -- [-1806.342] (-1804.823) (-1803.623) (-1803.232) * [-1805.591] (-1803.998) (-1804.020) (-1806.515) -- 0:00:53

      Average standard deviation of split frequencies: 0.013106

      445500 -- (-1805.952) (-1804.720) [-1803.141] (-1804.852) * [-1804.436] (-1809.568) (-1805.684) (-1805.703) -- 0:00:53
      446000 -- (-1805.406) [-1809.346] (-1807.186) (-1805.122) * (-1806.588) (-1803.677) [-1805.742] (-1802.797) -- 0:00:53
      446500 -- (-1804.637) [-1803.375] (-1803.148) (-1804.875) * (-1808.284) [-1804.785] (-1804.650) (-1803.847) -- 0:00:53
      447000 -- [-1803.548] (-1803.712) (-1803.428) (-1806.172) * (-1805.016) (-1803.830) (-1805.409) [-1804.342] -- 0:00:54
      447500 -- (-1807.109) [-1805.847] (-1802.889) (-1803.959) * (-1803.451) [-1804.456] (-1802.848) (-1803.536) -- 0:00:54
      448000 -- [-1804.978] (-1805.453) (-1803.721) (-1805.115) * (-1805.705) (-1805.096) [-1805.619] (-1803.929) -- 0:00:54
      448500 -- (-1803.915) (-1804.718) (-1806.036) [-1802.805] * (-1803.399) [-1805.063] (-1806.761) (-1803.565) -- 0:00:54
      449000 -- [-1802.902] (-1803.421) (-1804.837) (-1804.917) * [-1805.558] (-1805.131) (-1807.194) (-1805.218) -- 0:00:53
      449500 -- (-1803.141) (-1803.650) (-1803.859) [-1804.215] * (-1803.691) (-1805.872) [-1807.286] (-1804.635) -- 0:00:53
      450000 -- [-1803.433] (-1803.826) (-1805.288) (-1805.450) * (-1805.142) (-1803.691) (-1805.978) [-1805.532] -- 0:00:53

      Average standard deviation of split frequencies: 0.013389

      450500 -- (-1807.654) (-1804.294) [-1804.070] (-1805.589) * [-1807.291] (-1803.621) (-1804.531) (-1805.829) -- 0:00:53
      451000 -- (-1803.361) (-1804.155) [-1804.370] (-1803.439) * (-1804.794) (-1805.671) [-1803.989] (-1805.964) -- 0:00:53
      451500 -- (-1804.310) (-1805.014) [-1806.477] (-1803.948) * (-1803.107) (-1808.512) (-1803.442) [-1805.552] -- 0:00:53
      452000 -- (-1803.407) (-1803.206) (-1804.647) [-1804.552] * (-1803.232) (-1807.575) (-1807.932) [-1802.774] -- 0:00:53
      452500 -- (-1803.887) (-1804.237) (-1813.082) [-1803.352] * (-1803.585) (-1803.871) (-1807.120) [-1803.236] -- 0:00:53
      453000 -- [-1804.790] (-1803.951) (-1803.656) (-1803.742) * (-1803.409) (-1804.956) (-1814.238) [-1803.744] -- 0:00:53
      453500 -- [-1805.136] (-1805.990) (-1807.319) (-1804.337) * [-1805.604] (-1804.724) (-1805.301) (-1805.635) -- 0:00:53
      454000 -- (-1804.853) [-1806.684] (-1806.001) (-1803.359) * (-1804.848) (-1804.522) [-1805.132] (-1806.982) -- 0:00:52
      454500 -- (-1805.472) [-1806.928] (-1806.025) (-1803.029) * [-1805.971] (-1803.639) (-1804.517) (-1804.623) -- 0:00:52
      455000 -- (-1803.317) [-1808.448] (-1804.141) (-1803.660) * (-1806.836) (-1804.848) (-1804.421) [-1805.548] -- 0:00:52

      Average standard deviation of split frequencies: 0.013232

      455500 -- (-1803.244) (-1803.874) [-1802.893] (-1803.331) * (-1809.657) (-1803.790) (-1803.325) [-1803.622] -- 0:00:52
      456000 -- (-1804.867) (-1804.095) [-1803.357] (-1802.245) * [-1806.636] (-1804.978) (-1805.243) (-1804.653) -- 0:00:52
      456500 -- (-1809.000) (-1805.026) (-1804.435) [-1803.875] * (-1808.983) (-1804.856) [-1802.999] (-1806.428) -- 0:00:52
      457000 -- (-1810.065) (-1804.176) (-1805.618) [-1804.799] * (-1807.950) (-1803.905) (-1803.284) [-1802.769] -- 0:00:52
      457500 -- [-1806.975] (-1802.844) (-1804.951) (-1804.442) * (-1808.469) (-1804.470) [-1802.426] (-1805.381) -- 0:00:53
      458000 -- (-1806.486) (-1802.130) (-1804.480) [-1803.507] * (-1803.904) (-1806.818) [-1803.001] (-1807.185) -- 0:00:53
      458500 -- (-1808.241) (-1802.288) (-1805.114) [-1806.071] * (-1803.515) [-1803.924] (-1806.256) (-1813.315) -- 0:00:53
      459000 -- (-1806.621) [-1802.885] (-1805.734) (-1804.036) * [-1803.146] (-1807.058) (-1803.758) (-1810.012) -- 0:00:53
      459500 -- (-1804.559) (-1803.886) [-1805.940] (-1806.041) * (-1805.024) [-1804.642] (-1806.815) (-1803.194) -- 0:00:52
      460000 -- [-1803.835] (-1804.948) (-1805.478) (-1804.734) * (-1808.321) [-1805.929] (-1806.696) (-1802.643) -- 0:00:52

      Average standard deviation of split frequencies: 0.012484

      460500 -- (-1804.262) (-1805.791) [-1803.945] (-1802.117) * (-1805.070) (-1804.320) [-1805.114] (-1806.759) -- 0:00:52
      461000 -- (-1803.689) (-1804.373) (-1803.490) [-1803.978] * (-1806.048) [-1803.999] (-1806.997) (-1804.934) -- 0:00:52
      461500 -- [-1801.900] (-1811.997) (-1803.610) (-1805.282) * (-1804.891) (-1803.079) [-1804.668] (-1804.667) -- 0:00:52
      462000 -- (-1804.659) (-1807.493) [-1802.836] (-1810.408) * (-1803.370) (-1802.850) (-1808.822) [-1803.931] -- 0:00:52
      462500 -- (-1804.390) [-1802.706] (-1804.162) (-1806.325) * (-1803.884) [-1805.815] (-1802.636) (-1805.177) -- 0:00:52
      463000 -- (-1805.928) [-1805.428] (-1807.398) (-1803.077) * (-1804.902) [-1802.993] (-1803.309) (-1804.838) -- 0:00:52
      463500 -- [-1806.587] (-1804.283) (-1805.779) (-1811.146) * (-1805.193) (-1804.171) [-1805.349] (-1805.760) -- 0:00:52
      464000 -- (-1805.537) (-1804.296) (-1807.044) [-1804.684] * (-1803.294) [-1803.367] (-1803.846) (-1803.490) -- 0:00:51
      464500 -- (-1803.788) (-1805.216) [-1803.801] (-1805.930) * [-1804.449] (-1804.726) (-1803.535) (-1804.151) -- 0:00:51
      465000 -- [-1803.144] (-1807.644) (-1804.965) (-1805.618) * [-1804.482] (-1804.658) (-1805.576) (-1803.314) -- 0:00:51

      Average standard deviation of split frequencies: 0.012341

      465500 -- [-1804.075] (-1804.677) (-1804.476) (-1804.094) * [-1803.972] (-1805.818) (-1805.663) (-1803.366) -- 0:00:51
      466000 -- (-1803.160) [-1803.481] (-1806.842) (-1806.320) * (-1803.343) (-1803.931) (-1807.104) [-1803.384] -- 0:00:51
      466500 -- [-1804.613] (-1812.114) (-1803.294) (-1803.991) * (-1803.745) (-1803.787) (-1805.446) [-1804.866] -- 0:00:51
      467000 -- (-1804.371) (-1804.413) [-1803.915] (-1804.246) * (-1804.326) [-1804.128] (-1804.321) (-1802.822) -- 0:00:51
      467500 -- (-1805.262) [-1805.280] (-1808.608) (-1804.824) * [-1803.457] (-1803.283) (-1806.159) (-1804.199) -- 0:00:51
      468000 -- (-1802.458) [-1802.846] (-1803.975) (-1804.022) * [-1804.414] (-1805.301) (-1805.376) (-1803.871) -- 0:00:51
      468500 -- (-1805.379) (-1810.442) [-1805.202] (-1803.075) * [-1804.012] (-1804.504) (-1805.285) (-1805.322) -- 0:00:52
      469000 -- (-1806.491) [-1803.516] (-1805.008) (-1809.562) * (-1806.768) (-1806.907) [-1805.700] (-1803.717) -- 0:00:52
      469500 -- (-1809.419) (-1803.407) (-1805.389) [-1803.897] * (-1803.188) (-1803.038) [-1805.239] (-1804.710) -- 0:00:51
      470000 -- (-1805.586) (-1802.218) (-1806.467) [-1803.345] * [-1804.092] (-1805.366) (-1803.376) (-1809.916) -- 0:00:51

      Average standard deviation of split frequencies: 0.012620

      470500 -- [-1802.897] (-1808.593) (-1805.913) (-1806.298) * [-1805.280] (-1808.375) (-1803.914) (-1806.745) -- 0:00:51
      471000 -- (-1802.520) (-1806.791) [-1806.393] (-1804.680) * (-1802.908) (-1804.988) (-1806.589) [-1805.931] -- 0:00:51
      471500 -- (-1807.049) (-1804.747) [-1806.776] (-1805.125) * (-1804.106) (-1804.164) [-1804.227] (-1807.548) -- 0:00:51
      472000 -- (-1805.966) (-1804.474) [-1803.855] (-1804.657) * (-1803.300) (-1804.907) [-1803.110] (-1803.557) -- 0:00:51
      472500 -- (-1802.843) [-1804.506] (-1805.418) (-1809.469) * [-1802.929] (-1805.242) (-1803.198) (-1803.426) -- 0:00:51
      473000 -- [-1806.514] (-1802.848) (-1806.747) (-1803.319) * (-1806.858) [-1805.979] (-1804.351) (-1805.079) -- 0:00:51
      473500 -- (-1809.832) [-1804.209] (-1806.189) (-1803.585) * (-1804.163) (-1805.015) [-1802.683] (-1807.382) -- 0:00:51
      474000 -- (-1803.940) (-1804.071) (-1803.318) [-1803.683] * (-1806.798) [-1805.468] (-1805.765) (-1806.937) -- 0:00:51
      474500 -- [-1803.666] (-1803.968) (-1802.583) (-1807.053) * (-1806.388) (-1802.893) [-1808.276] (-1802.938) -- 0:00:50
      475000 -- (-1804.873) [-1803.795] (-1803.647) (-1803.454) * (-1804.423) (-1803.219) [-1805.285] (-1803.231) -- 0:00:50

      Average standard deviation of split frequencies: 0.011884

      475500 -- (-1805.219) (-1805.894) [-1802.992] (-1803.158) * (-1804.484) [-1807.357] (-1804.509) (-1806.212) -- 0:00:50
      476000 -- (-1805.462) [-1805.136] (-1802.737) (-1802.731) * (-1802.873) [-1803.591] (-1805.324) (-1805.597) -- 0:00:50
      476500 -- (-1803.224) (-1804.079) [-1802.484] (-1803.400) * (-1804.482) (-1803.216) [-1806.524] (-1804.859) -- 0:00:50
      477000 -- (-1806.508) [-1803.578] (-1804.780) (-1803.001) * [-1805.724] (-1802.944) (-1804.715) (-1805.246) -- 0:00:50
      477500 -- (-1808.239) (-1803.280) (-1805.923) [-1803.161] * (-1806.187) (-1804.835) (-1803.141) [-1804.485] -- 0:00:50
      478000 -- (-1808.045) (-1803.470) [-1807.540] (-1804.631) * (-1804.982) (-1804.291) (-1803.310) [-1805.760] -- 0:00:50
      478500 -- (-1806.761) (-1805.306) (-1802.927) [-1808.285] * (-1804.130) [-1805.845] (-1806.131) (-1805.510) -- 0:00:50
      479000 -- (-1806.355) (-1805.986) [-1802.656] (-1803.735) * (-1803.867) (-1803.752) (-1809.220) [-1805.282] -- 0:00:50
      479500 -- (-1805.562) (-1806.342) [-1804.134] (-1804.364) * [-1802.610] (-1803.751) (-1804.726) (-1805.692) -- 0:00:51
      480000 -- (-1805.866) [-1805.005] (-1805.364) (-1804.122) * (-1807.263) (-1803.334) (-1804.888) [-1803.762] -- 0:00:50

      Average standard deviation of split frequencies: 0.010200

      480500 -- (-1805.952) [-1803.298] (-1811.043) (-1803.161) * (-1809.438) [-1803.825] (-1803.434) (-1804.948) -- 0:00:50
      481000 -- (-1805.542) (-1803.137) (-1805.397) [-1802.718] * (-1807.430) [-1807.717] (-1804.888) (-1809.525) -- 0:00:50
      481500 -- (-1804.168) (-1802.546) (-1807.568) [-1802.781] * (-1803.982) (-1804.191) [-1803.912] (-1810.395) -- 0:00:50
      482000 -- (-1805.184) (-1805.973) (-1806.613) [-1804.238] * [-1805.705] (-1805.080) (-1804.022) (-1805.908) -- 0:00:50
      482500 -- [-1805.001] (-1807.002) (-1804.647) (-1803.453) * (-1806.295) (-1804.758) [-1805.421] (-1804.175) -- 0:00:50
      483000 -- (-1805.141) (-1805.038) (-1805.367) [-1804.564] * (-1805.397) (-1803.639) [-1804.987] (-1805.233) -- 0:00:50
      483500 -- [-1804.923] (-1805.795) (-1805.721) (-1805.364) * (-1803.766) [-1803.497] (-1802.525) (-1808.765) -- 0:00:50
      484000 -- (-1805.210) (-1803.150) (-1803.269) [-1804.353] * (-1805.068) [-1803.436] (-1804.314) (-1808.601) -- 0:00:50
      484500 -- (-1805.449) [-1807.445] (-1806.163) (-1804.271) * (-1803.918) (-1804.200) [-1805.098] (-1807.676) -- 0:00:50
      485000 -- (-1802.871) (-1806.651) [-1806.149] (-1803.666) * (-1805.044) (-1807.482) (-1804.673) [-1811.714] -- 0:00:49

      Average standard deviation of split frequencies: 0.010282

      485500 -- [-1803.205] (-1804.094) (-1806.628) (-1804.290) * [-1808.631] (-1803.780) (-1803.193) (-1804.443) -- 0:00:49
      486000 -- [-1804.465] (-1804.359) (-1804.623) (-1803.355) * [-1804.883] (-1803.381) (-1805.729) (-1806.941) -- 0:00:49
      486500 -- [-1804.204] (-1807.638) (-1805.357) (-1804.208) * (-1804.185) (-1803.386) (-1804.417) [-1803.191] -- 0:00:49
      487000 -- (-1803.564) [-1807.564] (-1804.170) (-1802.546) * (-1804.173) [-1807.214] (-1804.102) (-1804.284) -- 0:00:49
      487500 -- (-1802.253) (-1804.559) (-1804.992) [-1803.028] * (-1804.748) [-1806.419] (-1805.846) (-1803.938) -- 0:00:49
      488000 -- (-1806.264) (-1803.917) [-1806.130] (-1803.847) * (-1808.014) [-1804.012] (-1803.452) (-1804.107) -- 0:00:49
      488500 -- (-1805.430) [-1803.015] (-1804.123) (-1803.080) * [-1806.811] (-1813.643) (-1804.959) (-1806.281) -- 0:00:49
      489000 -- (-1807.836) (-1806.177) (-1803.906) [-1803.901] * [-1805.227] (-1807.703) (-1803.743) (-1804.234) -- 0:00:49
      489500 -- [-1806.266] (-1808.761) (-1806.376) (-1803.802) * (-1806.489) [-1808.072] (-1803.323) (-1806.780) -- 0:00:49
      490000 -- (-1805.988) (-1807.187) (-1804.266) [-1803.688] * (-1808.798) (-1806.955) [-1803.543] (-1804.194) -- 0:00:49

      Average standard deviation of split frequencies: 0.010952

      490500 -- (-1802.922) [-1809.980] (-1805.589) (-1802.526) * (-1808.312) (-1809.918) [-1803.812] (-1804.151) -- 0:00:49
      491000 -- (-1805.047) (-1805.059) [-1804.231] (-1803.410) * (-1804.710) [-1806.964] (-1803.643) (-1803.480) -- 0:00:49
      491500 -- [-1806.533] (-1803.495) (-1804.025) (-1806.020) * [-1802.022] (-1805.747) (-1803.599) (-1808.099) -- 0:00:49
      492000 -- [-1804.760] (-1805.281) (-1803.121) (-1804.230) * (-1802.621) (-1805.747) [-1803.317] (-1802.457) -- 0:00:49
      492500 -- [-1803.952] (-1804.345) (-1804.042) (-1803.395) * (-1804.262) (-1804.416) [-1806.747] (-1804.266) -- 0:00:49
      493000 -- (-1805.300) (-1803.234) (-1804.526) [-1806.208] * (-1805.021) (-1808.469) (-1807.519) [-1805.499] -- 0:00:49
      493500 -- [-1804.730] (-1803.527) (-1803.509) (-1805.702) * (-1806.499) [-1803.686] (-1808.046) (-1803.879) -- 0:00:49
      494000 -- [-1805.969] (-1803.250) (-1804.341) (-1804.477) * (-1804.158) (-1803.642) (-1807.031) [-1805.568] -- 0:00:49
      494500 -- (-1803.976) (-1805.697) (-1804.335) [-1810.960] * [-1805.424] (-1810.244) (-1806.964) (-1803.378) -- 0:00:49
      495000 -- [-1808.294] (-1804.512) (-1803.349) (-1805.169) * (-1806.120) [-1802.978] (-1804.427) (-1804.311) -- 0:00:48

      Average standard deviation of split frequencies: 0.010455

      495500 -- (-1802.824) (-1804.493) (-1805.048) [-1803.883] * (-1804.042) (-1803.485) (-1804.173) [-1804.703] -- 0:00:48
      496000 -- (-1803.404) (-1804.720) [-1806.735] (-1803.642) * (-1806.273) (-1805.051) (-1803.526) [-1804.639] -- 0:00:48
      496500 -- [-1803.144] (-1806.684) (-1804.554) (-1804.744) * (-1806.692) [-1803.895] (-1805.807) (-1804.735) -- 0:00:48
      497000 -- [-1802.349] (-1803.060) (-1803.798) (-1804.210) * (-1802.703) (-1805.436) [-1806.393] (-1803.982) -- 0:00:48
      497500 -- [-1804.094] (-1803.269) (-1805.512) (-1803.358) * [-1804.553] (-1805.029) (-1804.236) (-1804.439) -- 0:00:48
      498000 -- [-1803.987] (-1803.142) (-1804.262) (-1810.952) * (-1805.725) (-1803.697) (-1805.420) [-1804.074] -- 0:00:48
      498500 -- (-1805.477) [-1805.101] (-1808.107) (-1803.647) * (-1803.949) (-1803.034) (-1805.322) [-1805.607] -- 0:00:48
      499000 -- [-1804.556] (-1805.749) (-1807.605) (-1803.106) * (-1803.259) (-1806.638) (-1803.354) [-1805.607] -- 0:00:48
      499500 -- [-1803.015] (-1803.726) (-1807.643) (-1803.834) * (-1803.058) (-1806.569) [-1803.478] (-1803.905) -- 0:00:48
      500000 -- (-1806.763) (-1805.461) [-1803.368] (-1809.862) * [-1803.803] (-1803.680) (-1806.737) (-1806.718) -- 0:00:48

      Average standard deviation of split frequencies: 0.009792

      500500 -- (-1810.340) (-1803.031) [-1803.346] (-1803.077) * (-1805.430) [-1804.034] (-1810.554) (-1806.467) -- 0:00:47
      501000 -- (-1803.615) (-1807.946) (-1805.076) [-1805.081] * (-1804.453) [-1804.021] (-1803.320) (-1803.857) -- 0:00:48
      501500 -- (-1804.654) (-1807.350) [-1806.493] (-1805.094) * [-1805.181] (-1802.931) (-1803.110) (-1803.780) -- 0:00:48
      502000 -- (-1803.199) [-1803.862] (-1805.116) (-1803.614) * (-1803.169) (-1810.303) [-1804.292] (-1804.004) -- 0:00:48
      502500 -- (-1805.564) (-1806.606) [-1803.621] (-1807.166) * (-1803.438) (-1804.309) (-1805.557) [-1806.664] -- 0:00:48
      503000 -- (-1805.945) [-1804.726] (-1805.667) (-1806.896) * (-1806.988) (-1807.689) (-1805.046) [-1803.665] -- 0:00:48
      503500 -- (-1805.823) (-1805.041) (-1805.387) [-1804.069] * (-1806.281) (-1807.962) (-1804.243) [-1805.178] -- 0:00:48
      504000 -- [-1803.325] (-1803.732) (-1805.359) (-1803.440) * (-1806.132) (-1803.796) [-1804.556] (-1804.602) -- 0:00:48
      504500 -- (-1803.519) (-1802.874) (-1809.495) [-1804.846] * [-1804.321] (-1805.519) (-1806.256) (-1809.783) -- 0:00:48
      505000 -- (-1803.749) [-1805.250] (-1805.592) (-1803.439) * (-1805.482) (-1803.786) (-1807.197) [-1803.632] -- 0:00:48

      Average standard deviation of split frequencies: 0.009875

      505500 -- (-1804.060) (-1804.892) [-1804.805] (-1803.328) * (-1802.857) (-1803.806) (-1803.709) [-1804.721] -- 0:00:47
      506000 -- (-1804.042) [-1804.899] (-1803.396) (-1802.790) * (-1803.513) [-1803.166] (-1805.670) (-1804.234) -- 0:00:47
      506500 -- (-1806.996) (-1804.376) (-1806.672) [-1805.052] * (-1804.224) [-1802.527] (-1804.424) (-1805.283) -- 0:00:47
      507000 -- (-1805.114) (-1803.174) [-1804.315] (-1805.537) * (-1803.469) (-1802.447) (-1804.846) [-1806.637] -- 0:00:47
      507500 -- [-1804.199] (-1803.242) (-1805.132) (-1810.598) * (-1804.898) (-1803.503) (-1803.970) [-1802.237] -- 0:00:47
      508000 -- (-1805.526) (-1803.454) (-1804.517) [-1811.358] * (-1802.803) (-1804.968) [-1804.159] (-1803.906) -- 0:00:47
      508500 -- [-1803.105] (-1804.672) (-1803.369) (-1805.136) * (-1803.578) (-1804.964) [-1805.291] (-1803.468) -- 0:00:47
      509000 -- (-1803.467) (-1803.935) (-1804.971) [-1804.571] * (-1806.057) (-1802.554) (-1805.448) [-1804.790] -- 0:00:47
      509500 -- [-1803.339] (-1804.800) (-1802.969) (-1804.508) * (-1803.625) [-1803.027] (-1803.580) (-1803.110) -- 0:00:47
      510000 -- [-1805.731] (-1802.759) (-1807.646) (-1804.588) * (-1805.562) (-1804.480) (-1805.295) [-1803.106] -- 0:00:47

      Average standard deviation of split frequencies: 0.010339

      510500 -- (-1807.145) [-1805.417] (-1804.964) (-1809.498) * [-1804.885] (-1805.615) (-1803.793) (-1802.985) -- 0:00:46
      511000 -- (-1808.450) [-1804.994] (-1804.380) (-1805.603) * [-1804.471] (-1810.101) (-1811.045) (-1803.954) -- 0:00:46
      511500 -- (-1805.630) [-1804.224] (-1803.167) (-1805.298) * (-1805.019) [-1806.036] (-1806.273) (-1803.344) -- 0:00:47
      512000 -- (-1804.618) [-1806.844] (-1803.509) (-1809.908) * (-1804.358) [-1803.258] (-1804.638) (-1803.013) -- 0:00:47
      512500 -- (-1805.444) [-1804.069] (-1803.375) (-1808.259) * (-1804.335) (-1807.024) [-1806.109] (-1804.262) -- 0:00:47
      513000 -- (-1804.226) (-1804.759) [-1803.925] (-1806.126) * (-1806.169) [-1804.616] (-1804.995) (-1803.531) -- 0:00:47
      513500 -- (-1802.347) [-1804.572] (-1805.761) (-1806.268) * (-1807.675) (-1807.235) [-1802.981] (-1807.769) -- 0:00:47
      514000 -- (-1803.019) (-1807.598) (-1803.761) [-1802.493] * (-1802.593) [-1806.637] (-1810.910) (-1806.201) -- 0:00:47
      514500 -- (-1804.462) (-1803.166) [-1805.004] (-1804.194) * [-1802.849] (-1805.448) (-1806.693) (-1809.484) -- 0:00:47
      515000 -- (-1805.959) [-1803.952] (-1806.216) (-1805.451) * [-1802.629] (-1803.371) (-1804.490) (-1808.107) -- 0:00:47

      Average standard deviation of split frequencies: 0.010049

      515500 -- (-1806.183) (-1803.138) [-1808.938] (-1807.628) * (-1801.908) (-1803.332) (-1805.311) [-1802.604] -- 0:00:46
      516000 -- [-1804.218] (-1808.623) (-1802.916) (-1807.110) * [-1802.701] (-1805.090) (-1806.358) (-1803.826) -- 0:00:46
      516500 -- (-1803.271) [-1806.486] (-1802.396) (-1811.845) * (-1804.845) [-1803.050] (-1805.407) (-1804.313) -- 0:00:46
      517000 -- [-1804.996] (-1803.305) (-1803.262) (-1806.066) * (-1810.161) (-1805.272) [-1805.257] (-1803.552) -- 0:00:46
      517500 -- (-1804.516) [-1805.185] (-1804.196) (-1807.958) * [-1804.124] (-1805.042) (-1806.890) (-1804.955) -- 0:00:46
      518000 -- [-1805.082] (-1802.603) (-1804.841) (-1804.388) * [-1804.747] (-1803.388) (-1803.129) (-1806.278) -- 0:00:46
      518500 -- (-1805.390) (-1802.855) [-1804.408] (-1810.635) * (-1804.560) (-1803.181) (-1805.083) [-1804.437] -- 0:00:46
      519000 -- (-1804.645) [-1805.582] (-1803.350) (-1808.466) * (-1803.437) (-1805.046) [-1804.981] (-1805.883) -- 0:00:46
      519500 -- (-1807.047) (-1804.170) (-1808.813) [-1805.054] * [-1804.443] (-1804.030) (-1805.115) (-1806.243) -- 0:00:46
      520000 -- (-1803.594) (-1803.877) [-1807.005] (-1804.271) * (-1803.614) (-1806.819) (-1803.145) [-1805.366] -- 0:00:46

      Average standard deviation of split frequencies: 0.008692

      520500 -- (-1805.778) (-1804.497) (-1803.728) [-1804.366] * (-1804.132) (-1803.271) (-1803.847) [-1804.291] -- 0:00:46
      521000 -- (-1805.469) (-1804.985) [-1807.426] (-1806.529) * (-1809.030) (-1802.544) (-1803.087) [-1805.470] -- 0:00:45
      521500 -- [-1803.307] (-1810.291) (-1804.411) (-1808.799) * (-1805.308) [-1804.163] (-1803.300) (-1806.794) -- 0:00:45
      522000 -- [-1802.604] (-1806.240) (-1804.411) (-1804.330) * (-1804.953) (-1803.258) (-1803.723) [-1803.716] -- 0:00:45
      522500 -- [-1804.996] (-1804.495) (-1806.111) (-1803.326) * [-1804.621] (-1803.974) (-1807.766) (-1803.976) -- 0:00:46
      523000 -- [-1803.677] (-1803.999) (-1805.491) (-1802.856) * (-1807.003) (-1807.715) [-1805.367] (-1803.986) -- 0:00:46
      523500 -- (-1804.169) (-1804.488) [-1805.192] (-1803.463) * (-1803.237) [-1805.257] (-1804.720) (-1803.067) -- 0:00:46
      524000 -- [-1804.497] (-1802.934) (-1803.252) (-1803.724) * (-1803.581) (-1807.378) (-1803.305) [-1803.863] -- 0:00:46
      524500 -- [-1803.275] (-1807.725) (-1804.628) (-1807.242) * [-1804.227] (-1806.423) (-1806.082) (-1805.412) -- 0:00:46
      525000 -- [-1806.473] (-1809.502) (-1806.691) (-1803.977) * (-1803.076) (-1803.813) (-1807.458) [-1806.573] -- 0:00:46

      Average standard deviation of split frequencies: 0.008783

      525500 -- [-1807.277] (-1805.508) (-1805.537) (-1806.673) * (-1803.925) (-1802.763) [-1803.422] (-1802.384) -- 0:00:46
      526000 -- [-1806.424] (-1806.362) (-1804.394) (-1804.572) * [-1802.643] (-1803.632) (-1805.134) (-1802.512) -- 0:00:45
      526500 -- [-1804.559] (-1803.801) (-1805.641) (-1805.343) * (-1803.436) (-1803.216) [-1803.780] (-1806.260) -- 0:00:45
      527000 -- (-1805.382) [-1803.529] (-1806.713) (-1806.872) * [-1803.887] (-1803.823) (-1803.537) (-1804.812) -- 0:00:45
      527500 -- [-1803.108] (-1803.175) (-1808.024) (-1804.910) * (-1804.678) (-1803.541) (-1803.882) [-1805.761] -- 0:00:45
      528000 -- [-1803.085] (-1803.356) (-1805.950) (-1806.330) * (-1805.059) [-1802.968] (-1805.705) (-1806.754) -- 0:00:45
      528500 -- (-1803.195) (-1804.699) [-1808.396] (-1804.728) * (-1805.478) [-1803.538] (-1805.364) (-1803.144) -- 0:00:45
      529000 -- [-1805.595] (-1803.528) (-1805.690) (-1804.548) * (-1804.072) (-1802.739) (-1805.334) [-1805.440] -- 0:00:45
      529500 -- (-1806.147) (-1803.761) (-1803.792) [-1806.068] * (-1804.801) (-1804.725) [-1805.402] (-1804.160) -- 0:00:45
      530000 -- [-1806.802] (-1803.767) (-1804.856) (-1803.272) * (-1802.492) (-1802.586) (-1805.414) [-1803.911] -- 0:00:45

      Average standard deviation of split frequencies: 0.008706

      530500 -- (-1803.804) [-1803.177] (-1804.463) (-1803.726) * (-1804.655) (-1805.962) [-1804.959] (-1804.085) -- 0:00:45
      531000 -- [-1805.514] (-1804.484) (-1806.527) (-1803.999) * [-1806.693] (-1804.007) (-1805.658) (-1803.909) -- 0:00:45
      531500 -- (-1805.026) (-1802.961) [-1803.357] (-1804.160) * (-1803.233) [-1803.939] (-1807.457) (-1808.243) -- 0:00:44
      532000 -- (-1807.680) [-1806.623] (-1803.106) (-1804.599) * (-1805.280) [-1804.178] (-1802.532) (-1806.802) -- 0:00:44
      532500 -- (-1804.479) (-1807.469) (-1804.120) [-1804.824] * (-1803.801) (-1804.576) (-1804.842) [-1804.153] -- 0:00:44
      533000 -- [-1804.707] (-1805.784) (-1803.710) (-1804.820) * [-1804.337] (-1802.875) (-1804.604) (-1804.380) -- 0:00:44
      533500 -- (-1808.050) (-1803.464) [-1805.382] (-1804.673) * (-1806.718) (-1803.535) (-1803.488) [-1805.221] -- 0:00:45
      534000 -- [-1804.796] (-1805.289) (-1803.901) (-1804.232) * (-1803.327) (-1804.797) [-1804.378] (-1805.683) -- 0:00:45
      534500 -- [-1806.502] (-1805.293) (-1806.226) (-1810.309) * (-1803.928) (-1806.048) [-1802.673] (-1805.486) -- 0:00:45
      535000 -- [-1808.377] (-1805.017) (-1805.126) (-1802.851) * (-1803.507) (-1805.607) (-1802.346) [-1806.393] -- 0:00:45

      Average standard deviation of split frequencies: 0.009498

      535500 -- (-1807.881) (-1804.198) (-1809.940) [-1804.186] * [-1805.800] (-1811.790) (-1803.762) (-1808.438) -- 0:00:45
      536000 -- (-1808.148) (-1803.816) (-1805.741) [-1804.523] * [-1805.084] (-1804.243) (-1803.448) (-1803.954) -- 0:00:45
      536500 -- (-1810.709) [-1805.065] (-1805.738) (-1803.036) * (-1804.279) (-1802.615) (-1803.852) [-1803.677] -- 0:00:44
      537000 -- (-1806.662) [-1802.837] (-1807.246) (-1803.725) * (-1802.738) (-1805.506) [-1805.401] (-1806.100) -- 0:00:44
      537500 -- (-1804.097) (-1804.460) (-1806.782) [-1803.093] * [-1804.659] (-1805.357) (-1803.642) (-1808.839) -- 0:00:44
      538000 -- (-1802.965) (-1803.983) (-1804.342) [-1804.460] * [-1804.061] (-1806.743) (-1806.429) (-1805.554) -- 0:00:44
      538500 -- (-1805.563) (-1806.221) (-1805.039) [-1803.539] * (-1802.473) (-1806.042) (-1809.638) [-1803.543] -- 0:00:44
      539000 -- (-1806.396) (-1802.925) [-1804.483] (-1804.935) * (-1803.098) [-1804.955] (-1806.711) (-1805.052) -- 0:00:44
      539500 -- (-1802.897) (-1805.584) (-1805.418) [-1803.835] * (-1804.815) (-1806.795) (-1804.988) [-1808.670] -- 0:00:44
      540000 -- [-1804.006] (-1805.015) (-1803.681) (-1803.598) * (-1809.299) (-1803.586) (-1807.436) [-1805.708] -- 0:00:44

      Average standard deviation of split frequencies: 0.009242

      540500 -- (-1807.337) [-1808.129] (-1805.951) (-1803.567) * (-1805.080) [-1803.378] (-1803.239) (-1803.997) -- 0:00:44
      541000 -- (-1804.132) (-1807.059) [-1804.335] (-1802.810) * (-1807.892) (-1804.133) (-1804.126) [-1803.132] -- 0:00:44
      541500 -- (-1804.183) [-1803.144] (-1803.053) (-1803.048) * (-1805.233) (-1805.057) [-1804.627] (-1802.737) -- 0:00:44
      542000 -- (-1803.608) (-1804.187) [-1804.558] (-1803.332) * [-1807.248] (-1804.617) (-1802.784) (-1802.880) -- 0:00:43
      542500 -- (-1803.091) [-1804.493] (-1802.430) (-1805.032) * (-1804.934) [-1802.555] (-1805.431) (-1806.200) -- 0:00:43
      543000 -- (-1803.861) [-1803.211] (-1806.264) (-1804.361) * [-1807.101] (-1803.565) (-1805.249) (-1803.252) -- 0:00:43
      543500 -- (-1804.569) (-1803.941) [-1804.318] (-1806.297) * (-1809.099) [-1804