--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:49:01 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/3res/ML0128/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1784.94 -1787.60 2 -1784.95 -1787.98 -------------------------------------- TOTAL -1784.94 -1787.80 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.494287 0.049862 0.131844 0.935211 0.460204 1501.00 1501.00 1.000 r(A<->C){all} 0.159001 0.018517 0.000066 0.433950 0.118064 261.03 295.76 1.000 r(A<->G){all} 0.168946 0.020187 0.000015 0.466688 0.133184 270.01 323.79 1.000 r(A<->T){all} 0.158582 0.018801 0.000065 0.425329 0.121141 310.80 315.74 1.001 r(C<->G){all} 0.174168 0.022577 0.000014 0.488210 0.133543 199.65 270.66 1.002 r(C<->T){all} 0.172092 0.020217 0.000151 0.453473 0.134693 251.69 348.50 1.000 r(G<->T){all} 0.167210 0.021133 0.000086 0.466848 0.128537 225.47 317.13 1.002 pi(A){all} 0.183980 0.000113 0.163567 0.204729 0.184049 1401.14 1451.07 1.000 pi(C){all} 0.291160 0.000162 0.265765 0.315586 0.291244 1288.57 1316.11 1.000 pi(G){all} 0.303379 0.000160 0.279579 0.329094 0.303129 1304.19 1393.91 1.000 pi(T){all} 0.221481 0.000133 0.200080 0.245063 0.221466 1027.19 1235.02 1.000 alpha{1,2} 0.435489 0.247454 0.000203 1.423218 0.256334 993.53 1075.92 1.000 alpha{3} 0.469055 0.247170 0.000102 1.457918 0.302516 1368.37 1384.48 1.001 pinvar{all} 0.998733 0.000002 0.995953 0.999999 0.999220 1288.19 1383.35 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -872.199058 Model 2: PositiveSelection -872.199058 Model 0: one-ratio -872.199056 Model 7: beta -872.199058 Model 8: beta&w>1 -872.199058 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT >C2 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT >C3 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV LHTVSQNPPPTSLARQNETTTooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooooooooooooooooooooooooooooooooo >C4 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=649 C1 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR C2 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR C3 -------------------------------------------------- C4 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR C1 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR C2 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR C3 -------------------------------------------------- C4 YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR C1 KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR C2 KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR C3 -------------------------------------------------- C4 KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR C1 RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL C2 RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL C3 -------------------------------------------------- C4 RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL C1 GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW C2 GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW C3 --------------LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW C4 GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW ************************************ C1 DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV C2 DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV C3 DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV C4 DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV ************************************************** C1 PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ C2 PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ C3 PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ C4 PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ ************************************************** C1 HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL C2 HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL C3 HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL C4 HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ************************************************** C1 ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT--------------- C2 ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT--------------- C3 ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTTooooooooooooooo C4 ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT--------------- *********************************** C1 -------------------------------------------------- C2 -------------------------------------------------- C3 oooooooooooooooooooooooooooooooooooooooooooooooooo C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 oooooooooooooooooooooooooooooooooooooooooooooooooo C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 oooooooooooooooooooooooooooooooooooooooooooooooooo C4 -------------------------------------------------- C1 ------------------------------------------------- C2 ------------------------------------------------- C3 ooooooooooooooooooooooooooooooooooooooooooooooooo C4 ------------------------------------------------- PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 4 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 435 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 435 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [13050] Library Relaxation: Multi_proc [96] Relaxation Summary: [13050]--->[7542] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.440 Mb, Max= 30.888 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL C2 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL C3 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL C4 LYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWWDSLPTDRPIVYATL ************************************************** C1 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA C2 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA C3 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA C4 GTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNVPANAFVADYLPGEA ************************************************** C1 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI C2 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI C3 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI C4 AAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQHLNMEAVEAAGAGI ************************************************** C1 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV C2 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV C3 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV C4 LLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVLERHVAGLPQHMENV ************************************************** C1 LHTVSQNPPPTSLARQNETTT C2 LHTVSQNPPPTSLARQNETTT C3 LHTVSQNPPPTSLARQNETTT C4 LHTVSQNPPPTSLARQNETTT ********************* FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:71 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG C2 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG C3 -------------------------------------------------- C4 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG C1 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT C2 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT C3 -------------------------------------------------- C4 CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT C1 CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG C2 CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG C3 -------------------------------------------------- C4 CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG C1 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC C2 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC C3 -------------------------------------------------- C4 TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC C1 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC C2 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC C3 -------------------------------------------------- C4 GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC C1 TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG C2 TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG C3 -------------------------------------------------- C4 TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG C1 AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT C2 AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT C3 -------------------------------------------------- C4 AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT C1 CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA C2 CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA C3 -------------------------------------------------- C4 CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA C1 GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC C2 GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC C3 -------------------------------------------------- C4 GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC C1 CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG C2 CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG C3 -------------------------------------------------- C4 CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG C1 GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT C2 GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT C3 -------------------------------------------------- C4 GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT C1 ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG C2 ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG C3 -------------------------------------------------- C4 ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG C1 GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC C2 GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC C3 ------------------------------------------CTTTATGC C4 GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC ******** C1 CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT C2 CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT C3 CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT C4 CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT ************************************************** C1 ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG C2 ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG C3 ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG C4 ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG ************************************************** C1 GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC C2 GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC C3 GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC C4 GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC ************************************************** C1 CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC C2 CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC C3 CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC C4 CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC ************************************************** C1 CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT C2 CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT C3 CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT C4 CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT ************************************************** C1 CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC C2 CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC C3 CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC C4 CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC ************************************************** C1 ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG C2 ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG C3 ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG C4 ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG ************************************************** C1 CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA C2 CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA C3 CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA C4 CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA ************************************************** C1 CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG C2 CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG C3 CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG C4 CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG ************************************************** C1 AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC C2 AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC C3 AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC C4 AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC ************************************************** C1 TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG C2 TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG C3 TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG C4 TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG ************************************************** C1 GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC C2 GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC C3 GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC C4 GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC ************************************************** C1 CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA C2 CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA C3 CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA C4 CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA ************************************************** C1 CGACC--------------------------------------------- C2 CGACC--------------------------------------------- C3 CGACC--------------------------------------------- C4 CGACC--------------------------------------------- ***** C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 -------------------------------------------------- C2 -------------------------------------------------- C3 -------------------------------------------------- C4 -------------------------------------------------- C1 ----------------------------------------------- C2 ----------------------------------------------- C3 ----------------------------------------------- C4 ----------------------------------------------- >C1 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA CGACC--------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ----------------------------------------------- >C2 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA CGACC--------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ----------------------------------------------- >C3 -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ------------------------------------------CTTTATGC CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA CGACC--------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ----------------------------------------------- >C4 GTGGGAAAGGATGCCGGTATGAGCACGGCACCGGATACTGTACCCGAGTG CCAGTCCCGTAGGATGCGGATCCTCTTTATCGCGGAAGCAGTTACCCTGT CCACCGTTGTGCGGCCGTTTGCCGTGGCGCGCTTGCTTGACCCAAGCCGG TATGAGGTGCACTTCGCCTGCGATCCACGGTACAACAACCTGTTGGGTCC GTTGCCTTTCCCTCACCACCCGATCCACACCGTCCCCAGTGAGTGGGTTC TCACCAGGATCGCTCAGGGCCGACTTTTCTATACTACCCGGACGCTGCGG AAGTACGTCGAGGAGGACAGCAAATTGCTGTCCGAGATCGAACCGGACCT CGTGGTCGGTGACGCTCGCTGGTCGCTGTCCGTTAGCGCCCGACTAGCAA GTATTCCCTATATTGCAATCGCCAATGCCTACTGGAGTTCCCACGCCCGC CGCCGATTGCCGCTGCCGGACGTGCTGTGGACCCGGATCCTGGGTGTTAG GCTGGTGAACATCTTATTCAGGCTATACAGCCCATTGATCTTCGCTATCT ATTGTTTGCCGCTCAACTGGGTCCGCCGCAAGCACGGGTTGCCGAGCCTG GGTTCAAATATTGGTTGCATTTACACCGATGGTGATTACACGCTTTATGC CGACGTGCCCGAATTGGTGCCGACGTACGATCTGCCGGCCAACCATCAGT ATCTCGGACCTGTTCTTTGGTCGCCTGCTGGAGAGTTGCCGAGATGGTGG GATTCGCTGCCAACCGACCGGCCGATCGTCTATGCAACGTTAGGCACTTC CGGTGGTAAGAATCTGTTGCAGGTGGTGTTGGATGCCTTAGCTGACTTGC CGGTGACGGTGATCGCTGCCACCGCTGGTCGCAGTGAGCTGCAGAATGTT CCCGCCAACGCCTTCGTGGCGGATTACTTGCCAGGCGAGGCTGCCGCAGC ACGCTCTGCTGTGGTGATATGCAACGGTGGTAGTTTGACGACGCAGCAGG CCTTCGTAGCCGGGGTGCCGGTGGTCGGGATCGCCGGTAACCTGGACCAA CACCTGAATATGGAAGCCGTTGAGGCGGCCGGCGCAGGTATCTTGCTGCG AAGTGAGCGGCTCAAGGTCCGGCGGGTGGCGGACGCGGTAAATCGGGTGC TTGGTCAGTCCGAATATCGGCAAGCTGCCCAGCGACTCGCCGAAGTGTTG GAGCGACACGTTGCTGGACTCCCGCAGCACATGGAGAATGTGTTGCACAC CGTATCGCAGAACCCGCCCCCGACATCGCTGGCCAGACAAAACGAAACTA CGACC--------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- -------------------------------------------------- ----------------------------------------------- >C1 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT >C2 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT >C3 oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo oooooooooooooooooooooooooooooooooooooooooooooooooo ooooooooooooooLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT >C4 VGKDAGMSTAPDTVPECQSRRMRILFIAEAVTLSTVVRPFAVARLLDPSR YEVHFACDPRYNNLLGPLPFPHHPIHTVPSEWVLTRIAQGRLFYTTRTLR KYVEEDSKLLSEIEPDLVVGDARWSLSVSARLASIPYIAIANAYWSSHAR RRLPLPDVLWTRILGVRLVNILFRLYSPLIFAIYCLPLNWVRRKHGLPSL GSNIGCIYTDGDYTLYADVPELVPTYDLPANHQYLGPVLWSPAGELPRWW DSLPTDRPIVYATLGTSGGKNLLQVVLDALADLPVTVIAATAGRSELQNV PANAFVADYLPGEAAAARSAVVICNGGSLTTQQAFVAGVPVVGIAGNLDQ HLNMEAVEAAGAGILLRSERLKVRRVADAVNRVLGQSEYRQAAQRLAEVL ERHVAGLPQHMENVLHTVSQNPPPTSLARQNETTT MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 4 taxa and 1947 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579790859 Setting output file names to "/data/3res/ML0128/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 442796924 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0308606249 Seed = 1809946269 Swapseed = 1579790859 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.35 % Dirichlet(Revmat{all}) 1.35 % Slider(Revmat{all}) 1.35 % Dirichlet(Pi{all}) 1.35 % Slider(Pi{all}) 2.70 % Multiplier(Alpha{1,2}) 2.70 % Multiplier(Alpha{3}) 2.70 % Slider(Pinvar{all}) 13.51 % NNI(Tau{all},V{all}) 13.51 % ParsSPR(Tau{all},V{all}) 40.54 % Multiplier(V{all}) 13.51 % Nodeslider(V{all}) 5.41 % TLMultiplier(V{all}) Division 1 has 9 unique site patterns Division 2 has 9 unique site patterns Division 3 has 9 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2373.349350 -- -26.620141 Chain 2 -- -2373.349434 -- -26.620141 Chain 3 -- -2373.349350 -- -26.620141 Chain 4 -- -2373.349434 -- -26.620141 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2373.349434 -- -26.620141 Chain 2 -- -2373.349350 -- -26.620141 Chain 3 -- -2373.349350 -- -26.620141 Chain 4 -- -2373.349350 -- -26.620141 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2373.349] (-2373.349) (-2373.349) (-2373.349) * [-2373.349] (-2373.349) (-2373.349) (-2373.349) 500 -- (-1792.124) (-1795.552) (-1787.899) [-1791.942] * (-1788.785) (-1796.705) [-1793.767] (-1797.340) -- 0:00:00 1000 -- (-1792.609) (-1789.877) (-1789.691) [-1788.901] * [-1790.682] (-1792.701) (-1796.535) (-1793.577) -- 0:00:00 1500 -- (-1789.870) (-1787.239) [-1788.819] (-1793.741) * [-1790.127] (-1790.293) (-1791.254) (-1789.662) -- 0:00:00 2000 -- (-1787.404) [-1791.614] (-1793.827) (-1794.219) * (-1793.187) [-1788.673] (-1791.419) (-1797.521) -- 0:00:00 2500 -- [-1798.314] (-1786.762) (-1791.790) (-1790.802) * (-1788.613) (-1792.997) (-1790.191) [-1787.706] -- 0:00:00 3000 -- (-1789.716) (-1788.412) (-1791.764) [-1788.339] * (-1793.764) [-1787.702] (-1790.121) (-1793.512) -- 0:00:00 3500 -- (-1791.194) (-1790.531) (-1797.265) [-1790.182] * (-1789.274) [-1791.604] (-1787.791) (-1791.030) -- 0:00:00 4000 -- [-1787.305] (-1789.077) (-1789.319) (-1792.590) * (-1791.493) (-1793.341) [-1788.193] (-1789.247) -- 0:00:00 4500 -- (-1786.978) (-1790.100) [-1788.947] (-1794.387) * (-1794.149) [-1788.645] (-1792.659) (-1790.886) -- 0:00:00 5000 -- (-1788.389) (-1793.316) (-1788.826) [-1789.361] * (-1789.248) [-1789.525] (-1789.356) (-1787.076) -- 0:00:00 Average standard deviation of split frequencies: 0.104757 5500 -- (-1789.082) (-1789.226) (-1786.663) [-1794.273] * (-1790.686) (-1786.489) [-1790.781] (-1800.351) -- 0:00:00 6000 -- (-1791.393) (-1787.298) [-1786.982] (-1788.754) * (-1789.020) (-1792.684) [-1789.970] (-1798.296) -- 0:02:45 6500 -- (-1789.391) [-1785.935] (-1791.930) (-1791.606) * (-1790.743) (-1790.554) [-1788.040] (-1790.801) -- 0:02:32 7000 -- (-1790.650) [-1790.912] (-1794.505) (-1791.839) * [-1792.778] (-1790.574) (-1792.524) (-1792.962) -- 0:02:21 7500 -- [-1793.274] (-1793.240) (-1793.465) (-1791.717) * (-1794.735) [-1789.612] (-1788.914) (-1787.643) -- 0:02:12 8000 -- (-1791.914) [-1787.387] (-1793.688) (-1790.099) * (-1794.830) [-1788.152] (-1793.156) (-1794.143) -- 0:02:04 8500 -- [-1788.624] (-1791.247) (-1794.405) (-1788.015) * (-1795.414) [-1790.670] (-1789.190) (-1792.550) -- 0:01:56 9000 -- (-1790.322) [-1787.982] (-1794.010) (-1787.027) * (-1791.765) (-1788.215) [-1787.152] (-1795.611) -- 0:01:50 9500 -- (-1792.662) [-1790.769] (-1789.186) (-1791.913) * (-1790.992) (-1792.585) [-1785.903] (-1788.044) -- 0:01:44 10000 -- (-1792.288) (-1787.395) (-1795.046) [-1790.936] * (-1790.999) (-1790.531) (-1795.411) [-1787.980] -- 0:01:39 Average standard deviation of split frequencies: 0.058926 10500 -- (-1793.137) (-1789.308) [-1787.014] (-1791.194) * (-1791.064) (-1790.617) [-1788.097] (-1789.153) -- 0:01:34 11000 -- (-1795.182) (-1787.353) (-1793.873) [-1786.717] * (-1788.903) (-1790.424) [-1786.920] (-1796.439) -- 0:01:29 11500 -- [-1789.623] (-1786.993) (-1789.051) (-1786.685) * (-1795.893) (-1787.756) (-1787.944) [-1785.940] -- 0:01:25 12000 -- (-1792.453) (-1794.696) [-1792.743] (-1789.254) * (-1792.771) [-1785.125] (-1792.068) (-1786.305) -- 0:01:22 12500 -- (-1793.682) (-1789.319) (-1788.226) [-1793.095] * (-1789.147) (-1790.051) (-1793.946) [-1790.394] -- 0:01:19 13000 -- (-1793.567) (-1788.762) (-1791.866) [-1786.605] * (-1786.740) (-1794.541) (-1790.015) [-1786.045] -- 0:01:15 13500 -- (-1790.710) [-1786.679] (-1793.651) (-1789.203) * [-1787.349] (-1788.428) (-1785.737) (-1791.648) -- 0:01:13 14000 -- (-1793.279) [-1787.669] (-1784.937) (-1795.722) * (-1790.244) (-1786.839) [-1788.688] (-1794.344) -- 0:01:10 14500 -- [-1789.415] (-1786.084) (-1787.476) (-1787.997) * (-1793.149) [-1789.159] (-1790.353) (-1790.836) -- 0:01:07 15000 -- (-1793.851) [-1787.624] (-1789.586) (-1791.875) * (-1789.706) [-1790.076] (-1791.804) (-1791.684) -- 0:01:05 Average standard deviation of split frequencies: 0.019642 15500 -- (-1793.389) [-1795.072] (-1786.418) (-1789.715) * [-1788.712] (-1786.706) (-1792.690) (-1788.868) -- 0:01:03 16000 -- (-1788.575) [-1791.250] (-1786.895) (-1788.420) * (-1791.870) (-1790.817) [-1789.640] (-1789.286) -- 0:01:01 16500 -- [-1787.516] (-1790.320) (-1786.490) (-1793.588) * (-1786.587) (-1789.752) (-1787.111) [-1789.015] -- 0:00:59 17000 -- (-1789.595) (-1788.519) [-1787.128] (-1793.917) * [-1791.258] (-1796.711) (-1786.352) (-1790.465) -- 0:00:57 17500 -- (-1794.341) (-1793.587) (-1788.180) [-1790.014] * (-1790.150) [-1785.482] (-1791.142) (-1787.252) -- 0:00:56 18000 -- (-1787.018) (-1797.148) (-1785.173) [-1790.359] * (-1792.544) [-1787.729] (-1801.045) (-1791.033) -- 0:00:54 18500 -- (-1797.430) (-1790.008) (-1783.588) [-1787.923] * (-1792.311) (-1791.450) (-1792.397) [-1790.978] -- 0:00:53 19000 -- (-1791.427) (-1788.338) [-1783.785] (-1785.097) * [-1792.844] (-1790.231) (-1789.830) (-1789.294) -- 0:01:43 19500 -- [-1786.295] (-1792.016) (-1784.302) (-1791.470) * [-1789.358] (-1788.975) (-1788.912) (-1788.014) -- 0:01:40 20000 -- (-1790.807) [-1789.459] (-1787.855) (-1785.130) * (-1788.797) (-1793.529) (-1787.434) [-1787.531] -- 0:01:38 Average standard deviation of split frequencies: 0.030413 20500 -- (-1789.268) (-1790.084) [-1786.857] (-1792.198) * (-1789.432) [-1796.721] (-1793.725) (-1789.732) -- 0:01:35 21000 -- (-1791.218) (-1791.062) [-1785.996] (-1788.274) * [-1794.556] (-1796.597) (-1789.050) (-1786.754) -- 0:01:33 21500 -- (-1791.044) (-1791.123) (-1785.037) [-1785.578] * (-1789.835) (-1794.222) [-1791.990] (-1785.887) -- 0:01:31 22000 -- [-1785.665] (-1790.471) (-1785.031) (-1792.497) * (-1791.385) [-1785.935] (-1792.003) (-1793.105) -- 0:01:28 22500 -- [-1789.591] (-1790.867) (-1786.246) (-1791.823) * (-1793.774) [-1790.534] (-1795.812) (-1789.524) -- 0:01:26 23000 -- (-1787.762) (-1783.924) (-1785.790) [-1790.432] * (-1790.879) (-1791.727) [-1789.489] (-1790.195) -- 0:01:24 23500 -- (-1788.890) (-1783.851) (-1787.988) [-1789.814] * (-1789.521) (-1789.034) (-1788.579) [-1786.711] -- 0:01:23 24000 -- (-1789.946) [-1787.583] (-1786.935) (-1792.531) * (-1795.400) (-1791.848) (-1789.250) [-1789.961] -- 0:01:21 24500 -- [-1787.703] (-1788.314) (-1784.219) (-1788.802) * (-1796.536) (-1791.311) (-1799.974) [-1789.283] -- 0:01:19 25000 -- [-1785.349] (-1791.441) (-1785.003) (-1794.658) * (-1792.246) (-1794.038) [-1788.753] (-1788.813) -- 0:01:18 Average standard deviation of split frequencies: 0.036262 25500 -- (-1790.663) (-1785.224) [-1784.998] (-1788.037) * (-1786.791) [-1786.543] (-1790.834) (-1791.658) -- 0:01:16 26000 -- [-1785.862] (-1783.891) (-1786.205) (-1790.335) * (-1790.429) (-1793.394) (-1793.408) [-1790.080] -- 0:01:14 26500 -- [-1797.299] (-1795.190) (-1785.011) (-1789.565) * (-1793.657) [-1788.943] (-1788.652) (-1787.776) -- 0:01:13 27000 -- (-1798.194) [-1787.965] (-1785.110) (-1789.210) * (-1792.748) [-1790.367] (-1789.406) (-1788.321) -- 0:01:12 27500 -- (-1792.724) (-1786.894) [-1786.558] (-1788.120) * [-1789.971] (-1787.002) (-1790.446) (-1787.420) -- 0:01:10 28000 -- [-1790.451] (-1786.961) (-1786.323) (-1794.876) * [-1792.774] (-1790.549) (-1797.189) (-1791.436) -- 0:01:09 28500 -- (-1789.876) (-1784.968) [-1784.411] (-1795.874) * (-1792.207) (-1790.791) [-1785.290] (-1790.287) -- 0:01:08 29000 -- (-1791.569) [-1784.486] (-1784.412) (-1789.675) * (-1791.103) (-1792.598) (-1792.724) [-1788.279] -- 0:01:06 29500 -- (-1788.929) (-1784.975) [-1784.214] (-1793.008) * (-1788.347) [-1787.613] (-1801.617) (-1797.216) -- 0:01:05 30000 -- [-1790.306] (-1784.479) (-1783.650) (-1792.184) * (-1788.944) (-1795.382) (-1786.443) [-1786.277] -- 0:01:04 Average standard deviation of split frequencies: 0.000000 30500 -- (-1791.381) (-1784.934) (-1783.633) [-1786.510] * (-1791.843) (-1787.478) (-1790.446) [-1788.228] -- 0:01:03 31000 -- (-1785.673) (-1784.449) (-1785.735) [-1793.701] * (-1786.092) (-1789.836) (-1789.263) [-1791.356] -- 0:01:02 31500 -- [-1789.967] (-1784.958) (-1786.134) (-1802.362) * (-1794.671) [-1788.801] (-1788.138) (-1789.145) -- 0:01:32 32000 -- (-1789.172) [-1784.570] (-1786.649) (-1791.279) * (-1787.784) (-1788.759) [-1789.699] (-1792.215) -- 0:01:30 32500 -- (-1793.007) [-1787.205] (-1788.507) (-1790.247) * (-1785.588) (-1787.796) [-1788.632] (-1788.239) -- 0:01:29 33000 -- (-1789.852) [-1784.519] (-1785.641) (-1790.502) * (-1785.115) [-1789.631] (-1792.635) (-1791.591) -- 0:01:27 33500 -- (-1785.677) (-1784.344) (-1786.454) [-1790.655] * (-1786.553) [-1787.120] (-1788.420) (-1792.991) -- 0:01:26 34000 -- (-1788.597) (-1786.252) (-1784.309) [-1787.758] * (-1785.729) (-1789.378) (-1792.454) [-1787.469] -- 0:01:25 34500 -- (-1793.086) (-1785.731) (-1784.178) [-1787.868] * (-1785.678) (-1788.975) (-1791.869) [-1792.055] -- 0:01:23 35000 -- (-1792.697) (-1786.657) (-1790.201) [-1791.949] * (-1787.154) (-1789.565) (-1789.123) [-1787.676] -- 0:01:22 Average standard deviation of split frequencies: 0.043649 35500 -- (-1792.359) (-1787.076) (-1789.197) [-1788.713] * (-1785.691) (-1795.284) (-1788.336) [-1793.495] -- 0:01:21 36000 -- (-1790.269) (-1784.226) [-1783.811] (-1791.621) * (-1788.340) (-1793.803) [-1789.755] (-1791.892) -- 0:01:20 36500 -- [-1793.849] (-1786.638) (-1783.926) (-1789.523) * [-1785.874] (-1787.026) (-1792.152) (-1790.769) -- 0:01:19 37000 -- [-1788.566] (-1785.626) (-1786.684) (-1790.995) * (-1785.552) [-1787.053] (-1787.771) (-1796.215) -- 0:01:18 37500 -- (-1790.229) (-1787.998) [-1784.097] (-1795.507) * (-1785.208) (-1786.145) [-1792.395] (-1793.019) -- 0:01:17 38000 -- (-1792.999) (-1790.047) (-1784.846) [-1784.416] * [-1783.667] (-1785.344) (-1793.557) (-1792.425) -- 0:01:15 38500 -- (-1793.555) (-1788.040) (-1784.029) [-1787.036] * (-1787.125) (-1784.638) (-1791.501) [-1787.186] -- 0:01:14 39000 -- (-1791.781) (-1787.500) [-1784.964] (-1787.820) * (-1786.314) (-1789.131) (-1792.460) [-1787.300] -- 0:01:13 39500 -- (-1795.501) (-1788.295) [-1784.085] (-1793.044) * [-1783.657] (-1786.325) (-1794.155) (-1791.480) -- 0:01:12 40000 -- (-1788.253) (-1784.986) (-1786.387) [-1787.512] * (-1785.529) (-1784.528) (-1791.818) [-1791.916] -- 0:01:12 Average standard deviation of split frequencies: 0.023184 40500 -- (-1792.127) (-1787.929) [-1786.937] (-1787.540) * [-1786.664] (-1784.880) (-1794.461) (-1786.950) -- 0:01:11 41000 -- (-1790.066) (-1786.558) (-1787.765) [-1788.633] * (-1787.257) (-1793.459) (-1788.508) [-1791.771] -- 0:01:10 41500 -- (-1793.008) (-1785.685) [-1789.266] (-1791.083) * (-1785.116) [-1784.876] (-1790.398) (-1787.753) -- 0:01:09 42000 -- (-1792.644) (-1788.107) (-1786.750) [-1786.636] * (-1786.947) (-1787.133) [-1789.385] (-1787.785) -- 0:01:08 42500 -- (-1799.701) (-1785.026) [-1787.124] (-1792.531) * (-1785.492) (-1786.709) (-1788.208) [-1786.419] -- 0:01:07 43000 -- (-1790.733) (-1785.706) (-1790.246) [-1794.343] * (-1786.373) (-1784.880) (-1787.169) [-1789.186] -- 0:01:06 43500 -- [-1787.812] (-1788.504) (-1788.770) (-1792.153) * (-1784.627) (-1784.932) [-1790.037] (-1788.577) -- 0:01:05 44000 -- (-1789.469) (-1787.794) [-1785.487] (-1789.037) * (-1785.736) [-1785.206] (-1795.874) (-1788.844) -- 0:01:26 44500 -- [-1788.242] (-1787.961) (-1787.297) (-1788.626) * (-1784.933) (-1785.333) (-1788.967) [-1786.451] -- 0:01:25 45000 -- (-1786.374) (-1787.963) [-1792.535] (-1787.959) * [-1785.798] (-1784.462) (-1792.895) (-1788.580) -- 0:01:24 Average standard deviation of split frequencies: 0.027328 45500 -- (-1791.383) [-1783.970] (-1787.528) (-1788.444) * (-1786.019) (-1786.831) (-1786.063) [-1791.214] -- 0:01:23 46000 -- (-1792.755) (-1790.204) [-1785.408] (-1791.762) * (-1786.834) [-1787.746] (-1788.742) (-1792.326) -- 0:01:22 46500 -- (-1788.760) (-1787.354) [-1787.604] (-1789.380) * (-1784.808) (-1786.097) (-1793.420) [-1790.618] -- 0:01:22 47000 -- (-1788.238) (-1790.422) (-1786.668) [-1794.342] * (-1785.415) (-1785.817) [-1791.272] (-1788.837) -- 0:01:21 47500 -- (-1789.824) [-1787.458] (-1785.162) (-1791.720) * (-1786.458) [-1789.673] (-1793.807) (-1790.868) -- 0:01:20 48000 -- (-1792.477) (-1785.961) (-1783.912) [-1788.037] * (-1787.140) (-1790.039) (-1790.993) [-1791.011] -- 0:01:19 48500 -- (-1788.367) (-1785.747) [-1785.962] (-1785.715) * [-1787.029] (-1784.979) (-1788.352) (-1790.616) -- 0:01:18 49000 -- (-1787.907) (-1786.841) [-1783.987] (-1791.616) * (-1786.923) (-1784.885) (-1790.118) [-1788.947] -- 0:01:17 49500 -- (-1788.568) (-1784.253) [-1784.403] (-1787.514) * (-1784.687) (-1784.830) [-1790.270] (-1795.969) -- 0:01:16 50000 -- [-1788.514] (-1784.428) (-1784.084) (-1790.812) * (-1785.982) (-1784.201) (-1787.660) [-1792.061] -- 0:01:16 Average standard deviation of split frequencies: 0.012405 50500 -- (-1790.791) [-1785.264] (-1784.197) (-1792.927) * (-1786.649) (-1786.378) [-1789.228] (-1790.390) -- 0:01:15 51000 -- (-1788.585) [-1786.157] (-1786.015) (-1790.818) * [-1789.048] (-1787.818) (-1795.048) (-1786.650) -- 0:01:14 51500 -- (-1789.919) [-1786.930] (-1786.066) (-1797.807) * (-1784.676) (-1791.965) [-1793.600] (-1793.073) -- 0:01:13 52000 -- (-1785.765) (-1786.695) (-1784.281) [-1786.830] * (-1783.465) (-1785.489) [-1787.971] (-1793.427) -- 0:01:12 52500 -- (-1792.829) (-1784.916) [-1784.731] (-1793.397) * (-1784.256) [-1788.611] (-1798.066) (-1793.305) -- 0:01:12 53000 -- (-1787.601) (-1787.429) [-1784.773] (-1788.341) * (-1783.836) [-1790.599] (-1793.074) (-1792.264) -- 0:01:11 53500 -- [-1791.084] (-1787.324) (-1784.293) (-1788.678) * (-1784.218) (-1790.900) (-1790.038) [-1788.079] -- 0:01:10 54000 -- (-1790.602) [-1787.077] (-1784.360) (-1792.349) * [-1783.857] (-1787.374) (-1788.804) (-1788.970) -- 0:01:10 54500 -- (-1789.216) [-1785.373] (-1784.797) (-1789.237) * (-1786.366) (-1787.712) (-1786.391) [-1787.017] -- 0:01:09 55000 -- (-1787.582) (-1785.470) [-1785.347] (-1795.621) * (-1786.754) (-1786.571) (-1787.562) [-1794.473] -- 0:01:08 Average standard deviation of split frequencies: 0.011224 55500 -- (-1790.556) (-1789.169) (-1790.897) [-1789.298] * (-1787.268) [-1783.818] (-1784.490) (-1790.498) -- 0:01:08 56000 -- [-1790.763] (-1784.811) (-1789.355) (-1790.017) * (-1785.564) (-1784.321) [-1786.303] (-1789.109) -- 0:01:07 56500 -- (-1791.421) (-1786.812) (-1788.145) [-1791.247] * [-1783.984] (-1786.567) (-1784.926) (-1791.908) -- 0:01:06 57000 -- [-1791.751] (-1785.448) (-1788.319) (-1788.375) * (-1783.965) (-1786.303) (-1786.960) [-1786.366] -- 0:01:22 57500 -- [-1786.421] (-1784.803) (-1783.314) (-1789.914) * (-1785.131) (-1785.832) (-1787.254) [-1790.739] -- 0:01:21 58000 -- (-1790.112) [-1783.809] (-1783.940) (-1793.434) * (-1788.086) (-1785.344) (-1789.345) [-1790.841] -- 0:01:21 58500 -- (-1786.574) (-1783.960) (-1783.716) [-1785.722] * (-1786.640) (-1784.943) (-1787.172) [-1787.160] -- 0:01:20 59000 -- [-1790.258] (-1786.609) (-1785.502) (-1793.380) * (-1784.569) (-1785.658) (-1784.747) [-1786.209] -- 0:01:19 59500 -- (-1790.542) [-1786.669] (-1785.822) (-1796.660) * (-1784.382) (-1785.805) (-1785.523) [-1792.330] -- 0:01:19 60000 -- (-1792.156) (-1787.091) [-1787.516] (-1787.201) * (-1784.430) (-1786.449) [-1786.148] (-1789.084) -- 0:01:18 Average standard deviation of split frequencies: 0.010361 60500 -- (-1790.034) [-1786.050] (-1784.721) (-1793.706) * [-1783.910] (-1786.899) (-1783.967) (-1792.575) -- 0:01:17 61000 -- (-1787.641) (-1785.542) [-1784.155] (-1801.570) * (-1783.832) (-1786.733) [-1784.140] (-1793.254) -- 0:01:16 61500 -- (-1794.011) (-1785.908) (-1784.407) [-1785.950] * [-1783.904] (-1791.293) (-1786.525) (-1788.504) -- 0:01:16 62000 -- (-1799.197) [-1784.909] (-1783.549) (-1786.724) * (-1785.632) (-1786.140) (-1784.517) [-1788.540] -- 0:01:15 62500 -- [-1786.203] (-1785.210) (-1785.894) (-1787.614) * (-1785.805) (-1786.099) [-1786.316] (-1796.050) -- 0:01:15 63000 -- (-1791.639) (-1785.913) (-1783.612) [-1786.400] * (-1784.233) (-1785.528) [-1786.216] (-1792.903) -- 0:01:14 63500 -- [-1787.395] (-1785.165) (-1784.586) (-1786.393) * (-1786.766) [-1785.601] (-1786.504) (-1789.834) -- 0:01:13 64000 -- (-1788.128) (-1786.020) [-1786.051] (-1787.872) * (-1785.871) (-1786.044) [-1783.984] (-1786.898) -- 0:01:13 64500 -- (-1793.536) [-1784.747] (-1784.835) (-1785.990) * (-1785.413) (-1785.008) (-1783.944) [-1788.618] -- 0:01:12 65000 -- [-1789.778] (-1786.168) (-1784.493) (-1784.570) * (-1786.944) [-1785.331] (-1786.250) (-1793.048) -- 0:01:11 Average standard deviation of split frequencies: 0.019047 65500 -- (-1793.890) [-1785.007] (-1783.813) (-1785.136) * (-1790.406) (-1785.468) [-1783.460] (-1793.926) -- 0:01:11 66000 -- (-1788.289) [-1784.732] (-1785.492) (-1784.826) * [-1787.459] (-1785.822) (-1784.764) (-1789.022) -- 0:01:10 66500 -- (-1793.499) (-1785.638) [-1787.366] (-1786.370) * (-1785.122) (-1790.393) [-1792.422] (-1795.253) -- 0:01:10 67000 -- (-1791.484) (-1784.416) [-1785.762] (-1787.786) * (-1785.043) [-1789.218] (-1785.782) (-1791.179) -- 0:01:09 67500 -- (-1787.073) [-1784.493] (-1787.391) (-1784.810) * (-1788.116) (-1788.776) (-1786.735) [-1788.386] -- 0:01:09 68000 -- (-1793.078) (-1784.447) (-1790.577) [-1785.407] * (-1787.058) (-1786.801) [-1784.265] (-1793.858) -- 0:01:08 68500 -- [-1788.764] (-1784.555) (-1786.318) (-1787.221) * (-1787.805) (-1786.333) [-1784.314] (-1790.039) -- 0:01:07 69000 -- (-1788.352) (-1784.908) (-1787.709) [-1783.480] * [-1785.609] (-1784.729) (-1784.877) (-1791.317) -- 0:01:07 69500 -- (-1787.948) [-1785.010] (-1786.389) (-1784.860) * [-1784.618] (-1785.310) (-1785.905) (-1797.665) -- 0:01:06 70000 -- (-1793.349) [-1785.251] (-1785.717) (-1787.599) * (-1784.691) (-1788.161) [-1788.027] (-1788.463) -- 0:01:06 Average standard deviation of split frequencies: 0.004447 70500 -- (-1788.547) (-1790.784) [-1785.570] (-1786.551) * (-1784.903) (-1787.095) [-1785.554] (-1790.459) -- 0:01:05 71000 -- (-1793.267) (-1789.003) [-1786.187] (-1786.308) * (-1784.716) (-1785.196) [-1785.451] (-1786.553) -- 0:01:05 71500 -- (-1794.936) (-1787.601) [-1784.656] (-1783.748) * [-1786.576] (-1784.652) (-1784.155) (-1786.186) -- 0:01:17 72000 -- [-1787.202] (-1789.007) (-1785.575) (-1787.711) * (-1791.116) (-1789.178) (-1791.461) [-1788.909] -- 0:01:17 72500 -- (-1790.077) (-1787.342) [-1783.261] (-1785.519) * (-1792.921) (-1790.799) [-1785.877] (-1791.551) -- 0:01:16 73000 -- (-1788.818) (-1790.116) (-1786.727) [-1785.616] * (-1790.792) (-1785.580) [-1785.903] (-1793.637) -- 0:01:16 73500 -- (-1789.809) [-1791.648] (-1787.796) (-1785.099) * (-1787.982) (-1785.178) [-1786.777] (-1797.942) -- 0:01:15 74000 -- [-1790.850] (-1784.296) (-1788.896) (-1789.396) * (-1787.048) (-1784.914) [-1787.464] (-1789.843) -- 0:01:15 74500 -- (-1795.576) [-1788.300] (-1785.310) (-1786.083) * (-1788.458) (-1785.669) [-1783.746] (-1786.256) -- 0:01:14 75000 -- [-1793.095] (-1785.053) (-1784.269) (-1786.561) * (-1787.443) (-1786.188) [-1786.160] (-1787.041) -- 0:01:14 Average standard deviation of split frequencies: 0.012405 75500 -- [-1787.557] (-1785.770) (-1784.578) (-1785.762) * [-1788.031] (-1785.598) (-1788.508) (-1789.755) -- 0:01:13 76000 -- [-1791.102] (-1783.903) (-1786.054) (-1785.954) * (-1784.834) (-1786.926) [-1787.901] (-1786.157) -- 0:01:12 76500 -- [-1789.257] (-1783.903) (-1784.491) (-1788.888) * [-1784.356] (-1787.190) (-1783.996) (-1796.734) -- 0:01:12 77000 -- (-1790.159) [-1784.383] (-1785.155) (-1786.387) * [-1784.996] (-1787.002) (-1784.354) (-1790.823) -- 0:01:11 77500 -- [-1796.120] (-1784.561) (-1785.586) (-1785.075) * (-1784.692) (-1786.432) [-1784.025] (-1797.288) -- 0:01:11 78000 -- (-1796.181) (-1784.262) [-1785.736] (-1785.145) * (-1788.632) [-1784.587] (-1784.982) (-1788.338) -- 0:01:10 78500 -- [-1790.440] (-1786.956) (-1785.754) (-1786.042) * (-1785.456) (-1784.177) [-1783.941] (-1787.181) -- 0:01:10 79000 -- (-1792.069) (-1783.343) [-1786.437] (-1786.089) * (-1785.257) (-1784.502) [-1784.875] (-1790.709) -- 0:01:09 79500 -- (-1793.203) (-1784.172) [-1789.662] (-1785.079) * (-1785.321) (-1783.887) [-1785.087] (-1793.176) -- 0:01:09 80000 -- (-1792.158) [-1784.160] (-1787.413) (-1785.749) * (-1785.438) [-1784.949] (-1785.314) (-1786.933) -- 0:01:09 Average standard deviation of split frequencies: 0.003896 80500 -- (-1787.784) [-1784.733] (-1785.895) (-1785.709) * (-1785.311) (-1784.615) (-1785.848) [-1789.285] -- 0:01:08 81000 -- (-1796.750) (-1785.438) [-1785.356] (-1788.487) * (-1784.572) (-1785.514) [-1785.698] (-1791.665) -- 0:01:08 81500 -- (-1789.230) [-1787.918] (-1786.553) (-1784.780) * (-1787.275) (-1784.289) [-1783.936] (-1786.212) -- 0:01:07 82000 -- (-1792.381) [-1786.015] (-1786.538) (-1783.828) * [-1784.925] (-1784.735) (-1783.660) (-1785.204) -- 0:01:07 82500 -- (-1789.867) (-1786.284) [-1786.210] (-1783.828) * (-1786.267) [-1785.026] (-1784.354) (-1786.300) -- 0:01:06 83000 -- [-1792.376] (-1785.611) (-1786.712) (-1783.961) * (-1784.943) (-1784.825) (-1785.007) [-1789.696] -- 0:01:06 83500 -- (-1793.196) (-1787.135) [-1784.067] (-1784.490) * (-1790.656) (-1783.682) (-1786.518) [-1789.554] -- 0:01:05 84000 -- [-1786.039] (-1787.861) (-1784.594) (-1783.982) * (-1784.351) (-1783.758) (-1787.064) [-1788.996] -- 0:01:05 84500 -- (-1791.881) [-1786.442] (-1784.537) (-1784.469) * [-1785.627] (-1786.150) (-1785.651) (-1788.849) -- 0:01:05 85000 -- (-1787.491) [-1784.166] (-1784.084) (-1785.105) * (-1784.312) [-1784.392] (-1787.842) (-1788.880) -- 0:01:04 Average standard deviation of split frequencies: 0.018271 85500 -- (-1796.340) [-1786.771] (-1784.952) (-1785.125) * (-1784.331) (-1785.344) (-1787.541) [-1786.968] -- 0:01:14 86000 -- (-1787.803) [-1784.625] (-1785.118) (-1784.721) * [-1785.640] (-1785.026) (-1790.495) (-1788.928) -- 0:01:14 86500 -- (-1790.743) (-1783.956) (-1786.104) [-1783.490] * (-1785.012) (-1785.909) [-1787.248] (-1785.179) -- 0:01:13 87000 -- (-1792.830) (-1784.725) (-1787.622) [-1783.971] * (-1785.070) [-1784.957] (-1786.393) (-1788.440) -- 0:01:13 87500 -- (-1790.204) (-1785.098) (-1788.285) [-1784.822] * [-1785.495] (-1785.747) (-1786.612) (-1788.030) -- 0:01:13 88000 -- (-1787.618) (-1784.985) [-1785.938] (-1785.928) * [-1785.088] (-1783.741) (-1787.780) (-1789.848) -- 0:01:12 88500 -- (-1789.509) (-1789.048) (-1787.662) [-1784.504] * (-1785.703) [-1786.256] (-1787.672) (-1785.990) -- 0:01:12 89000 -- (-1792.394) (-1785.816) (-1784.664) [-1784.124] * [-1787.504] (-1791.884) (-1786.605) (-1784.934) -- 0:01:11 89500 -- (-1797.391) [-1788.272] (-1785.159) (-1784.222) * [-1783.568] (-1790.459) (-1785.705) (-1784.880) -- 0:01:11 90000 -- (-1790.801) (-1787.144) (-1784.461) [-1784.605] * [-1784.602] (-1786.208) (-1786.159) (-1784.053) -- 0:01:10 Average standard deviation of split frequencies: 0.031196 90500 -- [-1786.063] (-1788.552) (-1786.534) (-1786.302) * (-1786.589) (-1787.319) [-1786.994] (-1784.063) -- 0:01:10 91000 -- (-1796.993) [-1785.202] (-1786.540) (-1789.361) * (-1784.996) (-1786.373) (-1786.224) [-1785.386] -- 0:01:09 91500 -- (-1787.597) (-1785.678) [-1784.473] (-1787.168) * (-1785.002) (-1787.780) [-1787.747] (-1785.314) -- 0:01:09 92000 -- (-1788.812) [-1785.370] (-1784.560) (-1785.425) * (-1787.954) (-1787.331) [-1787.200] (-1785.483) -- 0:01:09 92500 -- [-1792.662] (-1783.880) (-1785.811) (-1787.528) * [-1787.648] (-1784.848) (-1788.515) (-1784.685) -- 0:01:08 93000 -- (-1791.544) [-1783.784] (-1786.515) (-1786.458) * (-1787.537) [-1786.083] (-1788.337) (-1785.385) -- 0:01:08 93500 -- (-1793.868) (-1785.140) (-1787.529) [-1787.011] * (-1787.420) (-1787.361) (-1785.093) [-1784.517] -- 0:01:07 94000 -- (-1793.416) [-1785.743] (-1786.685) (-1787.350) * [-1787.506] (-1785.564) (-1785.298) (-1783.810) -- 0:01:07 94500 -- (-1798.503) [-1783.931] (-1785.714) (-1787.684) * (-1787.572) [-1784.291] (-1787.188) (-1785.191) -- 0:01:07 95000 -- (-1793.275) [-1784.542] (-1784.218) (-1789.015) * (-1785.579) [-1783.879] (-1786.650) (-1784.863) -- 0:01:06 Average standard deviation of split frequencies: 0.036010 95500 -- (-1789.282) (-1788.234) [-1786.085] (-1785.098) * (-1788.080) (-1785.080) [-1784.399] (-1785.172) -- 0:01:06 96000 -- (-1792.974) [-1783.646] (-1785.540) (-1784.232) * (-1788.874) (-1785.088) (-1783.960) [-1787.160] -- 0:01:05 96500 -- (-1793.043) [-1785.736] (-1786.015) (-1788.791) * (-1787.771) (-1785.623) [-1783.960] (-1784.095) -- 0:01:05 97000 -- (-1790.671) (-1783.958) [-1784.466] (-1788.676) * (-1786.249) (-1786.457) (-1783.425) [-1784.136] -- 0:01:05 97500 -- (-1788.467) (-1783.630) (-1785.471) [-1786.901] * (-1786.015) (-1783.625) [-1785.310] (-1790.130) -- 0:01:04 98000 -- (-1792.568) [-1783.997] (-1783.450) (-1785.438) * (-1786.470) (-1785.710) [-1787.975] (-1785.317) -- 0:01:04 98500 -- [-1785.719] (-1787.533) (-1785.477) (-1786.132) * [-1788.727] (-1783.867) (-1784.710) (-1784.097) -- 0:01:04 99000 -- [-1789.865] (-1787.220) (-1783.385) (-1784.229) * (-1789.300) [-1784.504] (-1785.657) (-1787.656) -- 0:01:03 99500 -- (-1794.367) (-1785.405) (-1783.418) [-1784.921] * (-1787.807) (-1785.914) [-1787.884] (-1784.700) -- 0:01:03 100000 -- [-1789.419] (-1785.227) (-1784.143) (-1784.614) * (-1787.233) [-1785.102] (-1784.258) (-1784.295) -- 0:01:12 Average standard deviation of split frequencies: 0.018731 100500 -- (-1793.549) (-1785.619) (-1785.369) [-1785.453] * [-1786.996] (-1786.878) (-1787.715) (-1786.246) -- 0:01:11 101000 -- (-1796.315) [-1785.647] (-1785.469) (-1784.667) * (-1790.287) (-1785.294) [-1788.610] (-1794.178) -- 0:01:11 101500 -- [-1785.350] (-1785.934) (-1788.250) (-1784.805) * (-1784.110) [-1785.347] (-1786.948) (-1784.544) -- 0:01:10 102000 -- (-1787.425) [-1785.117] (-1787.136) (-1784.720) * [-1785.942] (-1784.142) (-1788.287) (-1785.038) -- 0:01:10 102500 -- [-1786.873] (-1784.468) (-1785.569) (-1786.167) * (-1784.156) [-1784.154] (-1785.727) (-1786.095) -- 0:01:10 103000 -- (-1786.262) [-1784.703] (-1788.314) (-1784.685) * (-1786.230) (-1785.717) (-1784.067) [-1785.209] -- 0:01:09 103500 -- (-1787.015) [-1786.209] (-1785.170) (-1784.442) * [-1786.472] (-1785.193) (-1784.920) (-1784.524) -- 0:01:09 104000 -- [-1784.695] (-1785.516) (-1787.135) (-1784.555) * (-1785.884) [-1788.925] (-1786.465) (-1787.077) -- 0:01:08 104500 -- (-1784.831) [-1784.505] (-1786.150) (-1788.826) * [-1784.736] (-1788.319) (-1783.870) (-1785.328) -- 0:01:08 105000 -- [-1784.543] (-1784.470) (-1785.914) (-1785.255) * (-1783.917) (-1793.864) (-1784.621) [-1785.085] -- 0:01:08 Average standard deviation of split frequencies: 0.020754 105500 -- (-1786.655) (-1786.861) [-1786.159] (-1784.235) * (-1784.506) (-1787.936) [-1785.301] (-1784.377) -- 0:01:07 106000 -- (-1789.400) (-1783.891) (-1786.440) [-1786.660] * [-1784.616] (-1786.263) (-1784.184) (-1786.906) -- 0:01:07 106500 -- (-1793.551) (-1785.057) (-1785.646) [-1787.419] * (-1784.744) (-1785.113) [-1784.840] (-1786.347) -- 0:01:07 107000 -- [-1784.893] (-1784.162) (-1785.812) (-1788.793) * (-1784.876) (-1787.275) (-1785.900) [-1785.124] -- 0:01:06 107500 -- (-1784.330) (-1784.209) [-1787.229] (-1784.660) * [-1787.704] (-1785.984) (-1787.890) (-1786.741) -- 0:01:06 108000 -- (-1783.942) (-1784.336) (-1787.662) [-1784.003] * [-1786.706] (-1790.799) (-1785.868) (-1786.514) -- 0:01:06 108500 -- [-1786.354] (-1786.947) (-1788.590) (-1783.738) * [-1784.584] (-1788.738) (-1784.894) (-1784.128) -- 0:01:05 109000 -- (-1788.435) (-1787.033) (-1789.192) [-1786.795] * (-1785.250) (-1787.028) (-1788.803) [-1787.176] -- 0:01:05 109500 -- [-1786.961] (-1790.138) (-1788.364) (-1786.125) * (-1787.699) [-1786.163] (-1787.650) (-1788.482) -- 0:01:05 110000 -- (-1784.499) (-1785.094) (-1786.299) [-1787.668] * (-1787.608) [-1786.888] (-1784.959) (-1786.497) -- 0:01:04 Average standard deviation of split frequencies: 0.017039 110500 -- (-1783.990) (-1784.965) [-1784.613] (-1793.047) * [-1784.815] (-1787.072) (-1784.357) (-1783.974) -- 0:01:04 111000 -- [-1784.940] (-1783.891) (-1786.346) (-1785.151) * (-1784.815) (-1786.890) (-1784.222) [-1786.567] -- 0:01:04 111500 -- (-1787.084) [-1783.825] (-1786.922) (-1790.700) * (-1784.726) [-1786.877] (-1787.701) (-1785.135) -- 0:01:03 112000 -- [-1785.753] (-1786.177) (-1789.295) (-1791.045) * (-1784.434) (-1785.711) (-1787.443) [-1783.674] -- 0:01:03 112500 -- [-1787.425] (-1784.307) (-1783.797) (-1791.371) * (-1785.097) [-1786.752] (-1786.528) (-1783.752) -- 0:01:03 113000 -- (-1788.444) [-1785.613] (-1783.981) (-1789.791) * (-1785.256) (-1787.813) (-1786.135) [-1783.752] -- 0:01:02 113500 -- (-1788.831) [-1785.045] (-1785.100) (-1787.374) * (-1787.786) (-1783.940) (-1785.619) [-1788.865] -- 0:01:02 114000 -- (-1785.595) (-1786.052) (-1786.948) [-1787.273] * (-1790.174) [-1785.639] (-1785.470) (-1787.069) -- 0:01:09 114500 -- [-1784.482] (-1785.707) (-1788.413) (-1787.156) * [-1787.810] (-1785.945) (-1785.635) (-1792.012) -- 0:01:09 115000 -- (-1784.585) [-1785.096] (-1786.750) (-1784.711) * (-1790.227) [-1785.150] (-1785.576) (-1789.045) -- 0:01:09 Average standard deviation of split frequencies: 0.021674 115500 -- (-1784.586) (-1789.875) (-1785.875) [-1784.858] * (-1786.553) [-1784.034] (-1785.098) (-1787.005) -- 0:01:08 116000 -- [-1784.902] (-1787.536) (-1786.737) (-1784.900) * (-1787.972) (-1783.613) [-1785.760] (-1791.173) -- 0:01:08 116500 -- (-1784.838) (-1785.391) [-1785.288] (-1784.128) * (-1787.068) (-1784.346) (-1783.937) [-1793.467] -- 0:01:08 117000 -- (-1784.622) [-1785.024] (-1785.814) (-1783.675) * (-1785.358) [-1785.087] (-1785.576) (-1791.898) -- 0:01:07 117500 -- (-1784.112) (-1785.973) (-1785.355) [-1785.641] * (-1786.522) [-1784.726] (-1785.120) (-1784.248) -- 0:01:07 118000 -- (-1784.444) (-1784.893) (-1786.009) [-1786.371] * [-1785.271] (-1785.705) (-1784.996) (-1791.739) -- 0:01:07 118500 -- (-1784.477) (-1784.390) [-1785.796] (-1784.076) * (-1784.567) (-1788.908) (-1785.360) [-1784.773] -- 0:01:06 119000 -- (-1786.981) [-1784.339] (-1789.284) (-1785.604) * (-1786.776) (-1785.599) (-1785.036) [-1785.412] -- 0:01:06 119500 -- [-1784.008] (-1787.207) (-1784.825) (-1788.302) * [-1786.001] (-1791.126) (-1785.098) (-1787.801) -- 0:01:06 120000 -- (-1784.847) (-1788.005) [-1785.971] (-1789.726) * (-1786.862) [-1786.684] (-1784.068) (-1787.228) -- 0:01:06 Average standard deviation of split frequencies: 0.028649 120500 -- (-1784.925) (-1791.064) [-1784.318] (-1789.234) * (-1788.863) (-1788.136) [-1784.035] (-1785.144) -- 0:01:05 121000 -- [-1784.119] (-1788.519) (-1784.644) (-1787.233) * (-1787.319) (-1785.042) (-1785.519) [-1787.161] -- 0:01:05 121500 -- [-1784.688] (-1788.596) (-1790.165) (-1788.774) * [-1785.447] (-1784.855) (-1784.773) (-1785.978) -- 0:01:05 122000 -- [-1785.974] (-1788.591) (-1788.706) (-1786.978) * (-1786.115) (-1784.017) (-1784.002) [-1785.524] -- 0:01:04 122500 -- [-1784.975] (-1785.118) (-1788.351) (-1788.597) * (-1791.033) (-1784.366) [-1784.003] (-1785.820) -- 0:01:04 123000 -- (-1784.788) (-1787.028) [-1784.261] (-1790.293) * (-1794.124) (-1784.533) (-1784.003) [-1786.429] -- 0:01:04 123500 -- (-1785.323) (-1784.978) (-1784.841) [-1784.706] * (-1787.900) (-1783.803) [-1786.214] (-1789.652) -- 0:01:03 124000 -- (-1789.487) [-1786.075] (-1786.671) (-1784.099) * (-1785.499) (-1783.937) (-1786.579) [-1787.450] -- 0:01:03 124500 -- (-1784.387) [-1787.775] (-1787.111) (-1786.345) * (-1784.492) (-1784.697) (-1784.268) [-1785.593] -- 0:01:03 125000 -- (-1784.199) (-1786.684) (-1783.979) [-1786.946] * (-1785.358) (-1784.031) [-1786.043] (-1783.274) -- 0:01:03 Average standard deviation of split frequencies: 0.024942 125500 -- (-1786.676) (-1784.525) (-1784.189) [-1785.601] * (-1786.604) [-1785.617] (-1787.466) (-1784.125) -- 0:01:02 126000 -- (-1786.102) (-1784.776) (-1784.579) [-1785.460] * (-1786.121) [-1784.360] (-1786.512) (-1785.095) -- 0:01:02 126500 -- (-1785.589) [-1786.769] (-1784.496) (-1785.943) * (-1786.360) (-1784.555) [-1787.472] (-1784.179) -- 0:01:02 127000 -- (-1785.113) (-1786.895) (-1786.564) [-1785.714] * (-1784.283) (-1784.319) (-1785.218) [-1784.046] -- 0:01:01 127500 -- [-1784.186] (-1788.121) (-1786.391) (-1786.065) * [-1784.410] (-1785.792) (-1786.465) (-1784.506) -- 0:01:01 128000 -- [-1785.106] (-1786.979) (-1787.651) (-1783.849) * [-1784.304] (-1785.366) (-1786.270) (-1784.558) -- 0:01:01 128500 -- (-1788.783) (-1784.500) [-1788.049] (-1784.472) * (-1785.299) (-1787.055) [-1784.180] (-1786.329) -- 0:01:07 129000 -- (-1787.231) (-1784.887) (-1787.529) [-1783.827] * (-1784.399) [-1785.089] (-1785.040) (-1785.533) -- 0:01:07 129500 -- [-1784.857] (-1783.965) (-1786.053) (-1786.518) * (-1784.204) [-1784.801] (-1784.658) (-1787.889) -- 0:01:07 130000 -- (-1784.936) (-1784.368) (-1788.222) [-1786.201] * [-1786.273] (-1790.357) (-1784.404) (-1784.067) -- 0:01:06 Average standard deviation of split frequencies: 0.024051 130500 -- (-1785.725) [-1785.145] (-1787.214) (-1791.359) * (-1787.418) (-1791.510) (-1785.111) [-1784.101] -- 0:01:06 131000 -- (-1784.839) [-1783.919] (-1786.167) (-1786.552) * (-1785.937) (-1788.660) [-1785.315] (-1784.646) -- 0:01:06 131500 -- [-1786.158] (-1786.027) (-1784.193) (-1788.771) * (-1785.030) (-1787.056) [-1785.315] (-1784.451) -- 0:01:06 132000 -- (-1785.307) (-1784.554) [-1785.087] (-1784.343) * (-1784.415) (-1790.479) [-1786.063] (-1788.156) -- 0:01:05 132500 -- [-1785.242] (-1786.415) (-1788.515) (-1784.576) * (-1784.894) [-1785.974] (-1787.482) (-1787.739) -- 0:01:05 133000 -- (-1785.141) [-1783.934] (-1784.141) (-1786.736) * [-1785.156] (-1788.274) (-1790.237) (-1785.105) -- 0:01:05 133500 -- (-1788.287) (-1784.406) (-1786.035) [-1784.544] * (-1784.373) (-1788.316) [-1785.953] (-1784.669) -- 0:01:04 134000 -- (-1786.561) (-1789.406) [-1785.564] (-1785.318) * (-1784.879) [-1784.942] (-1787.596) (-1785.500) -- 0:01:04 134500 -- (-1787.013) [-1786.309] (-1787.150) (-1785.830) * (-1786.565) (-1785.386) (-1786.844) [-1784.408] -- 0:01:04 135000 -- [-1783.761] (-1784.846) (-1786.823) (-1787.187) * (-1784.727) [-1785.796] (-1785.646) (-1784.438) -- 0:01:04 Average standard deviation of split frequencies: 0.030040 135500 -- (-1786.212) [-1786.023] (-1788.483) (-1785.254) * [-1783.902] (-1786.504) (-1784.665) (-1784.953) -- 0:01:03 136000 -- (-1784.629) (-1785.653) [-1785.138] (-1787.272) * (-1784.352) [-1784.945] (-1785.074) (-1784.985) -- 0:01:03 136500 -- (-1785.391) [-1784.657] (-1785.066) (-1786.380) * (-1789.426) (-1791.317) [-1785.126] (-1785.502) -- 0:01:03 137000 -- (-1784.394) [-1784.494] (-1784.578) (-1789.093) * (-1786.315) [-1784.512] (-1787.391) (-1785.185) -- 0:01:02 137500 -- (-1787.527) (-1788.780) [-1784.247] (-1786.444) * (-1787.159) (-1789.250) (-1789.614) [-1784.533] -- 0:01:02 138000 -- (-1789.139) [-1785.703] (-1784.247) (-1785.137) * (-1790.697) (-1785.088) [-1785.888] (-1784.903) -- 0:01:02 138500 -- (-1784.523) (-1785.183) (-1785.099) [-1784.799] * (-1785.046) (-1790.310) [-1785.163] (-1785.719) -- 0:01:02 139000 -- [-1784.224] (-1785.983) (-1786.344) (-1786.222) * (-1784.653) (-1787.273) (-1787.109) [-1783.918] -- 0:01:01 139500 -- (-1788.937) (-1784.231) [-1784.808] (-1786.612) * [-1784.804] (-1784.681) (-1785.059) (-1788.718) -- 0:01:01 140000 -- [-1789.355] (-1784.999) (-1787.865) (-1786.607) * (-1787.504) [-1785.279] (-1784.702) (-1790.767) -- 0:01:01 Average standard deviation of split frequencies: 0.035746 140500 -- [-1786.536] (-1786.080) (-1786.918) (-1787.312) * (-1784.582) (-1785.875) (-1785.515) [-1787.106] -- 0:01:01 141000 -- (-1786.424) [-1787.327] (-1787.080) (-1786.388) * (-1788.145) [-1786.606] (-1786.231) (-1786.501) -- 0:01:00 141500 -- (-1788.760) [-1785.214] (-1789.194) (-1786.375) * (-1788.583) (-1784.085) (-1789.969) [-1783.979] -- 0:01:00 142000 -- [-1786.820] (-1786.720) (-1788.930) (-1787.660) * (-1787.650) [-1785.516] (-1788.010) (-1785.432) -- 0:01:00 142500 -- (-1786.086) [-1786.400] (-1794.311) (-1787.303) * (-1785.704) (-1787.944) (-1787.408) [-1784.579] -- 0:01:00 143000 -- (-1785.049) (-1786.262) (-1789.635) [-1787.868] * (-1787.980) (-1784.962) [-1784.851] (-1784.711) -- 0:01:05 143500 -- (-1785.662) (-1785.705) (-1787.010) [-1785.389] * (-1785.512) [-1784.375] (-1784.882) (-1789.600) -- 0:01:05 144000 -- (-1784.020) (-1786.565) [-1785.584] (-1784.125) * (-1789.007) (-1787.540) (-1785.500) [-1788.300] -- 0:01:05 144500 -- (-1784.266) (-1788.815) (-1785.739) [-1785.496] * (-1789.789) (-1787.776) [-1783.918] (-1786.300) -- 0:01:05 145000 -- (-1783.563) (-1786.618) [-1783.409] (-1784.896) * (-1785.169) (-1785.546) [-1787.372] (-1786.978) -- 0:01:04 Average standard deviation of split frequencies: 0.034441 145500 -- (-1784.084) (-1786.871) (-1786.436) [-1785.814] * (-1788.743) [-1784.755] (-1784.211) (-1785.801) -- 0:01:04 146000 -- [-1783.978] (-1786.224) (-1788.657) (-1787.589) * (-1789.916) (-1784.791) (-1785.474) [-1785.371] -- 0:01:04 146500 -- (-1783.947) (-1786.410) [-1786.674] (-1784.806) * [-1792.233] (-1786.625) (-1786.385) (-1785.408) -- 0:01:04 147000 -- [-1784.244] (-1786.080) (-1789.231) (-1785.118) * (-1791.383) (-1785.335) (-1787.805) [-1786.019] -- 0:01:03 147500 -- (-1784.294) [-1783.924] (-1784.564) (-1784.667) * [-1790.020] (-1786.142) (-1786.252) (-1786.506) -- 0:01:03 148000 -- (-1786.588) (-1785.578) [-1785.244] (-1786.097) * (-1790.498) [-1786.033] (-1785.153) (-1787.420) -- 0:01:03 148500 -- (-1784.659) (-1784.244) (-1784.907) [-1785.209] * [-1787.614] (-1784.929) (-1790.414) (-1785.800) -- 0:01:03 149000 -- [-1786.155] (-1785.808) (-1784.677) (-1787.703) * (-1786.021) (-1784.452) (-1788.271) [-1784.107] -- 0:01:02 149500 -- [-1785.335] (-1787.444) (-1784.854) (-1784.060) * (-1788.414) (-1784.460) [-1785.495] (-1785.144) -- 0:01:02 150000 -- (-1784.675) (-1787.094) (-1784.683) [-1786.492] * [-1791.340] (-1784.467) (-1785.009) (-1791.366) -- 0:01:02 Average standard deviation of split frequencies: 0.020859 150500 -- (-1784.981) (-1786.942) [-1786.290] (-1788.978) * [-1788.056] (-1783.575) (-1785.683) (-1785.116) -- 0:01:02 151000 -- [-1784.824] (-1785.673) (-1786.857) (-1785.022) * (-1786.162) (-1784.564) [-1786.599] (-1786.253) -- 0:01:01 151500 -- (-1783.813) (-1790.885) (-1787.455) [-1784.650] * (-1786.032) (-1783.799) [-1786.332] (-1785.615) -- 0:01:01 152000 -- [-1784.207] (-1785.846) (-1786.369) (-1787.035) * (-1787.102) [-1783.442] (-1785.435) (-1787.048) -- 0:01:01 152500 -- (-1784.526) (-1784.788) (-1787.980) [-1784.393] * [-1785.438] (-1785.334) (-1787.043) (-1784.177) -- 0:01:01 153000 -- (-1787.697) (-1785.121) (-1784.614) [-1784.546] * [-1786.778] (-1787.322) (-1785.192) (-1785.037) -- 0:01:00 153500 -- (-1784.199) (-1784.882) (-1785.272) [-1784.891] * [-1784.912] (-1784.361) (-1785.060) (-1786.357) -- 0:01:00 154000 -- (-1787.140) (-1789.139) [-1784.980] (-1786.262) * (-1786.844) (-1784.367) (-1784.573) [-1785.113] -- 0:01:00 154500 -- (-1795.650) [-1787.013] (-1786.078) (-1785.965) * [-1787.061] (-1787.242) (-1785.905) (-1785.585) -- 0:01:00 155000 -- (-1786.749) (-1784.031) (-1785.115) [-1784.402] * (-1785.433) (-1786.620) [-1784.260] (-1785.896) -- 0:00:59 Average standard deviation of split frequencies: 0.022160 155500 -- (-1787.986) (-1784.755) (-1785.626) [-1784.312] * [-1787.102] (-1787.093) (-1784.940) (-1787.402) -- 0:00:59 156000 -- (-1785.960) [-1784.482] (-1785.648) (-1788.647) * (-1788.487) (-1787.031) (-1785.117) [-1785.462] -- 0:00:59 156500 -- (-1785.552) [-1784.959] (-1786.699) (-1785.123) * (-1788.322) (-1785.113) [-1784.998] (-1788.910) -- 0:00:59 157000 -- (-1787.309) [-1785.374] (-1785.026) (-1788.449) * (-1794.932) (-1785.829) [-1787.079] (-1786.807) -- 0:00:59 157500 -- (-1786.768) [-1786.302] (-1784.019) (-1786.621) * (-1784.643) (-1785.940) (-1784.841) [-1787.642] -- 0:01:04 158000 -- (-1785.680) [-1785.400] (-1784.575) (-1784.911) * [-1784.739] (-1783.361) (-1785.598) (-1793.286) -- 0:01:03 158500 -- (-1785.253) [-1785.466] (-1788.119) (-1786.659) * (-1792.284) (-1783.429) [-1785.099] (-1784.808) -- 0:01:03 159000 -- [-1784.813] (-1786.427) (-1786.189) (-1788.635) * [-1789.806] (-1786.906) (-1787.151) (-1786.572) -- 0:01:03 159500 -- (-1784.268) [-1785.007] (-1785.360) (-1786.339) * (-1783.526) (-1784.949) (-1788.238) [-1785.687] -- 0:01:03 160000 -- (-1784.415) [-1784.255] (-1787.857) (-1785.940) * [-1786.721] (-1786.191) (-1790.041) (-1785.738) -- 0:01:02 Average standard deviation of split frequencies: 0.021516 160500 -- (-1789.413) (-1784.507) [-1784.141] (-1784.118) * (-1786.168) (-1788.653) (-1789.124) [-1791.125] -- 0:01:02 161000 -- (-1787.039) (-1785.686) (-1786.018) [-1788.793] * (-1784.431) (-1785.616) [-1786.931] (-1785.924) -- 0:01:02 161500 -- [-1784.077] (-1787.781) (-1785.125) (-1788.636) * (-1784.100) (-1784.846) [-1786.464] (-1787.834) -- 0:01:02 162000 -- (-1786.203) [-1786.585] (-1784.821) (-1785.477) * (-1785.485) [-1783.636] (-1788.048) (-1791.293) -- 0:01:02 162500 -- (-1786.466) (-1788.881) (-1787.671) [-1786.236] * [-1786.122] (-1786.354) (-1790.613) (-1785.359) -- 0:01:01 163000 -- (-1785.134) (-1785.019) [-1786.635] (-1785.594) * (-1787.482) (-1785.943) [-1785.806] (-1787.132) -- 0:01:01 163500 -- (-1785.744) (-1788.104) (-1787.039) [-1784.789] * (-1786.283) (-1787.192) (-1785.383) [-1788.108] -- 0:01:01 164000 -- (-1785.639) [-1786.671] (-1786.459) (-1787.183) * (-1784.411) [-1787.675] (-1786.640) (-1786.494) -- 0:01:01 164500 -- [-1784.666] (-1787.322) (-1786.098) (-1786.273) * (-1786.480) (-1788.365) [-1787.594] (-1785.855) -- 0:01:00 165000 -- (-1786.368) (-1788.356) [-1785.170] (-1785.766) * (-1786.611) (-1784.568) [-1787.934] (-1786.659) -- 0:01:00 Average standard deviation of split frequencies: 0.018932 165500 -- (-1785.458) [-1791.353] (-1786.146) (-1788.866) * (-1785.715) (-1786.499) [-1785.378] (-1785.818) -- 0:01:00 166000 -- [-1786.650] (-1785.571) (-1786.115) (-1786.318) * (-1785.730) (-1785.315) [-1785.328] (-1784.260) -- 0:01:00 166500 -- [-1785.024] (-1786.166) (-1786.743) (-1785.863) * (-1783.980) [-1786.419] (-1788.117) (-1783.860) -- 0:01:00 167000 -- (-1784.848) [-1785.279] (-1786.914) (-1785.074) * [-1785.377] (-1784.428) (-1785.561) (-1783.867) -- 0:00:59 167500 -- (-1785.612) [-1785.245] (-1783.852) (-1786.308) * (-1788.261) [-1783.561] (-1785.060) (-1783.998) -- 0:00:59 168000 -- [-1784.494] (-1786.374) (-1783.612) (-1785.368) * (-1787.022) (-1786.166) [-1785.648] (-1787.098) -- 0:00:59 168500 -- (-1785.017) (-1786.569) (-1783.839) [-1787.526] * (-1786.533) [-1787.066] (-1784.373) (-1784.670) -- 0:00:59 169000 -- (-1785.549) (-1788.539) (-1784.716) [-1785.190] * (-1785.420) (-1787.056) (-1785.100) [-1785.682] -- 0:00:59 169500 -- [-1787.590] (-1786.257) (-1786.163) (-1788.824) * [-1786.100] (-1787.155) (-1790.780) (-1785.923) -- 0:00:58 170000 -- (-1783.976) [-1784.546] (-1788.218) (-1788.327) * (-1784.605) (-1789.517) (-1785.754) [-1786.413] -- 0:00:58 Average standard deviation of split frequencies: 0.014731 170500 -- (-1784.597) (-1792.699) [-1786.075] (-1786.531) * [-1786.659] (-1788.434) (-1785.395) (-1785.879) -- 0:00:58 171000 -- (-1789.609) (-1788.999) (-1786.111) [-1784.280] * (-1784.455) (-1788.877) (-1789.166) [-1785.483] -- 0:00:58 171500 -- (-1788.103) [-1785.800] (-1787.939) (-1785.725) * [-1785.979] (-1789.169) (-1785.858) (-1785.991) -- 0:01:02 172000 -- (-1785.414) [-1783.428] (-1791.742) (-1783.704) * [-1784.349] (-1789.730) (-1785.171) (-1785.010) -- 0:01:02 172500 -- [-1783.605] (-1785.047) (-1791.863) (-1783.915) * [-1787.280] (-1790.468) (-1786.175) (-1784.777) -- 0:01:02 173000 -- [-1783.497] (-1789.682) (-1790.386) (-1784.372) * (-1784.362) [-1784.174] (-1785.191) (-1785.662) -- 0:01:02 173500 -- [-1783.747] (-1787.127) (-1785.881) (-1788.209) * (-1784.420) [-1784.388] (-1784.202) (-1785.157) -- 0:01:01 174000 -- (-1788.685) (-1785.930) [-1786.164] (-1786.191) * (-1786.196) (-1784.344) [-1784.023] (-1791.682) -- 0:01:01 174500 -- (-1787.333) (-1785.986) [-1787.066] (-1784.996) * [-1784.698] (-1784.542) (-1785.752) (-1790.788) -- 0:01:01 175000 -- (-1785.857) (-1785.874) (-1786.652) [-1784.294] * (-1785.337) (-1786.418) (-1785.625) [-1787.197] -- 0:01:01 Average standard deviation of split frequencies: 0.016071 175500 -- [-1785.417] (-1784.057) (-1784.756) (-1785.283) * (-1785.108) [-1785.876] (-1785.746) (-1784.743) -- 0:01:01 176000 -- (-1785.932) [-1785.517] (-1786.317) (-1787.143) * (-1786.808) [-1785.624] (-1785.274) (-1784.521) -- 0:01:00 176500 -- (-1786.282) (-1787.355) [-1783.722] (-1788.188) * (-1786.278) (-1784.590) [-1785.338] (-1784.646) -- 0:01:00 177000 -- (-1786.052) (-1786.120) [-1785.612] (-1785.300) * (-1784.628) (-1783.737) (-1785.017) [-1783.751] -- 0:01:00 177500 -- (-1786.008) (-1787.857) (-1785.225) [-1785.721] * (-1784.685) (-1785.322) [-1785.923] (-1785.395) -- 0:01:00 178000 -- (-1785.777) (-1786.609) (-1784.233) [-1785.365] * (-1787.243) [-1784.701] (-1785.177) (-1785.729) -- 0:01:00 178500 -- (-1785.264) (-1787.897) (-1784.213) [-1784.184] * (-1786.182) (-1785.414) (-1788.074) [-1786.648] -- 0:00:59 179000 -- (-1786.356) [-1785.823] (-1784.409) (-1786.481) * (-1785.887) (-1787.719) (-1785.426) [-1784.645] -- 0:00:59 179500 -- (-1786.249) (-1787.046) [-1783.294] (-1784.887) * (-1786.331) [-1784.250] (-1784.088) (-1784.249) -- 0:00:59 180000 -- (-1783.947) (-1786.801) [-1784.245] (-1785.156) * [-1785.905] (-1783.947) (-1784.757) (-1784.009) -- 0:00:59 Average standard deviation of split frequencies: 0.024353 180500 -- [-1784.285] (-1784.304) (-1786.023) (-1785.151) * [-1784.323] (-1784.792) (-1786.139) (-1787.309) -- 0:00:59 181000 -- (-1785.038) [-1783.898] (-1784.106) (-1784.866) * [-1784.593] (-1784.032) (-1786.713) (-1783.912) -- 0:00:58 181500 -- (-1787.957) (-1785.405) (-1787.010) [-1785.897] * (-1786.338) [-1785.059] (-1792.594) (-1783.442) -- 0:00:58 182000 -- (-1784.225) [-1783.567] (-1784.791) (-1787.492) * (-1786.300) [-1785.675] (-1789.667) (-1785.630) -- 0:00:58 182500 -- (-1784.224) (-1786.563) [-1785.104] (-1793.184) * [-1784.977] (-1788.913) (-1786.784) (-1786.877) -- 0:00:58 183000 -- (-1785.574) (-1784.297) [-1784.228] (-1786.902) * (-1784.031) (-1787.240) (-1785.056) [-1784.282] -- 0:00:58 183500 -- (-1786.392) [-1783.548] (-1786.187) (-1786.972) * [-1784.236] (-1787.758) (-1784.410) (-1785.736) -- 0:00:57 184000 -- (-1785.442) (-1785.368) [-1786.263] (-1788.880) * (-1790.395) (-1787.073) [-1784.957] (-1787.495) -- 0:00:57 184500 -- [-1784.395] (-1785.750) (-1784.948) (-1786.841) * (-1789.327) (-1787.639) [-1784.995] (-1787.923) -- 0:00:57 185000 -- (-1783.960) [-1784.423] (-1783.652) (-1788.241) * (-1785.801) (-1786.375) [-1784.060] (-1787.612) -- 0:00:57 Average standard deviation of split frequencies: 0.015207 185500 -- [-1784.210] (-1784.190) (-1783.686) (-1785.811) * [-1788.509] (-1785.596) (-1787.594) (-1783.872) -- 0:00:57 186000 -- (-1786.095) [-1785.378] (-1783.371) (-1785.071) * (-1789.377) (-1784.782) (-1785.505) [-1785.020] -- 0:01:01 186500 -- (-1787.915) (-1784.706) [-1783.539] (-1784.942) * (-1786.148) (-1786.178) [-1787.174] (-1786.689) -- 0:01:01 187000 -- (-1784.732) [-1785.413] (-1784.970) (-1785.265) * (-1785.177) (-1786.223) (-1784.836) [-1786.636] -- 0:01:00 187500 -- [-1784.652] (-1786.418) (-1784.839) (-1784.696) * (-1785.368) (-1787.806) (-1785.691) [-1788.070] -- 0:01:00 188000 -- (-1785.540) (-1785.524) (-1785.239) [-1787.420] * (-1792.825) (-1788.212) (-1784.423) [-1787.848] -- 0:01:00 188500 -- (-1783.914) (-1786.037) (-1788.203) [-1784.824] * (-1785.358) (-1786.194) [-1784.423] (-1783.820) -- 0:01:00 189000 -- (-1785.395) [-1785.010] (-1788.198) (-1784.872) * (-1784.901) (-1791.152) [-1786.027] (-1783.820) -- 0:01:00 189500 -- (-1786.467) (-1784.934) [-1785.969] (-1784.353) * [-1784.663] (-1790.085) (-1784.206) (-1786.131) -- 0:00:59 190000 -- (-1786.107) (-1784.111) [-1786.377] (-1784.740) * [-1785.912] (-1783.569) (-1784.448) (-1785.676) -- 0:00:59 Average standard deviation of split frequencies: 0.014834 190500 -- (-1785.620) [-1784.382] (-1788.159) (-1783.909) * (-1785.418) (-1784.173) (-1784.802) [-1786.474] -- 0:00:59 191000 -- (-1786.216) [-1786.282] (-1788.899) (-1786.676) * (-1783.634) (-1784.140) [-1784.302] (-1785.637) -- 0:00:59 191500 -- (-1785.358) (-1785.763) (-1785.968) [-1784.191] * (-1784.525) (-1783.449) (-1784.624) [-1785.828] -- 0:00:59 192000 -- [-1785.566] (-1785.287) (-1789.113) (-1783.786) * [-1783.715] (-1783.674) (-1785.377) (-1785.829) -- 0:00:58 192500 -- (-1785.706) (-1785.592) (-1786.027) [-1783.950] * (-1783.464) (-1784.130) [-1785.306] (-1784.703) -- 0:00:58 193000 -- (-1786.238) (-1784.281) (-1784.602) [-1784.202] * (-1784.461) (-1783.731) [-1785.774] (-1786.555) -- 0:00:58 193500 -- (-1785.270) (-1784.539) (-1789.382) [-1784.004] * (-1784.115) (-1784.647) (-1788.925) [-1786.387] -- 0:00:58 194000 -- (-1787.918) (-1787.651) [-1787.000] (-1783.836) * (-1784.800) (-1784.023) (-1791.789) [-1788.002] -- 0:00:58 194500 -- (-1787.102) (-1787.531) [-1785.129] (-1786.202) * (-1789.129) (-1785.582) (-1788.416) [-1786.989] -- 0:00:57 195000 -- (-1785.098) (-1790.932) (-1785.182) [-1785.844] * (-1789.666) [-1783.772] (-1784.628) (-1790.327) -- 0:00:57 Average standard deviation of split frequencies: 0.014431 195500 -- (-1787.121) (-1788.285) [-1789.461] (-1785.414) * (-1784.605) [-1783.617] (-1785.342) (-1785.240) -- 0:00:57 196000 -- (-1786.013) [-1787.195] (-1784.919) (-1784.935) * (-1786.024) (-1784.081) [-1784.142] (-1785.453) -- 0:00:57 196500 -- (-1784.817) [-1787.518] (-1783.896) (-1784.425) * (-1787.454) [-1783.925] (-1784.029) (-1787.021) -- 0:00:57 197000 -- (-1784.844) (-1786.831) (-1785.304) [-1784.358] * [-1786.281] (-1785.067) (-1787.440) (-1785.954) -- 0:00:57 197500 -- (-1783.960) (-1786.268) (-1784.560) [-1785.313] * (-1793.590) (-1785.079) [-1785.389] (-1787.983) -- 0:00:56 198000 -- [-1785.024] (-1785.630) (-1785.602) (-1784.590) * [-1786.679] (-1784.590) (-1785.285) (-1790.158) -- 0:00:56 198500 -- (-1783.826) (-1785.803) (-1786.461) [-1784.450] * (-1786.069) (-1784.282) [-1785.463] (-1788.530) -- 0:00:56 199000 -- [-1784.679] (-1785.109) (-1786.972) (-1784.208) * [-1786.834] (-1784.724) (-1784.148) (-1788.522) -- 0:00:56 199500 -- (-1784.387) [-1787.113] (-1785.818) (-1787.444) * [-1784.173] (-1785.994) (-1783.546) (-1788.937) -- 0:00:56 200000 -- (-1785.610) (-1786.994) (-1785.841) [-1784.312] * [-1784.413] (-1789.010) (-1783.990) (-1788.089) -- 0:00:55 Average standard deviation of split frequencies: 0.015661 200500 -- (-1786.932) (-1786.848) [-1785.612] (-1784.643) * [-1784.637] (-1787.754) (-1784.269) (-1785.002) -- 0:00:59 201000 -- (-1785.214) (-1785.649) (-1785.145) [-1786.370] * (-1788.035) (-1786.412) (-1784.821) [-1787.280] -- 0:00:59 201500 -- (-1785.933) (-1785.135) [-1787.227] (-1789.942) * (-1789.275) (-1784.852) [-1784.166] (-1784.563) -- 0:00:59 202000 -- (-1787.111) [-1784.193] (-1784.240) (-1784.999) * (-1790.696) [-1785.245] (-1784.583) (-1790.126) -- 0:00:59 202500 -- [-1785.229] (-1784.138) (-1789.398) (-1785.887) * [-1784.769] (-1784.079) (-1784.335) (-1783.695) -- 0:00:59 203000 -- (-1785.606) (-1790.108) (-1788.849) [-1784.605] * (-1786.784) (-1785.495) (-1786.744) [-1785.139] -- 0:00:58 203500 -- (-1785.283) [-1785.086] (-1786.518) (-1785.332) * (-1789.386) [-1785.586] (-1786.744) (-1784.289) -- 0:00:58 204000 -- (-1788.399) (-1784.143) (-1789.684) [-1784.423] * [-1783.924] (-1785.775) (-1785.255) (-1783.889) -- 0:00:58 204500 -- (-1785.343) (-1787.952) [-1786.453] (-1785.666) * (-1785.000) (-1786.667) (-1784.549) [-1784.013] -- 0:00:58 205000 -- [-1785.304] (-1791.299) (-1788.635) (-1786.460) * (-1784.994) (-1785.427) [-1785.006] (-1784.209) -- 0:00:58 Average standard deviation of split frequencies: 0.010679 205500 -- (-1785.286) (-1791.892) (-1785.843) [-1785.384] * [-1788.136] (-1785.157) (-1784.532) (-1787.991) -- 0:00:57 206000 -- [-1784.456] (-1789.849) (-1784.102) (-1786.847) * (-1791.023) (-1785.356) [-1792.176] (-1784.336) -- 0:00:57 206500 -- (-1785.544) (-1787.663) [-1784.287] (-1784.839) * (-1794.053) (-1783.579) (-1789.403) [-1783.710] -- 0:00:57 207000 -- [-1785.836] (-1788.731) (-1784.936) (-1788.726) * (-1789.339) (-1783.579) (-1787.011) [-1787.416] -- 0:00:57 207500 -- (-1786.402) (-1786.698) [-1785.853] (-1785.867) * (-1786.812) (-1784.442) [-1786.152] (-1784.794) -- 0:00:57 208000 -- (-1785.752) (-1786.133) (-1785.757) [-1786.929] * (-1786.573) [-1783.509] (-1784.226) (-1785.841) -- 0:00:57 208500 -- (-1783.902) [-1786.467] (-1787.752) (-1786.170) * (-1785.085) [-1783.627] (-1786.370) (-1785.016) -- 0:00:56 209000 -- [-1784.886] (-1788.825) (-1786.472) (-1786.387) * [-1784.229] (-1784.435) (-1784.600) (-1783.411) -- 0:00:56 209500 -- (-1785.013) [-1785.421] (-1785.919) (-1785.212) * (-1783.765) [-1783.609] (-1785.321) (-1784.843) -- 0:00:56 210000 -- (-1785.453) (-1784.622) [-1787.056] (-1785.483) * (-1785.888) (-1784.997) (-1787.537) [-1784.648] -- 0:00:56 Average standard deviation of split frequencies: 0.008951 210500 -- (-1786.855) (-1784.912) [-1787.544] (-1784.605) * [-1783.431] (-1785.121) (-1786.259) (-1787.616) -- 0:00:56 211000 -- (-1788.197) [-1784.655] (-1788.596) (-1785.362) * [-1783.374] (-1785.294) (-1787.140) (-1785.914) -- 0:00:56 211500 -- (-1787.336) (-1785.199) [-1786.517] (-1784.183) * (-1783.640) [-1783.726] (-1787.820) (-1785.001) -- 0:00:55 212000 -- [-1786.570] (-1784.342) (-1786.657) (-1789.342) * [-1783.637] (-1784.208) (-1788.177) (-1784.399) -- 0:00:55 212500 -- (-1786.223) [-1786.615] (-1786.678) (-1784.480) * (-1785.287) [-1788.113] (-1786.300) (-1784.020) -- 0:00:55 213000 -- (-1785.996) (-1786.269) [-1783.706] (-1784.088) * [-1784.336] (-1785.047) (-1785.344) (-1785.787) -- 0:00:55 213500 -- (-1787.224) (-1785.561) [-1786.089] (-1783.609) * (-1784.177) [-1784.438] (-1785.587) (-1785.284) -- 0:00:55 214000 -- (-1783.665) (-1789.834) (-1785.148) [-1783.751] * [-1784.427] (-1786.380) (-1786.500) (-1785.276) -- 0:00:55 214500 -- (-1784.472) (-1789.906) (-1784.774) [-1787.336] * (-1784.433) (-1788.380) [-1785.660] (-1784.582) -- 0:00:54 215000 -- (-1784.088) (-1786.143) [-1786.987] (-1788.985) * [-1783.876] (-1784.733) (-1785.342) (-1786.013) -- 0:00:58 Average standard deviation of split frequencies: 0.010185 215500 -- (-1783.390) [-1785.221] (-1787.911) (-1787.705) * (-1784.795) [-1785.145] (-1786.188) (-1785.592) -- 0:00:58 216000 -- (-1783.821) (-1786.675) [-1784.338] (-1786.118) * (-1786.980) (-1787.577) (-1784.676) [-1785.555] -- 0:00:58 216500 -- (-1785.737) (-1784.726) (-1784.692) [-1786.438] * (-1785.327) (-1791.515) (-1785.910) [-1784.079] -- 0:00:57 217000 -- (-1785.766) (-1784.097) (-1785.921) [-1785.798] * (-1786.165) (-1788.096) [-1787.055] (-1785.042) -- 0:00:57 217500 -- (-1785.346) [-1786.233] (-1787.965) (-1784.833) * (-1785.072) (-1789.314) [-1784.738] (-1783.593) -- 0:00:57 218000 -- [-1786.188] (-1785.115) (-1787.913) (-1786.290) * [-1784.792] (-1784.402) (-1785.104) (-1785.044) -- 0:00:57 218500 -- (-1786.626) (-1787.704) [-1785.671] (-1785.964) * (-1787.678) (-1784.474) [-1784.570] (-1786.081) -- 0:00:57 219000 -- (-1786.229) (-1786.969) (-1786.931) [-1785.124] * [-1784.443] (-1786.493) (-1785.804) (-1787.396) -- 0:00:57 219500 -- (-1786.126) (-1785.986) [-1785.376] (-1785.009) * (-1784.320) [-1786.419] (-1785.666) (-1784.101) -- 0:00:56 220000 -- [-1785.287] (-1786.519) (-1787.298) (-1786.842) * [-1785.589] (-1786.190) (-1784.873) (-1784.598) -- 0:00:56 Average standard deviation of split frequencies: 0.005697 220500 -- (-1786.679) (-1786.724) [-1787.794] (-1790.980) * (-1785.286) (-1789.020) [-1785.026] (-1785.079) -- 0:00:56 221000 -- (-1784.568) (-1786.702) (-1790.112) [-1786.493] * [-1784.799] (-1784.646) (-1787.384) (-1788.446) -- 0:00:56 221500 -- (-1784.425) [-1786.165] (-1787.687) (-1789.830) * [-1786.344] (-1788.529) (-1787.852) (-1784.720) -- 0:00:56 222000 -- [-1786.047] (-1788.385) (-1785.589) (-1785.626) * (-1784.621) (-1786.071) [-1787.571] (-1786.005) -- 0:00:56 222500 -- [-1788.212] (-1784.936) (-1784.452) (-1785.451) * (-1785.645) [-1785.145] (-1791.043) (-1787.609) -- 0:00:55 223000 -- (-1785.658) (-1786.318) (-1784.197) [-1785.227] * [-1785.678] (-1785.966) (-1786.581) (-1787.983) -- 0:00:55 223500 -- (-1787.791) (-1785.371) (-1784.729) [-1785.926] * (-1785.209) (-1786.494) [-1786.911] (-1786.639) -- 0:00:55 224000 -- (-1786.512) (-1783.619) (-1786.202) [-1785.492] * [-1785.984] (-1788.346) (-1788.276) (-1785.544) -- 0:00:55 224500 -- (-1784.722) (-1790.571) (-1784.242) [-1783.696] * (-1783.822) (-1786.884) (-1784.650) [-1785.155] -- 0:00:55 225000 -- (-1784.726) (-1786.266) (-1784.177) [-1783.887] * (-1784.159) [-1783.457] (-1786.754) (-1784.862) -- 0:00:55 Average standard deviation of split frequencies: 0.005562 225500 -- (-1784.919) [-1787.613] (-1785.033) (-1784.011) * (-1788.354) (-1785.573) (-1784.470) [-1784.438] -- 0:00:54 226000 -- (-1784.919) [-1788.216] (-1786.690) (-1786.093) * (-1784.818) (-1787.628) [-1785.987] (-1783.867) -- 0:00:54 226500 -- [-1783.621] (-1791.813) (-1786.700) (-1785.843) * (-1783.644) [-1787.767] (-1784.875) (-1785.220) -- 0:00:54 227000 -- (-1784.862) [-1785.903] (-1785.918) (-1783.745) * (-1783.642) [-1787.826] (-1784.959) (-1784.099) -- 0:00:54 227500 -- (-1785.504) (-1784.988) [-1784.822] (-1785.693) * (-1784.783) (-1787.535) (-1787.091) [-1784.647] -- 0:00:54 228000 -- (-1784.337) [-1788.428] (-1788.335) (-1785.231) * [-1784.388] (-1785.916) (-1785.796) (-1787.170) -- 0:00:54 228500 -- (-1787.611) (-1786.123) (-1787.155) [-1788.037] * (-1787.651) [-1785.506] (-1786.219) (-1789.286) -- 0:00:54 229000 -- [-1786.639] (-1783.988) (-1785.999) (-1791.640) * (-1785.494) (-1785.136) (-1787.465) [-1787.607] -- 0:00:57 229500 -- (-1793.706) (-1785.664) [-1786.301] (-1787.061) * [-1783.613] (-1785.483) (-1787.662) (-1784.736) -- 0:00:57 230000 -- (-1792.717) (-1788.499) (-1786.301) [-1786.168] * (-1783.393) (-1785.656) (-1787.255) [-1787.329] -- 0:00:56 Average standard deviation of split frequencies: 0.006812 230500 -- (-1788.054) (-1784.442) [-1785.879] (-1784.662) * (-1787.265) [-1784.845] (-1786.241) (-1787.818) -- 0:00:56 231000 -- (-1787.530) (-1784.800) (-1784.856) [-1785.950] * [-1784.089] (-1785.020) (-1785.399) (-1785.811) -- 0:00:56 231500 -- (-1784.673) (-1784.856) [-1785.663] (-1785.166) * (-1786.093) (-1785.249) (-1788.028) [-1784.429] -- 0:00:56 232000 -- (-1792.397) [-1786.679] (-1783.946) (-1786.131) * (-1783.714) (-1786.097) (-1783.829) [-1791.967] -- 0:00:56 232500 -- (-1787.268) (-1786.106) [-1787.576] (-1787.137) * [-1784.060] (-1788.152) (-1784.363) (-1789.184) -- 0:00:56 233000 -- [-1787.220] (-1785.883) (-1787.701) (-1786.957) * (-1784.963) (-1787.510) (-1785.132) [-1784.970] -- 0:00:55 233500 -- (-1785.858) (-1787.118) (-1787.886) [-1784.903] * [-1784.907] (-1785.104) (-1786.566) (-1785.942) -- 0:00:55 234000 -- [-1784.492] (-1787.223) (-1786.773) (-1787.093) * (-1786.638) (-1785.094) (-1785.954) [-1786.213] -- 0:00:55 234500 -- (-1786.771) (-1785.191) [-1784.245] (-1788.579) * [-1788.881] (-1786.027) (-1785.864) (-1788.374) -- 0:00:55 235000 -- [-1787.128] (-1787.694) (-1788.827) (-1787.435) * (-1784.563) [-1784.603] (-1784.656) (-1786.108) -- 0:00:55 Average standard deviation of split frequencies: 0.009322 235500 -- [-1784.938] (-1785.670) (-1783.899) (-1786.074) * (-1784.457) [-1785.618] (-1786.127) (-1786.188) -- 0:00:55 236000 -- (-1784.585) (-1788.052) (-1785.524) [-1785.575] * (-1787.115) (-1791.159) [-1790.646] (-1787.077) -- 0:00:55 236500 -- (-1788.203) (-1788.407) [-1785.978] (-1786.692) * (-1790.697) (-1785.289) [-1786.671] (-1786.603) -- 0:00:54 237000 -- [-1786.860] (-1787.892) (-1784.245) (-1787.093) * [-1786.297] (-1784.956) (-1785.151) (-1787.603) -- 0:00:54 237500 -- (-1787.878) (-1785.126) (-1784.938) [-1786.325] * (-1787.704) (-1786.075) [-1784.827] (-1785.221) -- 0:00:54 238000 -- [-1786.940] (-1786.279) (-1787.440) (-1785.145) * [-1784.806] (-1784.849) (-1784.729) (-1787.407) -- 0:00:54 238500 -- (-1787.301) (-1785.864) (-1786.773) [-1783.734] * [-1784.304] (-1784.594) (-1783.729) (-1786.271) -- 0:00:54 239000 -- (-1787.177) (-1784.448) (-1785.264) [-1783.494] * (-1785.133) (-1785.766) [-1784.318] (-1784.803) -- 0:00:54 239500 -- [-1786.619] (-1784.688) (-1785.417) (-1787.874) * (-1787.059) [-1785.528] (-1784.655) (-1786.588) -- 0:00:53 240000 -- [-1785.364] (-1783.542) (-1785.791) (-1786.803) * (-1785.689) (-1788.592) [-1784.730] (-1784.159) -- 0:00:53 Average standard deviation of split frequencies: 0.013058 240500 -- [-1786.545] (-1785.457) (-1787.227) (-1791.304) * (-1786.412) [-1786.908] (-1784.671) (-1784.948) -- 0:00:53 241000 -- (-1786.179) [-1791.663] (-1788.516) (-1785.085) * (-1786.109) [-1785.235] (-1784.436) (-1784.096) -- 0:00:53 241500 -- (-1785.212) [-1785.263] (-1787.893) (-1786.068) * [-1783.809] (-1786.480) (-1788.313) (-1784.376) -- 0:00:53 242000 -- [-1786.124] (-1785.301) (-1786.663) (-1784.560) * (-1783.445) (-1784.997) (-1786.306) [-1784.461] -- 0:00:53 242500 -- [-1784.343] (-1784.228) (-1786.201) (-1784.924) * (-1784.598) (-1786.546) (-1786.018) [-1784.795] -- 0:00:53 243000 -- (-1783.898) [-1785.515] (-1784.073) (-1784.753) * (-1784.176) [-1789.157] (-1785.068) (-1784.242) -- 0:00:56 243500 -- [-1784.540] (-1785.184) (-1783.994) (-1785.699) * (-1783.974) (-1784.549) (-1785.250) [-1784.694] -- 0:00:55 244000 -- (-1791.120) [-1785.854] (-1783.436) (-1785.688) * (-1784.062) (-1786.341) (-1785.647) [-1785.193] -- 0:00:55 244500 -- (-1790.220) (-1785.568) [-1785.659] (-1785.892) * (-1783.842) (-1786.182) [-1787.919] (-1786.051) -- 0:00:55 245000 -- (-1789.722) [-1788.079] (-1784.327) (-1787.131) * (-1783.781) [-1787.644] (-1786.434) (-1784.459) -- 0:00:55 Average standard deviation of split frequencies: 0.014053 245500 -- [-1785.722] (-1789.895) (-1785.935) (-1785.590) * (-1783.782) [-1784.962] (-1785.923) (-1783.934) -- 0:00:55 246000 -- [-1785.705] (-1783.706) (-1785.951) (-1791.322) * [-1784.840] (-1785.469) (-1787.267) (-1784.040) -- 0:00:55 246500 -- (-1786.571) (-1783.742) [-1787.531] (-1789.090) * (-1788.681) (-1786.288) [-1785.786] (-1789.355) -- 0:00:55 247000 -- [-1785.420] (-1784.107) (-1787.128) (-1790.355) * (-1786.595) [-1785.376] (-1785.842) (-1785.538) -- 0:00:54 247500 -- (-1785.642) (-1784.557) (-1786.629) [-1791.342] * (-1788.308) (-1784.205) [-1786.484] (-1786.103) -- 0:00:54 248000 -- (-1784.838) [-1785.054] (-1784.868) (-1787.786) * (-1787.893) (-1785.672) [-1785.347] (-1786.576) -- 0:00:54 248500 -- (-1784.400) (-1784.868) (-1784.778) [-1785.557] * (-1788.492) (-1785.218) (-1784.957) [-1785.550] -- 0:00:54 249000 -- (-1786.039) (-1783.900) [-1785.173] (-1785.306) * [-1785.377] (-1784.211) (-1784.375) (-1786.498) -- 0:00:54 249500 -- (-1790.817) (-1783.943) [-1787.634] (-1784.379) * (-1787.388) (-1785.378) (-1785.382) [-1784.738] -- 0:00:54 250000 -- (-1786.435) (-1784.044) (-1792.127) [-1783.814] * [-1788.402] (-1787.524) (-1785.429) (-1789.943) -- 0:00:54 Average standard deviation of split frequencies: 0.017552 250500 -- (-1787.763) (-1785.707) [-1786.167] (-1784.133) * (-1786.920) (-1786.220) [-1784.066] (-1786.605) -- 0:00:53 251000 -- (-1789.815) (-1787.229) (-1785.262) [-1784.144] * (-1787.773) [-1784.215] (-1784.301) (-1784.155) -- 0:00:53 251500 -- (-1788.706) (-1788.124) [-1784.787] (-1784.674) * (-1789.413) (-1785.501) (-1785.451) [-1785.953] -- 0:00:53 252000 -- (-1784.484) (-1787.024) (-1786.195) [-1784.041] * (-1787.186) (-1784.411) [-1784.324] (-1789.999) -- 0:00:53 252500 -- [-1784.880] (-1786.491) (-1784.944) (-1786.433) * (-1784.829) (-1785.146) (-1783.945) [-1787.500] -- 0:00:53 253000 -- [-1784.634] (-1786.715) (-1784.103) (-1784.465) * (-1784.854) (-1784.471) (-1785.748) [-1788.323] -- 0:00:53 253500 -- [-1785.594] (-1785.951) (-1783.660) (-1783.306) * (-1785.880) (-1784.534) [-1783.461] (-1785.162) -- 0:00:53 254000 -- (-1786.122) [-1787.272] (-1786.982) (-1784.663) * (-1784.746) (-1784.493) (-1783.461) [-1785.022] -- 0:00:52 254500 -- (-1784.429) (-1786.474) [-1786.518] (-1785.433) * [-1786.150] (-1786.091) (-1783.593) (-1783.854) -- 0:00:52 255000 -- [-1783.416] (-1785.703) (-1789.519) (-1791.953) * (-1785.822) [-1786.102] (-1784.111) (-1785.969) -- 0:00:52 Average standard deviation of split frequencies: 0.014731 255500 -- (-1785.614) [-1785.008] (-1785.550) (-1786.457) * (-1786.296) (-1787.215) [-1786.367] (-1786.691) -- 0:00:52 256000 -- [-1784.259] (-1788.242) (-1786.159) (-1786.176) * (-1784.386) [-1786.494] (-1785.781) (-1786.708) -- 0:00:52 256500 -- [-1784.757] (-1790.475) (-1786.672) (-1785.216) * [-1783.708] (-1784.691) (-1787.450) (-1788.056) -- 0:00:52 257000 -- [-1787.503] (-1790.965) (-1787.009) (-1785.216) * (-1784.450) [-1784.626] (-1783.250) (-1785.196) -- 0:00:52 257500 -- (-1784.781) (-1790.065) (-1786.456) [-1784.477] * (-1784.168) (-1789.826) (-1784.937) [-1784.659] -- 0:00:54 258000 -- (-1784.809) (-1790.214) (-1787.384) [-1783.977] * [-1786.127] (-1788.073) (-1784.880) (-1784.340) -- 0:00:54 258500 -- (-1783.758) [-1786.810] (-1785.535) (-1791.402) * (-1784.596) (-1785.461) [-1784.169] (-1787.328) -- 0:00:54 259000 -- (-1789.099) (-1786.035) [-1784.902] (-1787.002) * (-1788.695) [-1784.574] (-1787.340) (-1785.438) -- 0:00:54 259500 -- (-1784.697) [-1784.884] (-1787.765) (-1784.651) * [-1784.772] (-1784.660) (-1785.132) (-1786.070) -- 0:00:54 260000 -- (-1784.725) (-1786.855) (-1785.588) [-1785.120] * [-1784.403] (-1787.973) (-1785.542) (-1786.139) -- 0:00:54 Average standard deviation of split frequencies: 0.010851 260500 -- (-1784.557) (-1785.438) [-1784.642] (-1784.367) * [-1784.467] (-1788.670) (-1785.810) (-1789.045) -- 0:00:53 261000 -- [-1786.982] (-1786.907) (-1787.554) (-1785.165) * (-1788.612) (-1787.161) [-1787.078] (-1784.400) -- 0:00:53 261500 -- (-1784.311) (-1788.350) [-1787.751] (-1785.244) * (-1786.903) [-1784.267] (-1785.979) (-1785.370) -- 0:00:53 262000 -- [-1787.669] (-1784.061) (-1786.282) (-1793.381) * (-1786.236) [-1786.673] (-1784.507) (-1785.090) -- 0:00:53 262500 -- (-1784.385) [-1785.998] (-1788.680) (-1784.867) * [-1785.662] (-1786.582) (-1785.443) (-1796.658) -- 0:00:53 263000 -- [-1784.299] (-1787.262) (-1786.582) (-1785.225) * (-1786.314) (-1787.763) [-1785.786] (-1787.193) -- 0:00:53 263500 -- (-1788.212) (-1785.512) (-1785.179) [-1785.225] * (-1789.397) [-1787.885] (-1788.128) (-1785.530) -- 0:00:53 264000 -- [-1786.204] (-1786.698) (-1784.795) (-1786.173) * (-1788.618) (-1787.012) [-1787.970] (-1786.916) -- 0:00:52 264500 -- (-1784.027) (-1785.790) [-1784.046] (-1793.384) * (-1786.221) (-1785.121) [-1787.965] (-1785.404) -- 0:00:52 265000 -- (-1784.114) (-1786.707) [-1784.338] (-1784.955) * [-1786.557] (-1786.107) (-1787.822) (-1786.828) -- 0:00:52 Average standard deviation of split frequencies: 0.010633 265500 -- (-1787.029) (-1785.746) [-1784.064] (-1784.742) * (-1792.134) (-1785.979) [-1786.711] (-1786.985) -- 0:00:52 266000 -- [-1787.319] (-1789.850) (-1785.282) (-1784.967) * (-1789.295) [-1784.566] (-1783.970) (-1785.736) -- 0:00:52 266500 -- (-1784.181) (-1783.647) (-1788.442) [-1786.898] * [-1785.476] (-1783.888) (-1787.860) (-1786.821) -- 0:00:52 267000 -- (-1785.228) [-1785.120] (-1786.602) (-1786.457) * [-1784.912] (-1785.663) (-1787.980) (-1787.409) -- 0:00:52 267500 -- (-1787.009) (-1787.960) [-1789.919] (-1784.876) * (-1785.727) (-1784.262) [-1784.969] (-1785.611) -- 0:00:52 268000 -- (-1788.114) (-1787.730) (-1787.176) [-1785.546] * (-1786.952) (-1784.258) [-1784.300] (-1786.005) -- 0:00:51 268500 -- (-1788.440) (-1787.888) (-1784.297) [-1784.686] * (-1786.031) (-1787.605) (-1785.491) [-1786.240] -- 0:00:51 269000 -- (-1785.842) (-1786.411) (-1787.855) [-1785.224] * (-1785.296) [-1783.733] (-1787.270) (-1787.572) -- 0:00:51 269500 -- (-1785.108) (-1789.604) (-1787.110) [-1784.279] * (-1787.123) [-1784.008] (-1784.399) (-1786.304) -- 0:00:51 270000 -- (-1786.392) (-1786.361) [-1783.898] (-1784.376) * (-1786.187) (-1789.607) [-1788.816] (-1784.767) -- 0:00:51 Average standard deviation of split frequencies: 0.008128 270500 -- (-1789.487) (-1786.700) (-1786.376) [-1786.506] * (-1786.342) [-1789.674] (-1785.873) (-1784.636) -- 0:00:51 271000 -- (-1786.409) (-1786.177) (-1785.019) [-1786.922] * [-1787.812] (-1790.050) (-1785.710) (-1784.942) -- 0:00:51 271500 -- (-1785.237) [-1786.010] (-1788.758) (-1787.439) * (-1786.891) [-1785.072] (-1785.074) (-1784.694) -- 0:00:53 272000 -- [-1783.968] (-1786.401) (-1788.333) (-1789.600) * (-1787.524) [-1785.665] (-1786.169) (-1784.543) -- 0:00:53 272500 -- [-1785.597] (-1784.008) (-1787.823) (-1790.265) * (-1783.625) (-1786.663) [-1786.621] (-1787.128) -- 0:00:53 273000 -- (-1785.268) (-1784.857) [-1787.070] (-1784.992) * (-1784.389) (-1786.524) [-1786.035] (-1786.483) -- 0:00:53 273500 -- (-1785.065) (-1786.923) (-1786.835) [-1784.538] * (-1785.437) (-1788.199) [-1784.990] (-1786.867) -- 0:00:53 274000 -- (-1786.954) (-1786.016) (-1786.964) [-1785.545] * (-1785.646) [-1790.845] (-1785.298) (-1785.095) -- 0:00:52 274500 -- (-1787.252) (-1784.635) [-1785.581] (-1784.295) * (-1787.313) (-1792.018) [-1784.401] (-1785.955) -- 0:00:52 275000 -- (-1786.938) (-1784.599) (-1785.685) [-1784.504] * [-1789.861] (-1790.442) (-1787.483) (-1786.080) -- 0:00:52 Average standard deviation of split frequencies: 0.011387 275500 -- [-1786.687] (-1785.667) (-1785.952) (-1785.240) * (-1785.079) (-1786.475) [-1786.550] (-1785.084) -- 0:00:52 276000 -- (-1786.778) [-1786.247] (-1793.954) (-1784.469) * [-1785.305] (-1785.591) (-1786.025) (-1784.999) -- 0:00:52 276500 -- (-1784.418) (-1786.896) [-1787.084] (-1785.032) * (-1783.634) (-1787.880) [-1784.792] (-1786.135) -- 0:00:52 277000 -- (-1785.138) (-1786.621) [-1789.194] (-1787.332) * [-1783.411] (-1788.554) (-1787.089) (-1784.980) -- 0:00:52 277500 -- (-1784.681) [-1785.665] (-1786.239) (-1788.807) * (-1783.761) (-1789.808) (-1789.448) [-1785.749] -- 0:00:52 278000 -- (-1783.373) [-1784.972] (-1785.558) (-1787.676) * (-1784.774) (-1786.132) (-1786.788) [-1783.999] -- 0:00:51 278500 -- (-1784.004) (-1787.493) [-1789.114] (-1788.603) * (-1784.124) (-1785.295) (-1786.974) [-1784.543] -- 0:00:51 279000 -- (-1783.994) [-1786.348] (-1788.283) (-1785.223) * (-1784.009) (-1786.765) (-1784.223) [-1784.303] -- 0:00:51 279500 -- (-1785.206) [-1785.068] (-1785.995) (-1784.261) * [-1784.574] (-1786.282) (-1785.680) (-1786.804) -- 0:00:51 280000 -- [-1784.719] (-1784.245) (-1785.233) (-1788.193) * [-1784.620] (-1786.112) (-1786.869) (-1786.917) -- 0:00:51 Average standard deviation of split frequencies: 0.010078 280500 -- [-1784.166] (-1784.711) (-1789.421) (-1786.310) * [-1784.538] (-1788.252) (-1784.746) (-1784.260) -- 0:00:51 281000 -- (-1785.734) (-1786.859) [-1787.651] (-1789.669) * [-1786.317] (-1785.768) (-1787.225) (-1784.304) -- 0:00:51 281500 -- (-1784.438) (-1785.191) (-1784.881) [-1788.903] * (-1790.336) (-1786.279) [-1784.442] (-1784.917) -- 0:00:51 282000 -- (-1784.661) [-1785.257] (-1785.470) (-1785.748) * (-1787.438) [-1785.266] (-1786.441) (-1785.796) -- 0:00:50 282500 -- (-1785.753) [-1790.117] (-1789.157) (-1785.749) * (-1788.909) (-1786.898) (-1789.122) [-1784.091] -- 0:00:50 283000 -- [-1786.798] (-1786.748) (-1785.711) (-1785.568) * [-1788.082] (-1791.411) (-1787.491) (-1785.589) -- 0:00:50 283500 -- (-1784.008) (-1787.556) [-1784.802] (-1785.102) * (-1788.170) [-1788.713] (-1785.211) (-1787.697) -- 0:00:50 284000 -- (-1784.293) (-1787.822) (-1785.972) [-1785.109] * (-1788.733) [-1785.206] (-1787.645) (-1787.110) -- 0:00:50 284500 -- (-1785.217) (-1785.334) (-1788.515) [-1787.088] * [-1786.594] (-1785.263) (-1787.089) (-1785.237) -- 0:00:50 285000 -- [-1784.787] (-1786.657) (-1785.190) (-1783.735) * (-1785.743) (-1784.786) (-1786.023) [-1783.772] -- 0:00:50 Average standard deviation of split frequencies: 0.010988 285500 -- (-1786.101) [-1786.157] (-1785.594) (-1784.474) * [-1786.628] (-1785.762) (-1783.653) (-1784.044) -- 0:00:50 286000 -- [-1784.860] (-1786.183) (-1784.394) (-1786.355) * (-1787.828) [-1784.077] (-1784.160) (-1785.824) -- 0:00:52 286500 -- (-1786.001) (-1784.648) [-1783.811] (-1784.791) * (-1786.954) [-1783.617] (-1785.215) (-1783.815) -- 0:00:52 287000 -- (-1785.533) [-1788.892] (-1785.705) (-1786.555) * [-1785.781] (-1784.528) (-1787.653) (-1784.843) -- 0:00:52 287500 -- (-1786.239) (-1784.422) (-1787.117) [-1786.249] * (-1788.252) (-1788.118) [-1791.467] (-1784.249) -- 0:00:52 288000 -- [-1786.569] (-1786.421) (-1786.060) (-1785.477) * (-1785.848) (-1792.399) [-1793.901] (-1786.261) -- 0:00:51 288500 -- (-1785.922) (-1784.975) [-1784.414] (-1785.302) * (-1787.044) [-1785.179] (-1786.994) (-1786.500) -- 0:00:51 289000 -- (-1786.932) (-1786.359) [-1784.956] (-1783.891) * (-1786.555) (-1785.643) [-1786.144] (-1786.374) -- 0:00:51 289500 -- (-1787.527) (-1789.125) (-1786.260) [-1784.716] * (-1786.235) (-1789.087) [-1784.992] (-1788.740) -- 0:00:51 290000 -- (-1785.550) (-1785.004) [-1786.002] (-1788.540) * (-1786.627) [-1786.921] (-1786.367) (-1783.966) -- 0:00:51 Average standard deviation of split frequencies: 0.012974 290500 -- (-1785.840) (-1783.868) [-1787.301] (-1787.135) * [-1785.272] (-1785.993) (-1785.521) (-1786.116) -- 0:00:51 291000 -- (-1785.946) (-1785.549) (-1783.893) [-1789.872] * (-1784.283) (-1785.384) [-1785.038] (-1788.775) -- 0:00:51 291500 -- (-1786.729) (-1783.787) [-1784.973] (-1786.560) * (-1784.191) [-1787.748] (-1784.726) (-1784.165) -- 0:00:51 292000 -- (-1785.050) [-1783.711] (-1787.371) (-1788.682) * (-1783.999) (-1786.399) [-1791.556] (-1783.792) -- 0:00:50 292500 -- [-1787.303] (-1784.109) (-1785.306) (-1783.883) * [-1785.393] (-1785.297) (-1785.604) (-1793.980) -- 0:00:50 293000 -- (-1786.327) (-1784.565) [-1785.645] (-1783.964) * (-1785.591) (-1785.442) [-1787.361] (-1787.439) -- 0:00:50 293500 -- (-1789.395) [-1784.630] (-1784.512) (-1787.533) * [-1784.980] (-1788.702) (-1784.485) (-1786.554) -- 0:00:50 294000 -- (-1788.222) (-1784.275) (-1786.757) [-1784.328] * (-1785.074) [-1786.975] (-1784.012) (-1784.230) -- 0:00:50 294500 -- [-1787.671] (-1784.724) (-1785.720) (-1788.278) * (-1786.486) (-1789.287) [-1786.059] (-1784.258) -- 0:00:50 295000 -- (-1784.097) [-1785.789] (-1784.846) (-1786.191) * (-1786.274) (-1790.729) (-1784.085) [-1788.566] -- 0:00:50 Average standard deviation of split frequencies: 0.014864 295500 -- (-1785.034) (-1785.048) [-1785.183] (-1787.693) * (-1792.100) (-1787.266) [-1786.453] (-1788.405) -- 0:00:50 296000 -- (-1786.096) (-1787.098) [-1784.535] (-1787.023) * (-1784.657) (-1787.947) [-1786.219] (-1788.082) -- 0:00:49 296500 -- (-1786.022) (-1783.747) [-1783.700] (-1786.061) * (-1786.254) (-1786.604) [-1785.000] (-1783.552) -- 0:00:49 297000 -- (-1788.510) (-1783.862) (-1783.511) [-1784.505] * (-1785.987) [-1785.287] (-1786.025) (-1784.671) -- 0:00:49 297500 -- (-1787.104) (-1785.971) (-1783.567) [-1786.541] * (-1786.856) (-1786.366) [-1785.154] (-1784.868) -- 0:00:49 298000 -- [-1784.966] (-1784.883) (-1789.135) (-1785.274) * (-1785.530) [-1788.071] (-1784.920) (-1784.315) -- 0:00:49 298500 -- (-1784.397) (-1784.960) (-1785.657) [-1785.384] * (-1787.080) [-1783.699] (-1786.110) (-1783.675) -- 0:00:49 299000 -- [-1783.879] (-1784.836) (-1786.322) (-1790.422) * (-1790.531) (-1788.453) (-1784.790) [-1784.976] -- 0:00:49 299500 -- (-1783.937) (-1788.678) [-1785.198] (-1784.467) * [-1784.402] (-1783.966) (-1785.065) (-1784.200) -- 0:00:49 300000 -- (-1784.577) [-1784.481] (-1785.028) (-1784.445) * (-1784.256) (-1784.262) (-1785.209) [-1783.965] -- 0:00:48 Average standard deviation of split frequencies: 0.014633 300500 -- (-1784.344) (-1785.565) [-1785.975] (-1785.436) * [-1783.607] (-1784.910) (-1785.691) (-1788.132) -- 0:00:51 301000 -- (-1785.141) (-1787.491) [-1784.606] (-1786.248) * (-1791.084) (-1785.591) (-1785.348) [-1783.907] -- 0:00:51 301500 -- [-1785.116] (-1788.097) (-1784.911) (-1786.025) * (-1789.000) (-1784.035) [-1788.812] (-1789.899) -- 0:00:50 302000 -- [-1786.103] (-1785.107) (-1783.753) (-1787.087) * [-1789.144] (-1783.888) (-1785.866) (-1789.453) -- 0:00:50 302500 -- (-1784.086) [-1784.833] (-1784.271) (-1789.881) * [-1787.919] (-1787.605) (-1786.129) (-1785.275) -- 0:00:50 303000 -- [-1783.951] (-1785.272) (-1785.473) (-1785.349) * (-1784.947) (-1787.514) [-1785.194] (-1788.666) -- 0:00:50 303500 -- (-1784.681) [-1783.691] (-1787.693) (-1784.635) * (-1784.691) (-1788.563) [-1785.091] (-1791.035) -- 0:00:50 304000 -- [-1784.817] (-1785.855) (-1784.473) (-1786.730) * (-1784.603) [-1788.005] (-1784.864) (-1789.971) -- 0:00:50 304500 -- (-1786.412) (-1785.203) (-1784.476) [-1785.316] * (-1787.590) (-1785.129) [-1783.563] (-1786.294) -- 0:00:50 305000 -- (-1787.349) [-1783.914] (-1785.539) (-1786.942) * (-1785.461) [-1784.892] (-1784.761) (-1784.303) -- 0:00:50 Average standard deviation of split frequencies: 0.015405 305500 -- (-1786.786) (-1790.026) (-1785.990) [-1784.393] * (-1785.306) [-1785.274] (-1784.002) (-1784.555) -- 0:00:50 306000 -- (-1788.497) (-1786.302) (-1784.009) [-1783.712] * (-1787.243) (-1785.578) (-1783.976) [-1786.736] -- 0:00:49 306500 -- (-1787.046) (-1785.927) [-1784.046] (-1789.159) * (-1784.710) (-1789.069) [-1784.059] (-1784.871) -- 0:00:49 307000 -- [-1783.939] (-1785.015) (-1787.878) (-1787.599) * [-1785.809] (-1786.668) (-1787.047) (-1785.962) -- 0:00:49 307500 -- (-1784.360) (-1784.225) [-1787.769] (-1784.486) * (-1784.696) (-1784.664) [-1785.052] (-1787.483) -- 0:00:49 308000 -- (-1791.106) (-1785.048) (-1786.675) [-1784.796] * [-1784.677] (-1785.595) (-1785.391) (-1784.587) -- 0:00:49 308500 -- (-1786.648) (-1784.301) [-1788.254] (-1787.723) * (-1785.832) (-1784.878) (-1786.884) [-1784.189] -- 0:00:49 309000 -- (-1786.291) (-1786.693) [-1787.461] (-1788.334) * (-1787.040) [-1785.153] (-1787.979) (-1783.838) -- 0:00:49 309500 -- (-1786.238) (-1786.216) [-1786.817] (-1788.930) * (-1783.478) (-1785.132) (-1786.871) [-1783.758] -- 0:00:49 310000 -- (-1787.603) (-1788.072) (-1788.369) [-1785.137] * [-1783.901] (-1786.018) (-1787.772) (-1785.921) -- 0:00:48 Average standard deviation of split frequencies: 0.011128 310500 -- (-1784.744) [-1787.037] (-1786.107) (-1786.091) * (-1785.688) (-1785.031) [-1785.901] (-1785.596) -- 0:00:48 311000 -- (-1786.901) (-1784.581) (-1784.105) [-1786.543] * [-1784.568] (-1786.563) (-1785.228) (-1787.389) -- 0:00:48 311500 -- (-1786.198) (-1785.503) (-1786.307) [-1784.034] * (-1784.901) (-1785.663) (-1785.987) [-1783.868] -- 0:00:48 312000 -- (-1788.135) (-1788.727) (-1785.317) [-1785.216] * (-1785.309) [-1783.646] (-1784.489) (-1785.170) -- 0:00:48 312500 -- (-1788.115) (-1784.598) [-1785.546] (-1785.821) * (-1784.926) (-1787.668) (-1784.213) [-1784.133] -- 0:00:48 313000 -- (-1786.311) (-1784.377) [-1785.453] (-1787.008) * (-1788.094) (-1791.379) [-1784.541] (-1788.060) -- 0:00:48 313500 -- (-1784.407) [-1784.283] (-1787.950) (-1791.108) * (-1786.366) [-1786.839] (-1784.720) (-1785.122) -- 0:00:48 314000 -- (-1785.317) (-1785.752) (-1783.872) [-1788.650] * (-1783.932) (-1786.470) [-1785.337] (-1786.558) -- 0:00:48 314500 -- (-1789.096) (-1786.585) [-1785.673] (-1787.392) * (-1783.343) [-1785.295] (-1784.359) (-1786.518) -- 0:00:50 315000 -- (-1792.256) (-1791.644) (-1785.237) [-1785.283] * (-1785.083) (-1785.926) (-1784.584) [-1787.294] -- 0:00:50 Average standard deviation of split frequencies: 0.012929 315500 -- (-1787.276) (-1787.791) [-1784.053] (-1786.356) * (-1789.663) (-1785.476) (-1784.580) [-1785.945] -- 0:00:49 316000 -- [-1787.316] (-1785.831) (-1784.067) (-1785.138) * (-1786.315) [-1785.304] (-1784.202) (-1785.996) -- 0:00:49 316500 -- (-1787.254) (-1784.279) [-1785.393] (-1788.520) * (-1786.854) [-1783.990] (-1785.713) (-1788.640) -- 0:00:49 317000 -- (-1785.603) (-1784.547) [-1785.868] (-1790.943) * (-1784.566) (-1786.190) [-1784.800] (-1785.678) -- 0:00:49 317500 -- (-1786.970) [-1785.901] (-1786.232) (-1785.679) * (-1783.956) (-1787.284) [-1787.838] (-1784.547) -- 0:00:49 318000 -- (-1784.148) (-1784.143) [-1786.373] (-1787.890) * [-1784.902] (-1784.019) (-1790.195) (-1784.034) -- 0:00:49 318500 -- [-1783.842] (-1783.780) (-1787.148) (-1788.776) * [-1783.475] (-1785.418) (-1786.359) (-1784.034) -- 0:00:49 319000 -- [-1784.342] (-1783.965) (-1784.688) (-1787.627) * [-1783.686] (-1790.031) (-1790.098) (-1783.517) -- 0:00:49 319500 -- (-1785.093) (-1785.323) [-1788.005] (-1786.578) * [-1784.524] (-1788.438) (-1788.777) (-1784.957) -- 0:00:48 320000 -- (-1786.886) [-1785.935] (-1788.891) (-1786.540) * (-1784.537) (-1786.864) [-1786.338] (-1784.181) -- 0:00:48 Average standard deviation of split frequencies: 0.015681 320500 -- (-1784.349) (-1790.152) (-1791.684) [-1788.557] * (-1784.255) [-1785.611] (-1785.421) (-1785.588) -- 0:00:48 321000 -- [-1785.304] (-1785.391) (-1786.700) (-1788.475) * [-1784.252] (-1788.361) (-1786.360) (-1791.385) -- 0:00:48 321500 -- (-1784.800) (-1788.399) (-1787.524) [-1785.756] * (-1787.774) (-1786.748) [-1785.188] (-1784.933) -- 0:00:48 322000 -- (-1783.877) (-1784.855) [-1786.358] (-1785.747) * (-1784.459) (-1785.314) (-1786.503) [-1784.171] -- 0:00:48 322500 -- (-1786.711) (-1783.324) [-1785.783] (-1784.951) * (-1784.726) (-1787.996) (-1786.188) [-1783.792] -- 0:00:48 323000 -- [-1785.776] (-1783.504) (-1785.723) (-1783.653) * (-1785.323) (-1785.032) (-1787.541) [-1784.381] -- 0:00:48 323500 -- (-1788.881) [-1784.527] (-1785.776) (-1784.011) * (-1787.912) (-1792.063) (-1784.264) [-1786.358] -- 0:00:48 324000 -- (-1786.152) (-1785.459) (-1788.172) [-1791.090] * (-1784.010) [-1785.343] (-1788.626) (-1786.470) -- 0:00:47 324500 -- [-1786.353] (-1785.989) (-1784.587) (-1786.811) * (-1783.819) [-1786.048] (-1786.797) (-1783.801) -- 0:00:47 325000 -- (-1784.936) (-1785.956) [-1784.028] (-1788.060) * (-1786.527) (-1787.426) (-1786.053) [-1784.804] -- 0:00:47 Average standard deviation of split frequencies: 0.014460 325500 -- (-1785.170) [-1784.928] (-1783.550) (-1789.348) * (-1785.113) (-1785.444) [-1785.359] (-1785.217) -- 0:00:47 326000 -- (-1786.244) (-1788.574) (-1783.691) [-1786.674] * (-1784.983) (-1784.671) [-1785.090] (-1785.191) -- 0:00:47 326500 -- (-1786.853) (-1788.129) [-1784.321] (-1786.725) * [-1786.412] (-1784.377) (-1790.428) (-1784.426) -- 0:00:47 327000 -- (-1787.453) [-1788.924] (-1784.924) (-1785.745) * (-1785.610) [-1783.337] (-1786.988) (-1783.560) -- 0:00:47 327500 -- [-1789.171] (-1787.380) (-1784.951) (-1790.698) * [-1785.296] (-1783.401) (-1785.194) (-1785.391) -- 0:00:47 328000 -- (-1789.495) (-1788.032) (-1784.917) [-1784.492] * (-1784.710) (-1783.970) [-1785.735] (-1784.688) -- 0:00:47 328500 -- (-1788.020) (-1787.163) (-1786.181) [-1784.310] * (-1786.097) [-1785.576] (-1786.121) (-1784.317) -- 0:00:47 329000 -- (-1786.132) (-1785.335) (-1787.953) [-1786.066] * (-1786.975) (-1786.393) (-1785.853) [-1784.202] -- 0:00:48 329500 -- (-1786.344) (-1783.437) (-1784.799) [-1784.335] * [-1786.971] (-1787.871) (-1784.549) (-1784.918) -- 0:00:48 330000 -- (-1785.898) (-1784.632) (-1785.357) [-1788.675] * (-1785.554) (-1785.662) (-1784.616) [-1786.580] -- 0:00:48 Average standard deviation of split frequencies: 0.013306 330500 -- [-1784.959] (-1784.856) (-1787.684) (-1785.290) * (-1784.165) [-1786.442] (-1787.102) (-1785.517) -- 0:00:48 331000 -- (-1785.171) [-1784.067] (-1784.060) (-1785.484) * [-1785.142] (-1786.471) (-1789.714) (-1789.774) -- 0:00:48 331500 -- (-1788.192) (-1784.987) (-1785.572) [-1788.637] * (-1784.685) (-1786.902) [-1786.840] (-1785.604) -- 0:00:48 332000 -- (-1785.444) [-1784.450] (-1788.119) (-1785.307) * (-1786.154) (-1784.804) (-1785.060) [-1784.809] -- 0:00:48 332500 -- (-1783.574) (-1788.061) [-1785.720] (-1785.759) * [-1786.255] (-1784.125) (-1789.916) (-1787.293) -- 0:00:48 333000 -- [-1783.567] (-1784.751) (-1785.409) (-1784.828) * [-1785.334] (-1786.879) (-1785.263) (-1785.702) -- 0:00:48 333500 -- (-1784.824) (-1785.727) [-1784.434] (-1784.640) * (-1785.998) (-1788.205) [-1783.731] (-1791.524) -- 0:00:47 334000 -- [-1785.410] (-1785.346) (-1787.824) (-1785.742) * [-1785.990] (-1787.834) (-1785.552) (-1788.789) -- 0:00:47 334500 -- (-1787.275) (-1785.240) [-1785.717] (-1783.891) * (-1784.729) (-1784.006) [-1786.807] (-1786.350) -- 0:00:47 335000 -- (-1787.151) (-1784.025) (-1784.368) [-1785.753] * (-1784.776) (-1785.013) [-1785.100] (-1787.588) -- 0:00:47 Average standard deviation of split frequencies: 0.016836 335500 -- (-1786.524) [-1785.520] (-1784.891) (-1784.112) * (-1784.867) (-1784.922) [-1785.265] (-1786.340) -- 0:00:47 336000 -- (-1787.780) (-1784.264) [-1785.202] (-1785.697) * (-1784.105) [-1785.552] (-1787.065) (-1787.152) -- 0:00:47 336500 -- (-1786.332) (-1785.360) (-1783.758) [-1790.128] * [-1785.952] (-1787.330) (-1786.737) (-1784.881) -- 0:00:47 337000 -- (-1785.066) [-1786.374] (-1787.722) (-1784.255) * (-1786.516) [-1788.007] (-1784.917) (-1785.824) -- 0:00:47 337500 -- (-1785.336) (-1785.325) [-1784.240] (-1787.011) * (-1786.207) (-1788.011) (-1784.947) [-1785.006] -- 0:00:47 338000 -- (-1785.328) (-1783.529) [-1783.916] (-1784.806) * (-1783.516) (-1789.065) [-1787.082] (-1783.696) -- 0:00:47 338500 -- (-1785.875) (-1791.433) (-1791.106) [-1785.461] * (-1787.225) [-1785.525] (-1785.685) (-1785.178) -- 0:00:46 339000 -- (-1787.955) (-1788.919) (-1789.053) [-1786.410] * (-1784.021) [-1784.298] (-1785.781) (-1786.362) -- 0:00:46 339500 -- (-1785.659) (-1787.045) (-1791.798) [-1786.261] * (-1783.744) (-1786.980) (-1785.412) [-1786.475] -- 0:00:46 340000 -- (-1786.069) (-1787.420) (-1794.522) [-1785.500] * (-1783.715) (-1787.477) [-1786.519] (-1785.556) -- 0:00:46 Average standard deviation of split frequencies: 0.016605 340500 -- (-1786.886) (-1783.688) (-1787.730) [-1786.038] * (-1784.204) (-1789.205) (-1784.358) [-1784.273] -- 0:00:46 341000 -- [-1784.652] (-1787.648) (-1786.249) (-1788.497) * [-1784.037] (-1787.517) (-1783.653) (-1784.789) -- 0:00:46 341500 -- (-1783.464) (-1784.568) [-1786.323] (-1785.453) * (-1784.555) (-1783.934) [-1783.741] (-1786.775) -- 0:00:46 342000 -- (-1784.729) [-1788.230] (-1785.351) (-1785.813) * (-1784.161) [-1784.174] (-1784.770) (-1789.363) -- 0:00:46 342500 -- (-1786.946) (-1786.217) (-1785.982) [-1789.803] * (-1784.524) (-1786.705) (-1784.116) [-1787.755] -- 0:00:46 343000 -- (-1788.343) (-1784.166) [-1784.306] (-1788.648) * (-1785.453) [-1790.369] (-1785.189) (-1786.955) -- 0:00:47 343500 -- (-1785.826) [-1784.825] (-1783.873) (-1785.222) * (-1785.806) [-1785.978] (-1785.308) (-1786.143) -- 0:00:47 344000 -- (-1787.209) (-1784.359) (-1789.813) [-1785.677] * (-1786.909) [-1785.230] (-1786.738) (-1788.215) -- 0:00:47 344500 -- [-1785.127] (-1784.333) (-1785.785) (-1783.947) * [-1784.170] (-1786.889) (-1785.398) (-1788.078) -- 0:00:47 345000 -- [-1786.503] (-1784.857) (-1786.008) (-1784.432) * [-1784.224] (-1785.399) (-1784.886) (-1785.252) -- 0:00:47 Average standard deviation of split frequencies: 0.013624 345500 -- (-1786.237) [-1783.907] (-1786.162) (-1785.673) * (-1787.771) (-1784.830) [-1784.408] (-1785.076) -- 0:00:47 346000 -- [-1784.639] (-1784.568) (-1786.222) (-1787.266) * [-1784.905] (-1784.810) (-1784.275) (-1785.220) -- 0:00:47 346500 -- [-1785.260] (-1786.164) (-1784.413) (-1785.884) * (-1786.881) [-1786.019] (-1784.577) (-1785.373) -- 0:00:47 347000 -- (-1787.396) [-1784.335] (-1783.691) (-1785.833) * (-1785.905) (-1783.466) [-1785.545] (-1789.736) -- 0:00:47 347500 -- (-1788.844) (-1784.475) [-1784.240] (-1787.247) * (-1787.571) (-1783.978) (-1786.187) [-1788.509] -- 0:00:46 348000 -- [-1786.998] (-1785.137) (-1784.062) (-1787.334) * (-1784.561) [-1785.004] (-1786.035) (-1785.085) -- 0:00:46 348500 -- (-1786.713) (-1784.251) [-1784.628] (-1787.382) * (-1784.321) (-1784.438) (-1783.614) [-1785.405] -- 0:00:46 349000 -- (-1784.934) (-1786.264) (-1784.653) [-1787.457] * (-1786.421) [-1786.082] (-1783.679) (-1785.322) -- 0:00:46 349500 -- (-1784.801) [-1785.826] (-1784.373) (-1787.887) * (-1786.506) (-1784.129) [-1784.131] (-1785.381) -- 0:00:46 350000 -- [-1786.571] (-1786.584) (-1784.717) (-1784.832) * [-1784.089] (-1786.576) (-1783.734) (-1790.151) -- 0:00:46 Average standard deviation of split frequencies: 0.013443 350500 -- (-1785.259) (-1784.855) (-1784.723) [-1784.181] * (-1784.435) (-1787.061) [-1785.136] (-1788.794) -- 0:00:46 351000 -- (-1783.594) (-1786.190) [-1785.358] (-1784.000) * [-1785.645] (-1786.570) (-1788.202) (-1785.316) -- 0:00:46 351500 -- [-1785.839] (-1788.400) (-1786.120) (-1786.064) * (-1785.549) (-1786.649) (-1792.534) [-1785.047] -- 0:00:46 352000 -- (-1788.186) [-1785.202] (-1787.059) (-1786.414) * [-1784.667] (-1783.747) (-1789.245) (-1788.669) -- 0:00:46 352500 -- (-1792.005) [-1784.781] (-1788.348) (-1787.289) * (-1789.316) [-1783.597] (-1789.197) (-1784.956) -- 0:00:45 353000 -- (-1784.561) [-1785.943] (-1785.226) (-1786.412) * (-1786.797) [-1784.060] (-1788.058) (-1783.790) -- 0:00:45 353500 -- [-1788.878] (-1784.494) (-1784.967) (-1785.693) * (-1787.939) (-1786.013) (-1783.781) [-1784.361] -- 0:00:45 354000 -- (-1787.778) (-1786.402) (-1785.874) [-1785.633] * (-1789.131) (-1787.684) (-1783.840) [-1784.569] -- 0:00:45 354500 -- (-1784.349) [-1792.071] (-1785.933) (-1784.250) * (-1784.740) [-1787.272] (-1783.724) (-1787.801) -- 0:00:45 355000 -- (-1784.319) (-1786.460) (-1784.069) [-1786.519] * (-1787.561) (-1785.111) (-1784.699) [-1786.400] -- 0:00:45 Average standard deviation of split frequencies: 0.014124 355500 -- (-1784.438) (-1787.826) (-1784.478) [-1785.533] * (-1791.565) (-1784.354) (-1785.944) [-1785.175] -- 0:00:45 356000 -- [-1785.649] (-1786.657) (-1786.390) (-1785.215) * (-1784.118) (-1783.994) (-1787.900) [-1784.513] -- 0:00:45 356500 -- [-1785.203] (-1786.325) (-1787.824) (-1786.986) * (-1785.154) [-1786.688] (-1784.533) (-1784.174) -- 0:00:45 357000 -- (-1784.783) (-1793.337) [-1784.259] (-1784.349) * (-1785.106) (-1786.425) (-1784.242) [-1786.553] -- 0:00:45 357500 -- [-1785.802] (-1784.922) (-1787.511) (-1787.714) * [-1786.000] (-1787.168) (-1785.021) (-1786.674) -- 0:00:46 358000 -- (-1786.141) (-1784.908) [-1788.686] (-1786.408) * (-1785.135) (-1786.836) [-1787.114] (-1786.835) -- 0:00:46 358500 -- (-1783.990) (-1786.822) [-1787.415] (-1790.554) * (-1783.715) (-1786.325) (-1784.099) [-1787.969] -- 0:00:46 359000 -- (-1783.744) (-1785.489) (-1786.893) [-1783.777] * [-1783.589] (-1786.369) (-1784.756) (-1790.526) -- 0:00:46 359500 -- (-1784.240) (-1788.116) [-1785.483] (-1788.025) * [-1788.616] (-1783.969) (-1786.643) (-1785.399) -- 0:00:46 360000 -- (-1786.350) (-1788.871) [-1783.874] (-1788.156) * [-1788.304] (-1786.246) (-1784.404) (-1789.438) -- 0:00:46 Average standard deviation of split frequencies: 0.014813 360500 -- [-1785.324] (-1787.259) (-1785.325) (-1784.433) * (-1785.334) (-1785.065) (-1784.396) [-1787.374] -- 0:00:46 361000 -- [-1785.856] (-1785.754) (-1785.829) (-1784.795) * (-1786.735) (-1784.311) (-1785.521) [-1785.049] -- 0:00:46 361500 -- (-1788.268) (-1789.202) (-1786.190) [-1785.114] * [-1788.259] (-1783.263) (-1786.286) (-1787.918) -- 0:00:45 362000 -- [-1787.697] (-1785.998) (-1786.246) (-1785.539) * (-1785.125) (-1784.894) (-1789.335) [-1786.813] -- 0:00:45 362500 -- (-1786.576) [-1784.508] (-1786.248) (-1783.900) * (-1784.648) (-1785.028) [-1788.291] (-1786.035) -- 0:00:45 363000 -- [-1785.311] (-1785.227) (-1788.210) (-1785.504) * [-1787.602] (-1787.021) (-1785.368) (-1787.722) -- 0:00:45 363500 -- (-1785.666) [-1784.665] (-1786.257) (-1786.900) * (-1785.844) [-1785.940] (-1785.230) (-1785.313) -- 0:00:45 364000 -- (-1785.238) (-1783.707) (-1787.427) [-1786.952] * (-1786.485) (-1784.823) [-1784.795] (-1786.500) -- 0:00:45 364500 -- (-1789.150) (-1785.325) (-1786.030) [-1788.756] * (-1785.587) (-1784.822) [-1785.062] (-1783.830) -- 0:00:45 365000 -- (-1787.723) [-1786.710] (-1785.726) (-1789.273) * (-1786.956) [-1783.470] (-1790.291) (-1783.608) -- 0:00:45 Average standard deviation of split frequencies: 0.018891 365500 -- (-1786.541) (-1785.876) (-1788.631) [-1783.730] * (-1787.170) (-1785.282) (-1785.580) [-1785.029] -- 0:00:45 366000 -- (-1788.041) (-1785.127) (-1789.838) [-1783.765] * [-1785.540] (-1786.828) (-1785.224) (-1783.787) -- 0:00:45 366500 -- [-1785.245] (-1786.208) (-1786.317) (-1785.610) * (-1785.272) (-1789.708) [-1787.704] (-1783.488) -- 0:00:44 367000 -- (-1787.330) [-1784.001] (-1790.306) (-1786.787) * (-1788.918) (-1788.572) (-1788.184) [-1784.977] -- 0:00:44 367500 -- (-1786.670) (-1786.338) [-1785.922] (-1784.837) * (-1788.500) [-1785.384] (-1784.998) (-1785.499) -- 0:00:44 368000 -- (-1786.984) [-1788.397] (-1785.916) (-1786.812) * (-1785.349) (-1786.312) (-1788.395) [-1783.623] -- 0:00:44 368500 -- (-1784.380) (-1788.792) [-1787.489] (-1793.300) * (-1785.875) (-1784.286) (-1785.317) [-1783.960] -- 0:00:44 369000 -- (-1784.045) [-1784.478] (-1785.211) (-1785.772) * (-1786.342) [-1783.988] (-1786.299) (-1784.642) -- 0:00:44 369500 -- (-1784.995) [-1787.129] (-1786.037) (-1785.771) * (-1784.207) [-1783.867] (-1786.266) (-1785.778) -- 0:00:44 370000 -- (-1785.602) (-1785.863) (-1789.651) [-1785.300] * (-1786.393) (-1786.559) [-1785.006] (-1786.235) -- 0:00:44 Average standard deviation of split frequencies: 0.016957 370500 -- [-1785.305] (-1787.331) (-1787.360) (-1785.331) * (-1784.736) (-1785.091) (-1785.113) [-1785.492] -- 0:00:44 371000 -- (-1783.697) (-1789.432) (-1786.271) [-1787.026] * [-1784.991] (-1788.472) (-1784.131) (-1788.480) -- 0:00:45 371500 -- (-1783.543) (-1786.592) (-1786.394) [-1785.357] * [-1784.497] (-1788.867) (-1788.498) (-1785.407) -- 0:00:45 372000 -- (-1784.984) (-1785.921) (-1788.564) [-1785.416] * (-1787.470) [-1787.644] (-1789.258) (-1786.046) -- 0:00:45 372500 -- [-1786.178] (-1785.422) (-1788.006) (-1784.525) * (-1787.399) [-1785.381] (-1785.521) (-1791.155) -- 0:00:45 373000 -- (-1787.515) (-1786.084) (-1784.564) [-1784.303] * [-1784.684] (-1785.077) (-1784.945) (-1785.336) -- 0:00:45 373500 -- (-1783.952) (-1787.276) (-1785.664) [-1784.347] * [-1786.033] (-1783.973) (-1784.496) (-1784.567) -- 0:00:45 374000 -- (-1785.724) (-1788.049) (-1785.893) [-1786.471] * (-1787.094) [-1784.268] (-1785.355) (-1790.309) -- 0:00:45 374500 -- [-1785.317] (-1787.801) (-1788.122) (-1786.326) * (-1787.042) (-1784.723) [-1785.581] (-1784.660) -- 0:00:45 375000 -- (-1785.326) [-1785.621] (-1785.914) (-1787.306) * (-1786.639) (-1784.524) [-1787.332] (-1784.510) -- 0:00:45 Average standard deviation of split frequencies: 0.017552 375500 -- (-1784.825) (-1785.118) [-1786.841] (-1784.410) * [-1785.306] (-1783.614) (-1784.995) (-1786.639) -- 0:00:44 376000 -- (-1784.727) (-1783.757) (-1785.473) [-1786.981] * (-1785.239) [-1784.126] (-1783.899) (-1784.233) -- 0:00:44 376500 -- (-1784.993) [-1785.734] (-1788.677) (-1786.636) * [-1783.878] (-1783.963) (-1786.827) (-1785.238) -- 0:00:44 377000 -- (-1784.103) [-1788.799] (-1788.196) (-1784.540) * (-1785.659) [-1784.787] (-1786.144) (-1784.458) -- 0:00:44 377500 -- [-1784.903] (-1788.396) (-1786.810) (-1784.913) * (-1785.125) [-1787.462] (-1784.603) (-1784.640) -- 0:00:44 378000 -- (-1785.112) (-1788.176) [-1786.427] (-1785.196) * (-1786.192) (-1784.109) (-1783.636) [-1785.036] -- 0:00:44 378500 -- (-1784.805) (-1785.626) [-1786.161] (-1785.425) * [-1784.710] (-1784.748) (-1783.794) (-1785.021) -- 0:00:44 379000 -- (-1785.015) (-1783.592) [-1786.686] (-1785.872) * (-1785.210) (-1786.239) [-1785.986] (-1785.992) -- 0:00:44 379500 -- (-1785.738) (-1784.096) (-1784.653) [-1785.854] * (-1785.413) [-1791.477] (-1784.682) (-1784.647) -- 0:00:44 380000 -- (-1787.033) [-1783.905] (-1786.429) (-1790.204) * (-1786.667) (-1788.751) (-1783.698) [-1785.528] -- 0:00:44 Average standard deviation of split frequencies: 0.019814 380500 -- (-1785.754) [-1783.918] (-1786.350) (-1787.360) * (-1785.918) [-1787.288] (-1785.257) (-1785.597) -- 0:00:43 381000 -- (-1783.394) (-1784.123) (-1785.202) [-1792.904] * (-1784.387) (-1789.823) [-1786.981] (-1785.150) -- 0:00:43 381500 -- (-1786.150) (-1784.360) [-1784.417] (-1787.565) * [-1786.068] (-1783.654) (-1784.839) (-1786.462) -- 0:00:43 382000 -- (-1786.458) (-1786.229) [-1785.018] (-1787.689) * (-1789.981) (-1783.618) (-1784.809) [-1785.315] -- 0:00:43 382500 -- [-1785.693] (-1785.982) (-1784.466) (-1789.000) * (-1787.233) (-1784.614) (-1786.503) [-1787.422] -- 0:00:43 383000 -- [-1785.143] (-1783.644) (-1785.194) (-1786.329) * (-1787.249) [-1784.590] (-1784.702) (-1785.039) -- 0:00:43 383500 -- (-1786.124) [-1786.850] (-1788.158) (-1785.434) * (-1785.947) (-1789.267) (-1787.505) [-1784.030] -- 0:00:43 384000 -- (-1784.585) (-1786.700) (-1787.341) [-1783.782] * (-1788.003) [-1787.012] (-1789.943) (-1784.823) -- 0:00:44 384500 -- [-1784.201] (-1787.098) (-1791.563) (-1785.425) * (-1788.268) [-1786.139] (-1786.130) (-1785.417) -- 0:00:44 385000 -- (-1787.415) (-1786.641) (-1788.214) [-1785.802] * (-1785.025) [-1786.731] (-1785.977) (-1784.110) -- 0:00:44 Average standard deviation of split frequencies: 0.017912 385500 -- (-1784.455) (-1784.288) [-1788.873] (-1788.578) * (-1784.379) [-1784.359] (-1783.355) (-1785.979) -- 0:00:44 386000 -- (-1786.465) [-1785.205] (-1790.388) (-1787.467) * [-1784.886] (-1784.420) (-1785.072) (-1785.813) -- 0:00:44 386500 -- (-1786.168) (-1785.123) (-1785.121) [-1785.829] * (-1785.856) (-1786.017) [-1783.423] (-1787.262) -- 0:00:44 387000 -- (-1786.780) (-1785.783) [-1784.953] (-1785.683) * (-1785.679) [-1786.167] (-1783.413) (-1787.992) -- 0:00:44 387500 -- (-1784.623) (-1785.033) [-1785.860] (-1784.494) * (-1788.395) [-1784.821] (-1785.416) (-1788.509) -- 0:00:44 388000 -- (-1784.097) (-1785.858) (-1786.171) [-1785.691] * (-1783.454) [-1784.162] (-1787.461) (-1785.168) -- 0:00:44 388500 -- (-1785.059) [-1786.341] (-1786.715) (-1787.547) * (-1783.467) (-1784.878) [-1784.553] (-1785.284) -- 0:00:44 389000 -- [-1789.732] (-1788.997) (-1789.943) (-1789.951) * (-1785.615) (-1787.532) [-1785.315] (-1787.099) -- 0:00:43 389500 -- [-1784.530] (-1784.887) (-1786.917) (-1791.764) * [-1784.648] (-1790.090) (-1784.453) (-1783.859) -- 0:00:43 390000 -- (-1792.070) [-1786.528] (-1785.047) (-1785.148) * [-1784.625] (-1793.677) (-1784.965) (-1783.884) -- 0:00:43 Average standard deviation of split frequencies: 0.018502 390500 -- (-1785.341) [-1784.571] (-1785.204) (-1785.636) * (-1784.174) (-1785.971) [-1785.396] (-1785.093) -- 0:00:43 391000 -- [-1784.527] (-1784.171) (-1794.653) (-1784.156) * [-1784.175] (-1786.412) (-1784.936) (-1786.090) -- 0:00:43 391500 -- (-1784.136) [-1785.402] (-1786.844) (-1785.729) * (-1785.810) (-1785.921) (-1789.808) [-1787.106] -- 0:00:43 392000 -- (-1785.072) (-1784.401) (-1786.872) [-1787.323] * [-1785.177] (-1787.700) (-1784.123) (-1787.897) -- 0:00:43 392500 -- (-1784.567) [-1786.537] (-1787.213) (-1786.729) * (-1785.840) (-1791.570) (-1787.520) [-1785.837] -- 0:00:43 393000 -- (-1788.959) (-1785.640) (-1789.175) [-1784.802] * (-1789.271) (-1791.502) (-1785.066) [-1785.209] -- 0:00:43 393500 -- [-1788.157] (-1785.434) (-1788.591) (-1785.922) * (-1786.196) [-1786.702] (-1785.961) (-1784.006) -- 0:00:43 394000 -- (-1784.762) (-1788.438) [-1784.020] (-1784.337) * [-1785.396] (-1792.587) (-1783.815) (-1789.861) -- 0:00:43 394500 -- (-1784.685) (-1788.541) (-1787.876) [-1783.840] * (-1787.521) [-1785.162] (-1784.391) (-1787.292) -- 0:00:42 395000 -- (-1783.893) (-1787.302) (-1785.983) [-1785.150] * [-1785.796] (-1785.067) (-1785.591) (-1783.739) -- 0:00:42 Average standard deviation of split frequencies: 0.019840 395500 -- (-1788.725) [-1786.129] (-1786.051) (-1790.006) * (-1785.081) [-1785.566] (-1785.244) (-1785.149) -- 0:00:42 396000 -- (-1784.343) [-1784.552] (-1786.458) (-1785.440) * (-1787.310) (-1788.078) (-1785.591) [-1784.695] -- 0:00:42 396500 -- (-1784.793) [-1785.698] (-1784.992) (-1786.116) * (-1784.236) (-1787.906) (-1785.934) [-1786.097] -- 0:00:42 397000 -- [-1785.511] (-1787.336) (-1783.855) (-1784.212) * (-1785.911) (-1786.628) (-1788.122) [-1785.195] -- 0:00:42 397500 -- (-1788.209) [-1784.561] (-1789.604) (-1787.432) * (-1785.172) (-1784.317) [-1785.140] (-1784.792) -- 0:00:43 398000 -- (-1785.849) (-1784.214) [-1784.385] (-1788.612) * [-1783.726] (-1786.489) (-1785.561) (-1786.024) -- 0:00:43 398500 -- (-1789.365) (-1785.329) (-1788.446) [-1786.099] * (-1783.420) [-1784.900] (-1789.861) (-1786.751) -- 0:00:43 399000 -- (-1786.930) (-1784.341) (-1787.105) [-1784.430] * (-1785.083) (-1784.474) (-1791.308) [-1784.788] -- 0:00:43 399500 -- [-1786.815] (-1784.434) (-1784.287) (-1784.008) * (-1784.907) (-1785.435) (-1786.225) [-1784.343] -- 0:00:43 400000 -- (-1787.096) (-1784.492) (-1784.424) [-1785.475] * (-1786.072) (-1785.614) (-1785.064) [-1783.740] -- 0:00:43 Average standard deviation of split frequencies: 0.019609 400500 -- (-1786.880) [-1785.539] (-1784.303) (-1786.201) * (-1784.403) (-1783.995) (-1785.889) [-1785.493] -- 0:00:43 401000 -- (-1785.390) [-1790.569] (-1784.802) (-1789.129) * (-1787.330) (-1784.892) [-1786.115] (-1785.743) -- 0:00:43 401500 -- (-1787.299) (-1792.057) (-1784.590) [-1786.525] * (-1786.060) (-1789.991) (-1785.806) [-1784.635] -- 0:00:43 402000 -- (-1787.312) (-1785.883) (-1785.489) [-1785.533] * [-1784.482] (-1785.334) (-1787.319) (-1786.670) -- 0:00:43 402500 -- [-1784.297] (-1785.148) (-1785.239) (-1783.652) * [-1784.482] (-1783.520) (-1785.783) (-1787.499) -- 0:00:43 403000 -- (-1785.497) [-1784.348] (-1788.525) (-1785.479) * (-1785.438) [-1786.210] (-1785.022) (-1785.656) -- 0:00:42 403500 -- (-1787.052) [-1784.584] (-1786.262) (-1784.410) * [-1783.903] (-1786.302) (-1788.504) (-1785.574) -- 0:00:42 404000 -- (-1786.027) [-1785.496] (-1783.926) (-1784.300) * (-1783.733) (-1784.048) (-1786.790) [-1784.159] -- 0:00:42 404500 -- (-1786.081) (-1784.508) (-1785.505) [-1785.535] * (-1784.866) (-1784.500) [-1784.414] (-1784.239) -- 0:00:42 405000 -- (-1784.780) (-1785.637) (-1783.967) [-1784.608] * (-1785.251) [-1785.358] (-1785.151) (-1786.696) -- 0:00:42 Average standard deviation of split frequencies: 0.016255 405500 -- (-1784.140) [-1787.089] (-1785.500) (-1784.674) * [-1784.310] (-1788.115) (-1786.321) (-1786.812) -- 0:00:42 406000 -- (-1785.391) [-1788.540] (-1786.562) (-1784.758) * [-1786.265] (-1788.543) (-1784.260) (-1788.562) -- 0:00:42 406500 -- (-1784.824) [-1784.341] (-1784.878) (-1785.373) * [-1785.192] (-1788.897) (-1786.660) (-1786.787) -- 0:00:42 407000 -- (-1787.957) (-1784.722) (-1784.666) [-1787.412] * (-1786.821) (-1787.544) [-1790.417] (-1786.433) -- 0:00:42 407500 -- (-1785.098) [-1784.946] (-1787.810) (-1786.879) * (-1784.055) (-1784.109) [-1784.657] (-1786.011) -- 0:00:42 408000 -- (-1783.598) (-1786.148) [-1786.850] (-1790.296) * (-1785.172) [-1784.501] (-1784.825) (-1786.381) -- 0:00:42 408500 -- (-1785.255) [-1785.409] (-1786.009) (-1789.391) * (-1787.166) [-1785.812] (-1786.004) (-1788.074) -- 0:00:41 409000 -- (-1790.048) [-1784.864] (-1785.805) (-1786.078) * [-1785.578] (-1783.631) (-1786.420) (-1786.873) -- 0:00:41 409500 -- [-1786.904] (-1787.315) (-1788.253) (-1785.431) * (-1785.561) (-1783.840) [-1785.185] (-1787.485) -- 0:00:41 410000 -- (-1784.952) (-1786.895) [-1784.633] (-1786.653) * [-1783.252] (-1784.636) (-1784.675) (-1784.818) -- 0:00:43 Average standard deviation of split frequencies: 0.015305 410500 -- (-1786.660) [-1785.010] (-1784.567) (-1784.396) * (-1786.985) (-1785.654) [-1784.725] (-1785.929) -- 0:00:43 411000 -- (-1788.251) (-1785.733) (-1787.531) [-1784.714] * [-1786.886] (-1783.917) (-1784.457) (-1788.977) -- 0:00:42 411500 -- (-1786.542) [-1784.011] (-1796.901) (-1786.777) * (-1786.677) [-1785.805] (-1785.292) (-1789.404) -- 0:00:42 412000 -- (-1785.020) (-1786.246) (-1787.171) [-1787.182] * (-1788.354) [-1783.912] (-1786.843) (-1786.158) -- 0:00:42 412500 -- (-1787.009) (-1786.439) (-1787.854) [-1787.815] * (-1784.365) (-1783.545) (-1783.655) [-1784.704] -- 0:00:42 413000 -- (-1798.638) [-1785.420] (-1785.976) (-1785.278) * [-1787.367] (-1784.589) (-1785.430) (-1784.629) -- 0:00:42 413500 -- (-1785.910) [-1784.655] (-1784.907) (-1785.916) * (-1787.336) (-1786.298) (-1783.817) [-1785.117] -- 0:00:42 414000 -- (-1787.466) [-1785.623] (-1785.804) (-1786.843) * [-1787.676] (-1785.336) (-1784.104) (-1786.005) -- 0:00:42 414500 -- (-1787.264) (-1783.869) [-1784.800] (-1785.402) * (-1789.472) (-1785.378) (-1784.877) [-1784.125] -- 0:00:42 415000 -- (-1786.163) (-1785.274) [-1784.401] (-1786.793) * (-1787.774) (-1784.727) [-1784.719] (-1784.669) -- 0:00:42 Average standard deviation of split frequencies: 0.015865 415500 -- (-1784.452) [-1786.802] (-1788.214) (-1785.966) * (-1786.218) [-1784.006] (-1783.225) (-1788.086) -- 0:00:42 416000 -- (-1783.909) (-1791.542) (-1788.332) [-1784.353] * (-1788.505) (-1787.128) [-1783.837] (-1788.933) -- 0:00:42 416500 -- (-1785.293) (-1786.667) [-1784.270] (-1783.757) * (-1788.922) [-1785.423] (-1785.439) (-1786.153) -- 0:00:42 417000 -- [-1784.795] (-1786.987) (-1783.567) (-1783.983) * (-1786.212) (-1785.450) [-1784.637] (-1785.802) -- 0:00:41 417500 -- (-1785.839) (-1788.087) (-1787.313) [-1785.450] * (-1783.878) [-1784.671] (-1784.694) (-1790.383) -- 0:00:41 418000 -- [-1785.496] (-1785.152) (-1792.681) (-1789.701) * (-1784.516) [-1783.487] (-1784.859) (-1786.352) -- 0:00:41 418500 -- [-1788.207] (-1788.147) (-1786.136) (-1786.172) * [-1785.303] (-1785.083) (-1788.182) (-1785.240) -- 0:00:41 419000 -- (-1787.829) (-1785.966) (-1784.836) [-1786.403] * (-1785.399) (-1784.901) [-1784.552] (-1790.528) -- 0:00:41 419500 -- [-1784.145] (-1792.531) (-1784.412) (-1786.143) * [-1785.633] (-1785.879) (-1783.982) (-1790.670) -- 0:00:41 420000 -- (-1787.977) (-1790.207) [-1785.666] (-1784.875) * [-1784.382] (-1784.054) (-1785.594) (-1789.341) -- 0:00:41 Average standard deviation of split frequencies: 0.017930 420500 -- (-1786.296) [-1784.162] (-1784.394) (-1785.952) * (-1783.838) (-1786.185) [-1786.021] (-1787.481) -- 0:00:41 421000 -- (-1784.143) [-1783.840] (-1788.403) (-1784.248) * [-1784.923] (-1788.468) (-1784.732) (-1786.629) -- 0:00:41 421500 -- (-1784.688) (-1787.658) (-1786.536) [-1783.984] * (-1788.647) (-1783.725) (-1783.940) [-1786.074] -- 0:00:41 422000 -- [-1790.260] (-1787.035) (-1786.483) (-1784.180) * (-1784.822) (-1786.795) (-1786.167) [-1788.572] -- 0:00:41 422500 -- (-1786.765) (-1784.139) [-1784.992] (-1783.804) * [-1785.913] (-1785.405) (-1788.079) (-1786.887) -- 0:00:41 423000 -- [-1786.427] (-1784.842) (-1785.687) (-1783.430) * (-1786.369) (-1785.678) [-1783.534] (-1785.215) -- 0:00:40 423500 -- [-1788.725] (-1785.201) (-1785.030) (-1786.026) * (-1785.516) [-1785.620] (-1784.448) (-1783.622) -- 0:00:42 424000 -- [-1790.289] (-1783.580) (-1785.255) (-1787.930) * (-1784.202) (-1785.582) [-1784.481] (-1784.985) -- 0:00:42 424500 -- (-1786.229) [-1784.680] (-1787.277) (-1789.473) * (-1784.097) [-1785.027] (-1783.546) (-1786.514) -- 0:00:42 425000 -- (-1784.843) (-1783.852) [-1785.552] (-1786.169) * (-1785.870) (-1786.724) (-1790.338) [-1788.358] -- 0:00:41 Average standard deviation of split frequencies: 0.016968 425500 -- (-1788.315) [-1785.884] (-1784.918) (-1787.679) * [-1785.239] (-1786.688) (-1793.036) (-1791.866) -- 0:00:41 426000 -- (-1786.855) (-1785.099) (-1786.664) [-1790.682] * (-1785.282) (-1787.246) [-1786.921] (-1786.204) -- 0:00:41 426500 -- (-1784.298) (-1787.485) (-1786.282) [-1786.337] * (-1786.057) (-1785.408) [-1790.680] (-1787.501) -- 0:00:41 427000 -- (-1785.234) [-1787.811] (-1785.174) (-1787.448) * [-1787.779] (-1787.186) (-1787.764) (-1786.518) -- 0:00:41 427500 -- [-1784.041] (-1783.995) (-1786.004) (-1784.478) * (-1785.126) [-1784.532] (-1785.598) (-1788.544) -- 0:00:41 428000 -- (-1789.175) [-1783.821] (-1784.762) (-1784.025) * (-1787.498) [-1783.430] (-1784.921) (-1790.549) -- 0:00:41 428500 -- (-1784.294) (-1785.724) [-1786.174] (-1784.574) * (-1787.328) [-1786.079] (-1788.105) (-1786.859) -- 0:00:41 429000 -- [-1784.167] (-1785.763) (-1786.428) (-1785.776) * [-1786.865] (-1787.305) (-1785.162) (-1785.194) -- 0:00:41 429500 -- (-1784.129) [-1784.006] (-1784.194) (-1787.244) * (-1790.496) (-1783.600) [-1784.993] (-1784.984) -- 0:00:41 430000 -- (-1786.430) (-1786.620) [-1786.038] (-1785.262) * (-1785.829) (-1784.078) (-1788.234) [-1785.340] -- 0:00:41 Average standard deviation of split frequencies: 0.019703 430500 -- (-1784.286) (-1790.369) (-1787.996) [-1784.736] * (-1789.525) (-1787.190) (-1785.595) [-1786.203] -- 0:00:41 431000 -- (-1784.324) (-1788.256) (-1785.766) [-1785.049] * (-1787.920) (-1795.394) [-1784.978] (-1786.515) -- 0:00:40 431500 -- (-1783.508) [-1787.342] (-1785.940) (-1785.973) * (-1784.259) (-1789.088) (-1784.983) [-1786.214] -- 0:00:40 432000 -- (-1783.996) (-1785.468) (-1790.095) [-1784.316] * [-1784.420] (-1787.258) (-1788.664) (-1786.921) -- 0:00:40 432500 -- [-1783.504] (-1785.571) (-1787.487) (-1784.776) * (-1790.082) [-1786.069] (-1789.301) (-1784.777) -- 0:00:40 433000 -- (-1783.498) [-1785.519] (-1784.392) (-1784.610) * (-1790.953) (-1785.107) (-1783.851) [-1785.753] -- 0:00:40 433500 -- (-1784.792) (-1785.653) [-1789.042] (-1786.030) * (-1788.997) [-1785.927] (-1784.706) (-1788.764) -- 0:00:40 434000 -- [-1784.160] (-1785.785) (-1789.674) (-1791.902) * (-1787.305) [-1787.858] (-1784.895) (-1789.818) -- 0:00:40 434500 -- [-1784.452] (-1786.438) (-1786.690) (-1792.321) * (-1786.869) [-1785.057] (-1788.642) (-1785.091) -- 0:00:40 435000 -- [-1784.969] (-1788.666) (-1786.132) (-1785.952) * (-1787.039) (-1785.449) (-1787.948) [-1785.382] -- 0:00:40 Average standard deviation of split frequencies: 0.019462 435500 -- (-1785.213) (-1792.682) (-1788.863) [-1785.276] * (-1786.113) (-1786.897) [-1784.173] (-1786.493) -- 0:00:40 436000 -- (-1785.999) (-1785.985) [-1785.132] (-1787.822) * (-1787.606) [-1786.718] (-1783.581) (-1784.906) -- 0:00:40 436500 -- (-1785.625) [-1784.255] (-1786.504) (-1788.494) * (-1785.136) [-1785.821] (-1792.174) (-1787.821) -- 0:00:41 437000 -- (-1787.064) [-1785.689] (-1787.477) (-1786.328) * (-1785.980) [-1787.957] (-1786.340) (-1785.585) -- 0:00:41 437500 -- [-1784.764] (-1785.264) (-1786.567) (-1784.953) * [-1785.524] (-1786.961) (-1785.245) (-1786.363) -- 0:00:41 438000 -- [-1783.651] (-1784.384) (-1790.881) (-1785.005) * (-1789.287) [-1786.973] (-1785.954) (-1787.275) -- 0:00:41 438500 -- [-1784.073] (-1788.410) (-1787.160) (-1788.161) * (-1786.191) (-1786.899) (-1786.592) [-1785.855] -- 0:00:40 439000 -- [-1784.517] (-1785.281) (-1786.559) (-1783.802) * [-1785.964] (-1787.182) (-1783.476) (-1785.207) -- 0:00:40 439500 -- (-1784.205) [-1785.854] (-1787.654) (-1784.426) * (-1790.833) (-1786.454) (-1783.309) [-1786.839] -- 0:00:40 440000 -- (-1786.252) [-1787.600] (-1787.812) (-1784.247) * (-1784.119) [-1783.520] (-1783.773) (-1787.994) -- 0:00:40 Average standard deviation of split frequencies: 0.020682 440500 -- (-1785.261) (-1787.306) (-1788.124) [-1785.386] * [-1783.786] (-1787.508) (-1785.735) (-1787.215) -- 0:00:40 441000 -- [-1785.252] (-1786.412) (-1785.840) (-1787.348) * (-1784.407) (-1789.201) (-1788.001) [-1786.847] -- 0:00:40 441500 -- [-1787.007] (-1783.376) (-1786.944) (-1785.343) * (-1784.056) (-1788.383) [-1785.346] (-1786.497) -- 0:00:40 442000 -- (-1784.170) [-1785.371] (-1787.719) (-1784.935) * (-1783.634) [-1783.754] (-1785.019) (-1789.601) -- 0:00:40 442500 -- (-1786.397) (-1785.347) (-1785.254) [-1784.317] * (-1785.278) (-1783.927) [-1787.155] (-1786.726) -- 0:00:40 443000 -- [-1786.058] (-1789.279) (-1784.975) (-1784.243) * (-1783.703) (-1783.753) [-1787.717] (-1787.609) -- 0:00:40 443500 -- (-1785.298) (-1794.469) (-1783.666) [-1785.582] * [-1784.306] (-1785.883) (-1785.726) (-1784.741) -- 0:00:40 444000 -- [-1788.634] (-1789.204) (-1784.244) (-1783.367) * (-1783.830) (-1785.730) (-1787.107) [-1784.456] -- 0:00:40 444500 -- (-1787.036) (-1784.984) (-1784.897) [-1783.367] * (-1783.973) (-1785.928) (-1786.404) [-1786.603] -- 0:00:39 445000 -- [-1783.974] (-1785.502) (-1785.873) (-1786.064) * (-1784.090) (-1789.513) (-1784.904) [-1786.771] -- 0:00:39 Average standard deviation of split frequencies: 0.019025 445500 -- [-1784.473] (-1786.340) (-1785.037) (-1786.152) * (-1785.727) (-1786.385) (-1785.415) [-1785.852] -- 0:00:39 446000 -- (-1784.808) (-1785.389) (-1784.487) [-1785.228] * [-1784.230] (-1786.256) (-1783.699) (-1790.151) -- 0:00:39 446500 -- (-1786.472) [-1786.705] (-1784.091) (-1784.322) * (-1787.540) (-1787.717) [-1786.471] (-1788.289) -- 0:00:39 447000 -- (-1786.422) [-1785.867] (-1783.789) (-1786.030) * (-1785.975) [-1787.592] (-1786.292) (-1787.074) -- 0:00:39 447500 -- (-1786.573) [-1786.009] (-1783.851) (-1784.857) * (-1787.089) (-1785.087) [-1786.367] (-1786.392) -- 0:00:39 448000 -- (-1791.365) (-1787.398) (-1790.032) [-1784.923] * [-1788.974] (-1786.282) (-1784.955) (-1785.764) -- 0:00:39 448500 -- (-1786.145) (-1787.586) [-1786.191] (-1788.174) * (-1783.955) (-1785.867) (-1785.931) [-1786.444] -- 0:00:39 449000 -- (-1784.073) [-1784.776] (-1785.497) (-1787.022) * [-1787.179] (-1786.408) (-1784.609) (-1787.687) -- 0:00:39 449500 -- (-1795.452) [-1785.617] (-1785.667) (-1785.078) * (-1786.551) [-1785.844] (-1785.372) (-1784.765) -- 0:00:39 450000 -- (-1788.170) (-1785.376) (-1785.460) [-1787.241] * (-1785.199) (-1789.101) [-1784.785] (-1784.299) -- 0:00:39 Average standard deviation of split frequencies: 0.019526 450500 -- (-1785.863) [-1784.211] (-1785.159) (-1787.154) * (-1784.068) [-1785.970] (-1785.132) (-1784.474) -- 0:00:40 451000 -- (-1786.843) (-1785.461) [-1784.140] (-1785.096) * (-1784.560) (-1785.830) [-1785.755] (-1789.454) -- 0:00:40 451500 -- (-1789.028) (-1785.094) [-1784.802] (-1785.920) * (-1784.858) (-1788.506) [-1784.605] (-1783.742) -- 0:00:40 452000 -- (-1786.767) [-1784.579] (-1785.116) (-1786.900) * (-1784.579) (-1784.354) [-1786.325] (-1786.465) -- 0:00:40 452500 -- (-1788.796) [-1784.866] (-1785.521) (-1785.432) * [-1785.939] (-1784.502) (-1787.475) (-1785.020) -- 0:00:39 453000 -- (-1789.941) (-1784.197) (-1788.919) [-1784.163] * [-1785.385] (-1783.671) (-1784.406) (-1789.370) -- 0:00:39 453500 -- (-1786.738) (-1785.861) [-1785.786] (-1783.394) * (-1784.916) [-1787.041] (-1784.397) (-1787.715) -- 0:00:39 454000 -- (-1785.597) (-1785.527) (-1788.651) [-1783.417] * (-1789.828) (-1789.365) [-1784.381] (-1786.587) -- 0:00:39 454500 -- (-1784.430) (-1788.203) [-1787.721] (-1783.619) * (-1789.848) [-1788.940] (-1785.606) (-1787.085) -- 0:00:39 455000 -- (-1785.195) (-1786.037) (-1787.566) [-1786.819] * [-1785.133] (-1786.913) (-1786.556) (-1786.441) -- 0:00:39 Average standard deviation of split frequencies: 0.018608 455500 -- (-1784.177) (-1783.862) [-1785.322] (-1785.921) * (-1787.087) (-1788.133) (-1787.606) [-1784.857] -- 0:00:39 456000 -- (-1783.631) (-1784.166) [-1784.753] (-1784.267) * (-1784.305) (-1790.399) (-1787.177) [-1787.234] -- 0:00:39 456500 -- (-1790.278) [-1785.028] (-1785.567) (-1787.239) * (-1786.913) (-1787.044) (-1784.427) [-1783.581] -- 0:00:39 457000 -- (-1789.827) (-1785.039) (-1784.904) [-1784.555] * (-1788.519) (-1787.022) (-1784.196) [-1785.050] -- 0:00:39 457500 -- (-1783.991) (-1785.733) [-1786.714] (-1786.723) * (-1788.544) [-1786.914] (-1785.472) (-1786.364) -- 0:00:39 458000 -- (-1784.982) (-1788.192) (-1787.338) [-1788.029] * [-1785.079] (-1786.004) (-1785.011) (-1784.219) -- 0:00:39 458500 -- [-1786.197] (-1784.765) (-1785.879) (-1785.053) * (-1784.883) [-1785.852] (-1787.587) (-1785.010) -- 0:00:38 459000 -- (-1784.957) [-1784.241] (-1784.504) (-1784.703) * [-1787.217] (-1785.359) (-1785.064) (-1783.724) -- 0:00:38 459500 -- (-1786.492) [-1784.652] (-1784.301) (-1790.426) * (-1784.928) [-1789.234] (-1785.150) (-1786.492) -- 0:00:38 460000 -- [-1784.979] (-1790.296) (-1785.338) (-1788.342) * [-1785.746] (-1785.416) (-1784.368) (-1786.325) -- 0:00:38 Average standard deviation of split frequencies: 0.017737 460500 -- (-1789.222) (-1785.996) [-1785.660] (-1787.352) * (-1787.332) [-1785.404] (-1785.784) (-1784.335) -- 0:00:38 461000 -- (-1788.049) (-1783.637) [-1786.988] (-1794.067) * [-1785.806] (-1786.514) (-1785.624) (-1784.743) -- 0:00:38 461500 -- (-1787.044) [-1785.854] (-1785.142) (-1784.899) * (-1786.343) [-1784.920] (-1784.961) (-1784.990) -- 0:00:38 462000 -- (-1792.748) (-1785.283) [-1784.281] (-1786.655) * [-1784.581] (-1785.798) (-1788.619) (-1784.675) -- 0:00:38 462500 -- [-1786.965] (-1785.256) (-1784.671) (-1784.226) * (-1785.442) (-1789.178) (-1786.194) [-1784.307] -- 0:00:38 463000 -- (-1784.923) (-1785.432) (-1785.433) [-1786.551] * (-1786.285) (-1785.916) (-1786.281) [-1785.851] -- 0:00:38 463500 -- (-1787.331) [-1783.851] (-1785.019) (-1786.746) * (-1786.588) (-1786.323) [-1785.126] (-1785.869) -- 0:00:38 464000 -- (-1788.627) [-1785.264] (-1786.837) (-1784.049) * (-1787.265) [-1787.729] (-1785.359) (-1784.508) -- 0:00:38 464500 -- [-1786.187] (-1786.263) (-1784.567) (-1783.498) * (-1785.478) (-1787.382) [-1787.031] (-1784.797) -- 0:00:38 465000 -- [-1784.700] (-1784.727) (-1786.702) (-1784.171) * (-1786.032) (-1785.872) [-1786.535] (-1784.076) -- 0:00:39 Average standard deviation of split frequencies: 0.016860 465500 -- (-1784.245) [-1786.221] (-1788.018) (-1784.494) * [-1785.295] (-1785.691) (-1785.080) (-1786.857) -- 0:00:39 466000 -- (-1787.130) (-1786.805) [-1783.933] (-1784.577) * (-1785.957) (-1785.929) (-1785.199) [-1788.403] -- 0:00:38 466500 -- (-1786.075) (-1785.410) [-1784.396] (-1789.804) * [-1784.212] (-1783.822) (-1785.635) (-1787.560) -- 0:00:38 467000 -- (-1786.039) (-1785.613) (-1783.638) [-1784.927] * (-1788.000) [-1785.534] (-1787.025) (-1787.070) -- 0:00:38 467500 -- (-1788.895) (-1785.567) (-1784.088) [-1785.067] * (-1786.319) (-1787.697) (-1787.961) [-1788.466] -- 0:00:38 468000 -- [-1785.151] (-1785.220) (-1783.978) (-1785.036) * (-1786.764) [-1785.177] (-1787.929) (-1786.589) -- 0:00:38 468500 -- (-1786.945) (-1786.388) (-1787.312) [-1787.603] * (-1784.735) (-1786.608) [-1784.072] (-1789.567) -- 0:00:38 469000 -- (-1789.448) (-1786.552) (-1788.627) [-1787.018] * [-1783.918] (-1784.210) (-1785.833) (-1785.304) -- 0:00:38 469500 -- (-1786.810) (-1785.898) (-1791.047) [-1787.632] * (-1784.648) [-1784.718] (-1784.965) (-1785.158) -- 0:00:38 470000 -- [-1785.014] (-1789.188) (-1789.355) (-1788.250) * (-1786.528) [-1788.456] (-1785.234) (-1784.610) -- 0:00:38 Average standard deviation of split frequencies: 0.018696 470500 -- [-1784.343] (-1786.072) (-1786.129) (-1787.904) * (-1784.679) [-1787.895] (-1785.681) (-1786.192) -- 0:00:38 471000 -- (-1783.751) (-1785.369) (-1785.504) [-1784.406] * (-1785.211) (-1785.125) (-1794.096) [-1785.199] -- 0:00:38 471500 -- [-1786.331] (-1785.032) (-1787.665) (-1783.945) * (-1783.766) (-1786.199) [-1784.655] (-1788.923) -- 0:00:38 472000 -- (-1783.637) (-1784.255) [-1784.098] (-1789.670) * (-1787.449) (-1787.719) (-1785.837) [-1786.980] -- 0:00:38 472500 -- (-1785.918) (-1783.632) [-1784.428] (-1789.526) * (-1785.738) [-1784.859] (-1784.943) (-1788.397) -- 0:00:37 473000 -- [-1784.098] (-1783.506) (-1784.528) (-1787.525) * (-1788.178) (-1785.017) [-1786.058] (-1785.149) -- 0:00:37 473500 -- (-1787.004) [-1784.776] (-1785.293) (-1788.781) * (-1785.370) (-1784.575) (-1784.373) [-1784.420] -- 0:00:37 474000 -- (-1787.317) [-1785.169] (-1786.956) (-1784.871) * [-1786.664] (-1784.510) (-1784.980) (-1784.860) -- 0:00:37 474500 -- (-1785.901) [-1786.548] (-1783.640) (-1784.372) * (-1787.588) [-1786.329] (-1786.304) (-1785.123) -- 0:00:37 475000 -- (-1785.513) (-1790.482) (-1784.099) [-1785.052] * (-1784.160) (-1785.964) (-1791.330) [-1786.114] -- 0:00:37 Average standard deviation of split frequencies: 0.017826 475500 -- (-1787.739) [-1786.736] (-1790.563) (-1787.157) * (-1786.215) (-1785.002) [-1783.917] (-1787.182) -- 0:00:37 476000 -- [-1786.198] (-1787.061) (-1784.595) (-1785.563) * (-1785.685) (-1788.884) [-1783.534] (-1786.227) -- 0:00:37 476500 -- (-1785.602) (-1789.277) (-1786.179) [-1783.598] * (-1787.646) [-1786.140] (-1784.550) (-1783.529) -- 0:00:37 477000 -- [-1785.962] (-1789.822) (-1785.144) (-1787.516) * (-1787.359) (-1791.550) (-1787.966) [-1784.358] -- 0:00:37 477500 -- (-1784.136) (-1788.730) (-1785.580) [-1784.547] * (-1784.371) (-1785.168) (-1785.805) [-1786.079] -- 0:00:37 478000 -- (-1784.081) (-1784.135) [-1786.190] (-1786.404) * (-1785.483) [-1784.185] (-1787.710) (-1785.772) -- 0:00:37 478500 -- (-1786.304) (-1786.787) (-1787.855) [-1784.179] * [-1785.995] (-1784.172) (-1784.915) (-1786.150) -- 0:00:37 479000 -- (-1787.406) (-1789.719) (-1788.171) [-1784.174] * (-1784.288) (-1785.406) [-1786.281] (-1784.551) -- 0:00:36 479500 -- (-1785.338) (-1784.759) (-1792.553) [-1784.029] * [-1783.901] (-1784.326) (-1784.987) (-1786.813) -- 0:00:37 480000 -- (-1785.685) [-1784.604] (-1786.453) (-1783.816) * (-1784.889) (-1786.172) [-1784.980] (-1783.679) -- 0:00:37 Average standard deviation of split frequencies: 0.020268 480500 -- (-1785.981) [-1783.923] (-1785.244) (-1783.900) * (-1785.124) (-1786.105) (-1783.747) [-1786.086] -- 0:00:37 481000 -- [-1786.418] (-1784.261) (-1789.118) (-1786.475) * (-1784.539) (-1786.507) (-1784.914) [-1786.124] -- 0:00:37 481500 -- [-1786.944] (-1785.230) (-1785.840) (-1786.039) * (-1784.924) (-1786.471) [-1784.103] (-1785.311) -- 0:00:37 482000 -- (-1788.342) [-1786.470] (-1784.137) (-1787.185) * (-1785.062) (-1785.809) [-1784.256] (-1784.158) -- 0:00:37 482500 -- (-1786.421) [-1786.056] (-1783.965) (-1784.192) * (-1784.726) (-1786.196) [-1785.677] (-1783.483) -- 0:00:37 483000 -- (-1785.177) [-1783.721] (-1784.560) (-1784.623) * (-1789.477) (-1784.524) [-1788.111] (-1783.360) -- 0:00:37 483500 -- [-1785.339] (-1791.077) (-1784.651) (-1785.385) * [-1785.895] (-1784.451) (-1783.819) (-1783.661) -- 0:00:37 484000 -- [-1787.789] (-1784.122) (-1786.982) (-1784.298) * (-1784.252) [-1783.838] (-1785.988) (-1785.177) -- 0:00:37 484500 -- (-1786.452) (-1784.525) (-1786.194) [-1783.936] * [-1785.417] (-1784.729) (-1786.308) (-1785.588) -- 0:00:37 485000 -- (-1783.421) [-1785.485] (-1784.313) (-1783.948) * [-1784.768] (-1785.982) (-1784.567) (-1785.325) -- 0:00:37 Average standard deviation of split frequencies: 0.018106 485500 -- (-1785.668) (-1786.407) (-1786.195) [-1785.037] * (-1785.665) (-1784.669) [-1785.732] (-1785.135) -- 0:00:37 486000 -- (-1787.569) [-1783.585] (-1787.038) (-1784.869) * [-1785.794] (-1787.855) (-1785.119) (-1786.034) -- 0:00:37 486500 -- (-1786.089) (-1785.581) (-1787.082) [-1785.763] * (-1784.077) (-1784.710) [-1789.572] (-1784.571) -- 0:00:36 487000 -- (-1785.193) [-1787.148] (-1785.666) (-1786.401) * [-1788.390] (-1787.897) (-1790.519) (-1785.732) -- 0:00:36 487500 -- (-1785.876) (-1785.865) [-1788.868] (-1788.201) * (-1786.693) [-1785.015] (-1783.707) (-1783.896) -- 0:00:36 488000 -- (-1785.800) [-1785.251] (-1787.885) (-1784.572) * (-1785.263) (-1785.197) (-1784.495) [-1784.337] -- 0:00:36 488500 -- [-1783.840] (-1785.903) (-1786.564) (-1784.766) * (-1789.126) (-1784.467) [-1784.306] (-1784.264) -- 0:00:36 489000 -- [-1785.320] (-1788.030) (-1788.074) (-1784.849) * (-1786.403) (-1786.128) [-1784.639] (-1785.730) -- 0:00:36 489500 -- (-1787.175) [-1784.689] (-1785.043) (-1786.555) * (-1784.109) (-1787.375) [-1783.689] (-1785.659) -- 0:00:36 490000 -- (-1785.712) [-1786.294] (-1786.297) (-1787.015) * (-1785.421) [-1785.482] (-1785.522) (-1788.774) -- 0:00:36 Average standard deviation of split frequencies: 0.020496 490500 -- (-1784.739) (-1786.554) (-1785.316) [-1787.193] * [-1786.704] (-1783.806) (-1785.687) (-1786.748) -- 0:00:36 491000 -- (-1785.442) (-1789.621) (-1785.291) [-1785.975] * (-1786.464) [-1783.526] (-1790.624) (-1785.936) -- 0:00:36 491500 -- (-1787.035) (-1786.682) [-1784.586] (-1786.579) * [-1785.915] (-1786.548) (-1786.765) (-1790.199) -- 0:00:36 492000 -- (-1791.283) (-1784.130) [-1787.926] (-1789.512) * (-1786.078) [-1787.554] (-1786.036) (-1788.425) -- 0:00:36 492500 -- (-1784.697) [-1785.105] (-1788.215) (-1784.052) * (-1785.270) (-1783.663) (-1785.772) [-1786.787] -- 0:00:36 493000 -- (-1784.961) (-1784.245) (-1788.554) [-1785.029] * (-1785.178) [-1783.948] (-1785.602) (-1786.642) -- 0:00:35 493500 -- (-1791.170) (-1786.157) [-1785.982] (-1789.184) * (-1786.192) (-1786.372) [-1785.253] (-1786.848) -- 0:00:36 494000 -- (-1785.257) (-1785.253) (-1785.571) [-1783.845] * (-1789.974) (-1787.236) [-1785.100] (-1788.635) -- 0:00:36 494500 -- (-1786.006) (-1785.774) (-1785.298) [-1784.372] * (-1786.819) (-1788.227) [-1785.198] (-1788.608) -- 0:00:36 495000 -- (-1785.370) (-1788.182) [-1784.440] (-1785.080) * (-1785.230) (-1785.463) [-1783.627] (-1791.798) -- 0:00:36 Average standard deviation of split frequencies: 0.019642 495500 -- [-1785.538] (-1786.331) (-1785.106) (-1785.851) * (-1785.524) (-1784.701) (-1783.647) [-1787.466] -- 0:00:36 496000 -- [-1786.872] (-1785.554) (-1788.799) (-1785.773) * (-1784.009) (-1790.178) [-1785.446] (-1785.408) -- 0:00:36 496500 -- (-1784.354) (-1785.827) (-1791.219) [-1787.454] * (-1784.653) (-1789.908) [-1784.332] (-1784.998) -- 0:00:36 497000 -- (-1785.810) [-1785.721] (-1789.371) (-1788.788) * [-1786.309] (-1789.320) (-1784.198) (-1786.606) -- 0:00:36 497500 -- [-1787.129] (-1784.083) (-1786.644) (-1786.560) * (-1784.593) (-1789.971) [-1783.441] (-1787.153) -- 0:00:36 498000 -- (-1787.989) (-1783.594) (-1784.160) [-1786.479] * (-1785.675) [-1783.832] (-1785.020) (-1784.946) -- 0:00:36 498500 -- (-1786.152) [-1785.156] (-1784.406) (-1785.512) * (-1784.080) (-1784.523) [-1788.000] (-1790.037) -- 0:00:36 499000 -- (-1792.204) (-1784.487) (-1784.062) [-1785.809] * (-1784.177) (-1783.924) [-1784.658] (-1787.942) -- 0:00:36 499500 -- (-1786.623) (-1785.630) [-1785.241] (-1785.555) * [-1787.035] (-1784.457) (-1786.500) (-1790.780) -- 0:00:36 500000 -- [-1786.728] (-1784.835) (-1787.207) (-1785.216) * (-1790.567) [-1787.521] (-1783.855) (-1789.373) -- 0:00:36 Average standard deviation of split frequencies: 0.017576 500500 -- (-1785.518) (-1785.543) [-1787.155] (-1784.939) * (-1785.430) [-1783.975] (-1784.574) (-1784.174) -- 0:00:35 501000 -- (-1785.231) (-1783.810) (-1788.464) [-1788.872] * (-1785.197) [-1787.436] (-1785.778) (-1787.274) -- 0:00:35 501500 -- [-1784.972] (-1785.226) (-1785.176) (-1785.790) * (-1784.123) (-1785.902) (-1785.786) [-1784.961] -- 0:00:35 502000 -- (-1787.497) (-1784.976) [-1784.360] (-1786.080) * (-1783.695) (-1786.708) [-1790.346] (-1786.897) -- 0:00:35 502500 -- (-1787.129) (-1784.491) [-1786.109] (-1785.443) * [-1783.940] (-1787.341) (-1785.412) (-1785.049) -- 0:00:35 503000 -- (-1784.131) (-1796.014) [-1784.847] (-1787.274) * (-1785.488) (-1784.357) (-1785.390) [-1786.426] -- 0:00:35 503500 -- (-1784.540) (-1787.751) (-1785.094) [-1788.608] * (-1784.831) (-1784.620) (-1786.404) [-1785.548] -- 0:00:35 504000 -- (-1785.260) [-1786.268] (-1785.223) (-1786.867) * [-1785.049] (-1786.389) (-1786.280) (-1786.694) -- 0:00:35 504500 -- (-1787.783) [-1784.311] (-1785.070) (-1785.566) * [-1784.952] (-1785.465) (-1785.513) (-1786.371) -- 0:00:35 505000 -- [-1787.600] (-1783.873) (-1785.743) (-1788.066) * (-1783.546) (-1785.295) (-1786.212) [-1785.016] -- 0:00:35 Average standard deviation of split frequencies: 0.017390 505500 -- (-1786.393) (-1788.563) (-1785.588) [-1784.040] * (-1783.995) (-1785.131) [-1783.894] (-1785.345) -- 0:00:35 506000 -- [-1784.024] (-1786.305) (-1785.994) (-1784.784) * (-1787.440) (-1785.128) (-1783.654) [-1785.903] -- 0:00:35 506500 -- [-1785.575] (-1785.102) (-1785.862) (-1786.294) * (-1785.406) (-1786.603) [-1784.004] (-1787.112) -- 0:00:35 507000 -- [-1786.969] (-1784.870) (-1785.826) (-1786.721) * [-1785.497] (-1786.110) (-1786.317) (-1786.987) -- 0:00:35 507500 -- (-1786.207) (-1784.994) [-1785.456] (-1784.666) * (-1787.684) (-1787.058) (-1786.044) [-1785.682] -- 0:00:35 508000 -- [-1787.887] (-1788.225) (-1786.987) (-1786.886) * (-1786.705) (-1785.171) (-1788.048) [-1789.711] -- 0:00:35 508500 -- [-1785.403] (-1787.192) (-1785.026) (-1792.883) * (-1787.451) [-1785.851] (-1784.959) (-1787.092) -- 0:00:35 509000 -- (-1784.122) [-1785.057] (-1789.951) (-1785.571) * [-1786.627] (-1785.752) (-1788.227) (-1783.938) -- 0:00:35 509500 -- [-1784.133] (-1787.302) (-1784.741) (-1787.242) * (-1784.815) [-1786.201] (-1786.889) (-1785.066) -- 0:00:35 510000 -- (-1784.765) (-1784.151) (-1785.781) [-1785.655] * (-1783.801) [-1786.161] (-1783.951) (-1786.499) -- 0:00:35 Average standard deviation of split frequencies: 0.016001 510500 -- (-1786.083) (-1786.404) (-1785.128) [-1785.320] * [-1784.876] (-1785.530) (-1784.358) (-1786.503) -- 0:00:35 511000 -- [-1785.286] (-1784.654) (-1786.750) (-1784.182) * [-1784.988] (-1784.959) (-1786.686) (-1785.555) -- 0:00:35 511500 -- [-1787.060] (-1784.306) (-1783.442) (-1785.877) * [-1783.844] (-1787.035) (-1784.900) (-1785.984) -- 0:00:35 512000 -- [-1783.835] (-1789.905) (-1786.718) (-1785.379) * (-1784.914) (-1787.765) (-1784.024) [-1786.671] -- 0:00:35 512500 -- (-1785.300) (-1787.036) (-1783.964) [-1786.833] * (-1792.384) (-1786.451) [-1785.774] (-1792.450) -- 0:00:35 513000 -- (-1785.220) (-1787.054) [-1785.514] (-1783.553) * (-1791.277) (-1787.220) [-1788.465] (-1791.959) -- 0:00:35 513500 -- (-1786.594) [-1786.757] (-1785.183) (-1786.781) * (-1787.111) [-1788.340] (-1789.219) (-1787.101) -- 0:00:35 514000 -- (-1789.878) (-1788.670) [-1785.361] (-1787.672) * (-1784.288) (-1790.592) [-1784.724] (-1784.013) -- 0:00:34 514500 -- (-1789.186) (-1785.299) (-1790.868) [-1783.895] * (-1787.710) (-1784.447) (-1787.221) [-1784.217] -- 0:00:34 515000 -- (-1785.672) (-1785.360) (-1791.480) [-1784.345] * [-1789.735] (-1785.062) (-1784.060) (-1786.682) -- 0:00:34 Average standard deviation of split frequencies: 0.015226 515500 -- (-1784.615) (-1786.401) [-1786.272] (-1787.466) * (-1784.755) [-1788.102] (-1784.046) (-1786.728) -- 0:00:34 516000 -- (-1787.205) (-1784.672) [-1784.353] (-1791.277) * [-1784.804] (-1788.958) (-1784.090) (-1787.593) -- 0:00:34 516500 -- (-1784.551) (-1787.200) (-1784.295) [-1784.828] * (-1784.540) (-1784.336) (-1784.477) [-1788.090] -- 0:00:34 517000 -- [-1783.940] (-1785.791) (-1784.207) (-1788.100) * (-1785.749) (-1786.586) [-1783.902] (-1784.738) -- 0:00:34 517500 -- (-1783.971) (-1785.585) [-1784.296] (-1786.779) * (-1787.170) (-1785.354) [-1783.892] (-1783.501) -- 0:00:34 518000 -- (-1791.152) (-1784.138) [-1785.532] (-1786.250) * (-1784.909) (-1785.521) [-1785.481] (-1784.770) -- 0:00:34 518500 -- (-1787.933) [-1786.888] (-1784.071) (-1787.600) * (-1784.591) [-1785.575] (-1785.007) (-1785.850) -- 0:00:34 519000 -- (-1788.675) (-1787.392) (-1788.661) [-1787.566] * (-1788.917) [-1786.384] (-1788.356) (-1787.773) -- 0:00:34 519500 -- (-1783.849) [-1783.905] (-1784.190) (-1785.468) * (-1785.492) [-1787.099] (-1784.168) (-1788.235) -- 0:00:34 520000 -- (-1787.937) (-1785.836) (-1785.056) [-1785.993] * (-1786.021) (-1784.746) [-1786.637] (-1785.180) -- 0:00:34 Average standard deviation of split frequencies: 0.016297 520500 -- (-1786.788) (-1784.006) [-1786.007] (-1783.928) * (-1784.418) (-1787.951) [-1785.544] (-1786.043) -- 0:00:34 521000 -- (-1787.062) [-1784.284] (-1783.302) (-1786.140) * (-1785.421) (-1789.322) [-1786.265] (-1786.194) -- 0:00:34 521500 -- (-1786.795) [-1784.475] (-1783.830) (-1783.881) * (-1786.746) (-1784.450) (-1785.047) [-1783.551] -- 0:00:33 522000 -- (-1784.529) (-1787.494) [-1786.343] (-1784.147) * (-1785.639) [-1784.821] (-1784.668) (-1786.788) -- 0:00:34 522500 -- [-1785.004] (-1784.695) (-1783.975) (-1786.790) * (-1785.715) (-1784.566) [-1785.070] (-1784.885) -- 0:00:34 523000 -- (-1785.156) (-1783.680) [-1784.477] (-1784.300) * (-1788.793) (-1785.070) (-1787.423) [-1783.628] -- 0:00:34 523500 -- (-1785.202) [-1783.675] (-1784.661) (-1785.366) * (-1787.325) [-1785.585] (-1794.436) (-1786.101) -- 0:00:34 524000 -- (-1794.190) [-1783.717] (-1786.116) (-1786.646) * (-1789.817) [-1785.496] (-1784.718) (-1789.123) -- 0:00:34 524500 -- (-1794.781) (-1786.700) [-1787.484] (-1785.030) * (-1789.786) [-1786.271] (-1784.414) (-1783.795) -- 0:00:34 525000 -- (-1787.228) (-1786.448) (-1784.284) [-1784.796] * [-1785.263] (-1785.238) (-1783.856) (-1787.974) -- 0:00:34 Average standard deviation of split frequencies: 0.013144 525500 -- (-1785.758) (-1788.571) (-1785.168) [-1784.833] * (-1785.989) (-1792.443) [-1783.682] (-1785.227) -- 0:00:34 526000 -- (-1785.773) (-1785.380) [-1784.669] (-1786.016) * (-1783.838) (-1787.433) [-1785.689] (-1789.801) -- 0:00:34 526500 -- (-1784.599) (-1786.499) (-1784.546) [-1786.359] * [-1783.643] (-1786.325) (-1785.396) (-1786.248) -- 0:00:34 527000 -- (-1784.303) [-1786.608] (-1784.732) (-1784.703) * (-1784.314) (-1783.716) [-1786.214] (-1785.034) -- 0:00:34 527500 -- (-1784.999) (-1786.655) [-1787.294] (-1786.939) * (-1786.647) [-1785.048] (-1784.930) (-1785.531) -- 0:00:34 528000 -- (-1784.365) [-1784.424] (-1784.001) (-1790.712) * (-1788.146) (-1785.215) [-1784.460] (-1785.559) -- 0:00:33 528500 -- (-1783.790) (-1784.234) (-1784.205) [-1784.755] * (-1785.545) (-1785.431) (-1784.775) [-1784.536] -- 0:00:33 529000 -- [-1784.544] (-1786.277) (-1785.062) (-1784.069) * (-1786.018) (-1784.680) [-1785.782] (-1786.577) -- 0:00:33 529500 -- (-1786.909) [-1785.238] (-1787.070) (-1785.742) * (-1791.119) (-1785.512) (-1789.520) [-1786.215] -- 0:00:33 530000 -- (-1785.293) (-1785.177) (-1785.936) [-1787.715] * (-1789.347) (-1787.149) [-1788.031] (-1785.294) -- 0:00:33 Average standard deviation of split frequencies: 0.012437 530500 -- (-1785.249) (-1787.437) (-1787.006) [-1788.161] * (-1786.109) (-1789.783) [-1786.222] (-1786.183) -- 0:00:33 531000 -- [-1784.887] (-1787.087) (-1787.008) (-1786.021) * [-1785.388] (-1784.142) (-1783.571) (-1783.904) -- 0:00:33 531500 -- (-1783.938) (-1784.485) [-1785.993] (-1785.395) * (-1787.298) (-1784.227) (-1786.637) [-1784.305] -- 0:00:33 532000 -- [-1785.441] (-1785.616) (-1785.182) (-1784.933) * (-1787.167) (-1785.489) [-1784.015] (-1784.430) -- 0:00:33 532500 -- (-1786.588) (-1784.526) [-1783.925] (-1783.629) * (-1786.105) (-1784.084) (-1784.028) [-1784.815] -- 0:00:33 533000 -- (-1787.047) (-1784.738) (-1786.127) [-1783.620] * (-1789.742) [-1784.094] (-1783.969) (-1786.028) -- 0:00:33 533500 -- (-1785.337) (-1787.206) [-1786.451] (-1784.184) * (-1792.662) (-1786.279) [-1784.049] (-1783.728) -- 0:00:33 534000 -- (-1785.754) [-1788.188] (-1787.401) (-1784.140) * (-1784.337) [-1784.106] (-1786.859) (-1783.720) -- 0:00:33 534500 -- (-1787.788) (-1785.058) [-1785.145] (-1784.915) * (-1785.563) [-1785.435] (-1783.814) (-1786.828) -- 0:00:33 535000 -- (-1792.274) (-1788.280) (-1787.353) [-1785.033] * [-1785.051] (-1783.872) (-1788.281) (-1786.263) -- 0:00:33 Average standard deviation of split frequencies: 0.012313 535500 -- [-1784.665] (-1785.294) (-1786.216) (-1784.078) * (-1784.961) [-1784.591] (-1786.468) (-1785.778) -- 0:00:32 536000 -- (-1785.033) (-1784.678) [-1784.497] (-1785.654) * (-1785.867) [-1783.870] (-1785.380) (-1784.831) -- 0:00:32 536500 -- (-1785.138) [-1783.517] (-1783.279) (-1785.692) * (-1788.164) [-1783.926] (-1785.759) (-1786.069) -- 0:00:33 537000 -- (-1784.294) (-1784.741) (-1783.670) [-1784.042] * (-1786.475) (-1786.812) [-1784.905] (-1784.674) -- 0:00:33 537500 -- [-1784.713] (-1785.668) (-1785.513) (-1785.506) * (-1784.205) (-1785.503) (-1784.998) [-1790.770] -- 0:00:33 538000 -- (-1788.181) (-1787.752) [-1785.155] (-1784.228) * (-1785.372) (-1786.198) [-1785.224] (-1784.846) -- 0:00:33 538500 -- (-1787.988) (-1785.475) (-1785.959) [-1784.026] * (-1785.000) (-1788.456) (-1790.552) [-1783.698] -- 0:00:33 539000 -- [-1786.622] (-1786.285) (-1788.849) (-1783.805) * (-1785.594) (-1789.406) (-1783.664) [-1785.158] -- 0:00:33 539500 -- (-1784.790) [-1787.221] (-1785.003) (-1786.653) * [-1784.345] (-1783.780) (-1785.868) (-1786.362) -- 0:00:33 540000 -- (-1784.899) (-1786.647) [-1784.899] (-1784.170) * (-1784.677) [-1784.167] (-1787.365) (-1787.936) -- 0:00:33 Average standard deviation of split frequencies: 0.012207 540500 -- [-1785.653] (-1786.227) (-1784.183) (-1783.711) * (-1791.886) [-1788.689] (-1790.840) (-1788.628) -- 0:00:33 541000 -- [-1784.688] (-1792.795) (-1787.425) (-1788.141) * (-1789.252) [-1785.458] (-1795.188) (-1785.673) -- 0:00:33 541500 -- (-1786.868) (-1786.556) [-1783.896] (-1785.233) * (-1788.622) (-1788.737) [-1789.683] (-1789.103) -- 0:00:33 542000 -- (-1787.870) (-1789.823) [-1785.070] (-1785.980) * (-1790.523) [-1785.617] (-1784.533) (-1791.875) -- 0:00:32 542500 -- (-1785.167) (-1787.213) (-1785.702) [-1784.041] * (-1790.244) (-1786.883) (-1789.329) [-1785.666] -- 0:00:32 543000 -- (-1784.422) (-1786.663) [-1784.229] (-1787.524) * (-1788.328) (-1791.496) [-1785.759] (-1789.539) -- 0:00:32 543500 -- [-1789.290] (-1786.119) (-1788.265) (-1787.002) * (-1787.452) [-1785.612] (-1787.539) (-1786.239) -- 0:00:32 544000 -- (-1786.782) (-1787.501) [-1785.804] (-1788.791) * (-1784.343) [-1786.173] (-1785.090) (-1784.847) -- 0:00:32 544500 -- (-1785.150) (-1783.600) [-1786.616] (-1783.481) * [-1783.691] (-1784.625) (-1784.868) (-1786.526) -- 0:00:32 545000 -- (-1785.498) [-1784.408] (-1787.536) (-1784.162) * [-1783.659] (-1783.460) (-1786.250) (-1786.437) -- 0:00:32 Average standard deviation of split frequencies: 0.012087 545500 -- (-1786.422) [-1783.341] (-1787.741) (-1784.054) * (-1786.966) (-1784.769) [-1786.538] (-1786.150) -- 0:00:32 546000 -- (-1785.964) (-1784.679) (-1785.657) [-1784.665] * (-1789.058) (-1785.588) (-1785.191) [-1784.559] -- 0:00:32 546500 -- (-1786.453) (-1786.341) (-1787.103) [-1786.302] * (-1785.794) (-1786.868) (-1785.333) [-1784.708] -- 0:00:32 547000 -- (-1788.205) [-1784.732] (-1787.846) (-1784.124) * (-1784.118) (-1784.810) [-1784.655] (-1784.325) -- 0:00:32 547500 -- (-1786.478) [-1784.241] (-1787.406) (-1786.851) * (-1785.427) (-1784.068) [-1784.509] (-1784.692) -- 0:00:32 548000 -- (-1784.306) (-1784.841) (-1786.623) [-1784.170] * (-1784.497) [-1786.775] (-1784.559) (-1785.162) -- 0:00:32 548500 -- [-1786.063] (-1789.687) (-1784.788) (-1787.166) * (-1785.211) [-1784.775] (-1786.901) (-1784.270) -- 0:00:32 549000 -- (-1783.739) (-1786.011) (-1784.572) [-1785.587] * (-1786.047) [-1783.868] (-1787.593) (-1783.958) -- 0:00:32 549500 -- [-1783.941] (-1785.291) (-1784.059) (-1784.335) * (-1784.897) (-1784.782) [-1787.056] (-1784.372) -- 0:00:31 550000 -- [-1784.664] (-1786.013) (-1784.719) (-1785.139) * (-1788.257) (-1786.480) (-1786.307) [-1785.756] -- 0:00:31 Average standard deviation of split frequencies: 0.014268 550500 -- (-1786.014) (-1784.587) (-1785.667) [-1786.703] * (-1788.030) [-1786.435] (-1784.922) (-1784.755) -- 0:00:31 551000 -- (-1785.772) [-1784.764] (-1786.004) (-1788.692) * (-1785.657) [-1785.658] (-1785.497) (-1785.905) -- 0:00:32 551500 -- (-1784.223) (-1786.121) (-1788.015) [-1786.981] * [-1786.613] (-1786.578) (-1785.214) (-1784.328) -- 0:00:32 552000 -- (-1786.890) [-1784.713] (-1786.459) (-1790.076) * (-1786.957) (-1790.613) [-1784.530] (-1788.124) -- 0:00:32 552500 -- (-1786.421) (-1787.170) [-1784.082] (-1784.549) * (-1788.242) (-1787.752) (-1785.227) [-1788.388] -- 0:00:32 553000 -- [-1783.643] (-1786.627) (-1785.119) (-1790.500) * (-1786.043) (-1786.989) [-1784.266] (-1786.473) -- 0:00:32 553500 -- [-1784.506] (-1785.869) (-1786.413) (-1784.865) * [-1785.238] (-1788.068) (-1786.069) (-1784.532) -- 0:00:32 554000 -- [-1785.786] (-1787.785) (-1784.743) (-1783.689) * (-1786.957) [-1787.188] (-1785.086) (-1785.610) -- 0:00:32 554500 -- (-1784.423) (-1787.547) (-1784.938) [-1784.161] * (-1785.457) (-1786.449) (-1785.455) [-1786.006] -- 0:00:32 555000 -- (-1789.630) (-1786.123) [-1785.269] (-1788.530) * (-1786.345) (-1784.597) [-1784.507] (-1783.654) -- 0:00:32 Average standard deviation of split frequencies: 0.013566 555500 -- [-1786.916] (-1785.043) (-1787.092) (-1785.869) * (-1784.808) [-1787.917] (-1783.732) (-1786.830) -- 0:00:32 556000 -- [-1785.060] (-1783.766) (-1784.799) (-1786.470) * [-1784.722] (-1784.806) (-1787.833) (-1786.574) -- 0:00:31 556500 -- (-1785.818) (-1787.716) (-1783.573) [-1788.420] * [-1785.975] (-1784.496) (-1786.525) (-1790.182) -- 0:00:31 557000 -- [-1786.616] (-1788.190) (-1787.027) (-1784.990) * (-1785.419) [-1786.099] (-1787.121) (-1784.200) -- 0:00:31 557500 -- (-1786.028) (-1785.504) [-1786.187] (-1784.645) * (-1784.750) (-1786.668) [-1787.707] (-1785.530) -- 0:00:31 558000 -- (-1785.294) (-1785.824) [-1787.225] (-1784.893) * (-1785.768) (-1786.811) (-1788.665) [-1784.926] -- 0:00:31 558500 -- (-1784.505) (-1788.215) (-1787.277) [-1783.997] * (-1787.274) (-1786.222) (-1786.979) [-1783.631] -- 0:00:31 559000 -- [-1784.691] (-1784.343) (-1787.704) (-1784.768) * (-1789.690) [-1785.341] (-1784.731) (-1784.550) -- 0:00:31 559500 -- (-1784.314) [-1784.103] (-1785.010) (-1784.280) * (-1786.341) [-1784.710] (-1786.878) (-1785.302) -- 0:00:31 560000 -- (-1785.317) [-1785.313] (-1785.214) (-1788.162) * (-1786.208) (-1785.330) (-1786.108) [-1786.537] -- 0:00:31 Average standard deviation of split frequencies: 0.014013 560500 -- (-1786.164) (-1788.997) (-1785.242) [-1786.429] * (-1784.020) (-1787.732) (-1786.804) [-1784.393] -- 0:00:31 561000 -- (-1785.753) (-1788.048) (-1784.214) [-1785.988] * (-1784.675) (-1791.215) [-1784.715] (-1787.347) -- 0:00:31 561500 -- [-1790.004] (-1791.064) (-1786.736) (-1785.566) * [-1784.541] (-1785.138) (-1789.437) (-1785.156) -- 0:00:31 562000 -- [-1786.891] (-1787.701) (-1785.585) (-1786.739) * (-1784.095) (-1784.735) (-1784.352) [-1784.402] -- 0:00:31 562500 -- (-1785.147) (-1786.973) [-1785.615] (-1787.212) * [-1785.623] (-1783.672) (-1786.861) (-1785.153) -- 0:00:31 563000 -- [-1786.913] (-1785.807) (-1785.818) (-1790.182) * [-1783.680] (-1787.634) (-1785.704) (-1785.632) -- 0:00:31 563500 -- (-1784.861) (-1784.269) [-1784.898] (-1786.729) * [-1783.662] (-1787.795) (-1784.348) (-1786.309) -- 0:00:30 564000 -- [-1784.144] (-1786.465) (-1785.298) (-1784.338) * [-1784.181] (-1784.676) (-1786.186) (-1785.374) -- 0:00:30 564500 -- (-1786.282) (-1785.679) (-1788.480) [-1786.638] * (-1785.201) [-1786.038] (-1787.490) (-1787.475) -- 0:00:30 565000 -- [-1786.655] (-1788.051) (-1786.380) (-1787.770) * (-1783.618) [-1783.795] (-1784.199) (-1784.343) -- 0:00:30 Average standard deviation of split frequencies: 0.013326 565500 -- [-1785.689] (-1789.607) (-1785.209) (-1786.025) * (-1784.740) (-1783.657) [-1785.529] (-1785.768) -- 0:00:31 566000 -- [-1789.018] (-1789.079) (-1787.971) (-1784.587) * (-1785.933) [-1784.709] (-1784.329) (-1785.585) -- 0:00:31 566500 -- (-1785.557) (-1786.872) [-1787.765] (-1783.500) * (-1784.327) (-1784.242) (-1786.215) [-1787.442] -- 0:00:31 567000 -- (-1789.382) (-1788.623) [-1784.993] (-1784.090) * (-1786.688) (-1787.327) (-1784.949) [-1789.470] -- 0:00:31 567500 -- (-1786.895) (-1784.045) (-1787.378) [-1785.552] * (-1783.622) (-1788.853) (-1788.365) [-1784.273] -- 0:00:31 568000 -- (-1787.388) (-1784.030) [-1786.487] (-1786.882) * (-1784.780) (-1786.491) (-1788.568) [-1786.435] -- 0:00:31 568500 -- (-1783.846) (-1784.595) (-1785.044) [-1784.227] * (-1786.594) (-1784.999) (-1787.580) [-1785.111] -- 0:00:31 569000 -- (-1785.254) (-1783.601) (-1785.336) [-1783.708] * [-1785.560] (-1789.659) (-1789.364) (-1787.656) -- 0:00:31 569500 -- (-1790.088) [-1784.139] (-1787.931) (-1786.454) * (-1791.016) (-1786.311) [-1784.657] (-1784.220) -- 0:00:30 570000 -- (-1786.638) [-1787.001] (-1785.264) (-1786.203) * (-1784.508) (-1786.104) (-1784.655) [-1786.607] -- 0:00:30 Average standard deviation of split frequencies: 0.014318 570500 -- (-1787.193) [-1787.061] (-1784.412) (-1786.378) * (-1784.770) [-1789.708] (-1789.311) (-1786.160) -- 0:00:30 571000 -- (-1790.338) [-1785.739] (-1786.664) (-1786.272) * [-1784.182] (-1784.243) (-1785.726) (-1786.279) -- 0:00:30 571500 -- (-1784.434) [-1783.809] (-1787.129) (-1786.961) * (-1784.080) [-1785.343] (-1787.529) (-1787.148) -- 0:00:30 572000 -- (-1786.010) (-1784.786) (-1784.382) [-1787.792] * (-1787.320) [-1784.339] (-1785.958) (-1784.623) -- 0:00:30 572500 -- [-1784.076] (-1784.996) (-1784.591) (-1788.403) * (-1790.547) [-1785.173] (-1784.169) (-1786.247) -- 0:00:30 573000 -- (-1785.143) (-1786.850) [-1786.962] (-1786.562) * (-1784.506) [-1784.551] (-1783.678) (-1786.323) -- 0:00:30 573500 -- (-1786.278) (-1787.088) (-1787.141) [-1785.789] * (-1784.991) (-1786.469) (-1785.477) [-1785.591] -- 0:00:30 574000 -- [-1785.444] (-1784.728) (-1787.876) (-1784.271) * (-1784.420) (-1785.762) (-1785.709) [-1787.922] -- 0:00:30 574500 -- (-1785.685) (-1787.876) (-1788.394) [-1786.379] * (-1788.305) (-1784.068) (-1784.140) [-1784.239] -- 0:00:30 575000 -- (-1787.355) (-1785.600) (-1784.642) [-1787.385] * (-1789.337) (-1784.064) [-1784.177] (-1785.570) -- 0:00:30 Average standard deviation of split frequencies: 0.014731 575500 -- (-1788.288) (-1785.814) [-1786.095] (-1785.832) * [-1784.912] (-1785.083) (-1786.242) (-1784.124) -- 0:00:30 576000 -- [-1784.808] (-1787.265) (-1784.613) (-1784.826) * (-1788.631) [-1784.121] (-1789.181) (-1785.695) -- 0:00:30 576500 -- [-1785.894] (-1787.884) (-1783.970) (-1785.285) * (-1785.377) (-1783.832) (-1784.889) [-1786.749] -- 0:00:30 577000 -- [-1784.031] (-1786.305) (-1785.871) (-1784.556) * (-1787.724) (-1783.609) (-1784.133) [-1783.750] -- 0:00:30 577500 -- [-1785.199] (-1786.292) (-1787.360) (-1785.174) * [-1785.227] (-1784.639) (-1784.825) (-1786.963) -- 0:00:29 578000 -- (-1785.172) (-1786.406) [-1785.369] (-1788.675) * [-1785.145] (-1784.778) (-1786.162) (-1783.931) -- 0:00:29 578500 -- (-1785.382) [-1784.696] (-1792.943) (-1784.725) * (-1784.968) (-1783.859) (-1787.112) [-1783.693] -- 0:00:29 579000 -- (-1785.883) (-1786.617) (-1788.820) [-1784.808] * (-1785.818) (-1787.857) [-1784.667] (-1784.898) -- 0:00:29 579500 -- (-1783.998) (-1786.117) (-1786.540) [-1783.967] * (-1786.139) (-1785.591) (-1785.840) [-1784.035] -- 0:00:29 580000 -- (-1786.820) (-1792.373) [-1787.502] (-1786.611) * (-1789.979) (-1785.756) [-1785.031] (-1789.001) -- 0:00:30 Average standard deviation of split frequencies: 0.014072 580500 -- (-1783.537) (-1786.376) [-1784.541] (-1786.286) * (-1785.245) (-1784.805) [-1785.233] (-1792.292) -- 0:00:30 581000 -- [-1788.633] (-1786.652) (-1784.557) (-1788.459) * [-1785.290] (-1789.452) (-1787.877) (-1785.636) -- 0:00:30 581500 -- (-1784.283) (-1785.505) [-1785.369] (-1789.957) * (-1785.839) [-1786.632] (-1786.099) (-1783.834) -- 0:00:30 582000 -- (-1789.268) (-1785.321) [-1784.173] (-1786.256) * (-1784.148) (-1784.215) (-1784.064) [-1789.034] -- 0:00:30 582500 -- (-1787.807) [-1786.616] (-1784.727) (-1787.814) * (-1783.730) (-1786.546) (-1788.652) [-1784.042] -- 0:00:30 583000 -- (-1785.261) (-1784.952) (-1785.015) [-1785.226] * [-1785.068] (-1785.974) (-1784.435) (-1789.111) -- 0:00:30 583500 -- (-1785.777) [-1783.671] (-1785.753) (-1785.430) * (-1785.020) [-1783.704] (-1787.716) (-1784.199) -- 0:00:29 584000 -- (-1785.503) (-1786.639) (-1784.572) [-1783.992] * (-1787.149) [-1783.462] (-1787.625) (-1787.469) -- 0:00:29 584500 -- [-1787.279] (-1786.971) (-1784.648) (-1787.560) * (-1785.272) [-1787.981] (-1786.996) (-1785.416) -- 0:00:29 585000 -- (-1786.675) (-1786.032) [-1783.693] (-1784.266) * (-1784.191) (-1785.657) [-1785.789] (-1783.867) -- 0:00:29 Average standard deviation of split frequencies: 0.013407 585500 -- (-1788.140) (-1786.467) (-1787.127) [-1785.312] * (-1783.704) [-1783.634] (-1786.288) (-1788.408) -- 0:00:29 586000 -- [-1783.603] (-1788.086) (-1784.528) (-1786.157) * (-1785.973) (-1784.462) (-1785.671) [-1786.459] -- 0:00:29 586500 -- [-1787.310] (-1783.682) (-1788.616) (-1785.518) * (-1783.792) (-1784.479) [-1787.259] (-1791.466) -- 0:00:29 587000 -- (-1788.351) (-1784.072) (-1785.463) [-1785.101] * (-1789.286) (-1789.897) (-1789.810) [-1790.903] -- 0:00:29 587500 -- (-1786.770) (-1785.624) [-1785.666] (-1787.228) * [-1792.017] (-1785.501) (-1786.111) (-1787.975) -- 0:00:29 588000 -- (-1786.187) (-1787.814) (-1784.620) [-1783.706] * (-1785.554) (-1784.237) [-1786.913] (-1785.565) -- 0:00:29 588500 -- (-1785.236) (-1785.593) (-1786.371) [-1786.122] * [-1785.083] (-1785.661) (-1785.806) (-1785.123) -- 0:00:29 589000 -- (-1786.257) (-1787.772) (-1784.919) [-1786.964] * (-1783.800) (-1785.885) (-1785.676) [-1783.549] -- 0:00:29 589500 -- (-1786.505) [-1785.283] (-1785.250) (-1786.802) * (-1784.701) (-1786.508) [-1786.226] (-1786.609) -- 0:00:29 590000 -- [-1786.006] (-1784.699) (-1788.606) (-1786.693) * (-1783.661) (-1783.548) [-1786.029] (-1791.037) -- 0:00:29 Average standard deviation of split frequencies: 0.015430 590500 -- (-1785.510) (-1784.975) (-1784.364) [-1785.473] * (-1783.490) (-1783.988) (-1784.382) [-1787.184] -- 0:00:29 591000 -- (-1786.654) (-1785.155) [-1785.563] (-1789.163) * (-1785.852) (-1789.353) [-1789.583] (-1789.002) -- 0:00:29 591500 -- (-1784.640) (-1786.387) (-1788.023) [-1790.616] * [-1787.265] (-1785.048) (-1785.531) (-1784.920) -- 0:00:29 592000 -- (-1786.537) (-1791.976) [-1787.217] (-1786.747) * (-1784.728) [-1783.673] (-1783.650) (-1785.633) -- 0:00:28 592500 -- (-1788.332) (-1785.868) [-1785.676] (-1784.485) * [-1787.685] (-1783.573) (-1784.938) (-1787.851) -- 0:00:28 593000 -- (-1785.689) (-1787.815) (-1784.787) [-1783.781] * (-1786.950) [-1784.140] (-1785.973) (-1784.889) -- 0:00:28 593500 -- [-1785.515] (-1789.609) (-1784.911) (-1784.923) * (-1787.393) [-1785.008] (-1787.347) (-1784.755) -- 0:00:28 594000 -- (-1788.008) (-1788.144) (-1784.912) [-1785.332] * (-1786.320) (-1785.418) [-1784.500] (-1785.332) -- 0:00:28 594500 -- (-1788.286) (-1784.887) [-1786.260] (-1786.040) * [-1789.872] (-1785.522) (-1787.249) (-1791.150) -- 0:00:29 595000 -- (-1793.472) (-1783.898) [-1784.408] (-1794.671) * (-1786.851) (-1787.085) (-1787.150) [-1787.193] -- 0:00:29 Average standard deviation of split frequencies: 0.015292 595500 -- (-1784.460) (-1786.952) (-1784.778) [-1787.108] * (-1784.668) (-1784.158) [-1787.188] (-1784.485) -- 0:00:29 596000 -- (-1785.891) (-1788.519) [-1784.711] (-1786.107) * (-1783.727) (-1786.607) (-1787.487) [-1786.786] -- 0:00:29 596500 -- (-1787.381) (-1787.806) (-1788.116) [-1785.818] * (-1785.017) (-1789.144) (-1785.609) [-1785.617] -- 0:00:29 597000 -- (-1784.206) (-1785.922) [-1788.763] (-1788.832) * [-1785.421] (-1784.175) (-1785.122) (-1785.663) -- 0:00:29 597500 -- (-1784.635) [-1784.920] (-1785.452) (-1792.533) * (-1785.231) (-1786.178) (-1783.764) [-1786.030] -- 0:00:28 598000 -- (-1785.907) (-1785.596) [-1784.243] (-1785.462) * [-1785.186] (-1784.320) (-1786.424) (-1785.220) -- 0:00:28 598500 -- (-1790.697) [-1788.039] (-1784.502) (-1784.317) * (-1785.646) (-1787.349) (-1786.134) [-1786.579] -- 0:00:28 599000 -- (-1785.853) (-1783.972) [-1785.140] (-1784.800) * (-1786.045) [-1784.041] (-1786.668) (-1786.562) -- 0:00:28 599500 -- (-1786.454) [-1785.405] (-1785.240) (-1785.705) * (-1787.210) [-1785.355] (-1788.982) (-1787.534) -- 0:00:28 600000 -- [-1785.310] (-1784.959) (-1786.686) (-1786.842) * (-1785.738) (-1785.253) (-1788.797) [-1786.930] -- 0:00:28 Average standard deviation of split frequencies: 0.013603 600500 -- (-1787.552) [-1788.675] (-1787.170) (-1785.913) * (-1784.307) (-1785.761) (-1783.658) [-1786.371] -- 0:00:28 601000 -- (-1786.726) (-1789.228) (-1787.486) [-1784.685] * (-1784.467) (-1785.393) (-1783.429) [-1786.697] -- 0:00:28 601500 -- (-1792.709) (-1785.288) (-1784.271) [-1787.783] * (-1787.593) (-1784.212) [-1787.094] (-1784.181) -- 0:00:28 602000 -- (-1789.101) [-1788.610] (-1783.817) (-1787.467) * (-1783.825) [-1783.933] (-1784.422) (-1788.637) -- 0:00:28 602500 -- (-1787.454) (-1789.130) [-1784.742] (-1785.142) * (-1787.561) [-1783.780] (-1784.602) (-1790.313) -- 0:00:28 603000 -- (-1784.613) (-1787.805) [-1786.347] (-1789.207) * [-1785.855] (-1787.030) (-1784.492) (-1791.134) -- 0:00:28 603500 -- (-1787.810) (-1785.131) (-1785.077) [-1783.507] * (-1786.035) (-1785.908) (-1784.928) [-1783.965] -- 0:00:28 604000 -- (-1786.969) [-1784.383] (-1787.132) (-1784.435) * (-1783.588) (-1785.311) (-1785.177) [-1786.787] -- 0:00:28 604500 -- (-1783.635) (-1786.471) [-1784.168] (-1787.357) * (-1783.846) (-1787.654) (-1785.421) [-1784.348] -- 0:00:28 605000 -- (-1783.562) (-1787.783) (-1783.882) [-1787.206] * (-1785.066) (-1788.311) (-1785.220) [-1785.093] -- 0:00:28 Average standard deviation of split frequencies: 0.013484 605500 -- (-1788.348) (-1784.304) [-1788.918] (-1785.169) * (-1784.401) (-1791.719) [-1785.738] (-1784.457) -- 0:00:28 606000 -- [-1786.918] (-1784.203) (-1786.952) (-1785.337) * [-1784.515] (-1786.730) (-1787.253) (-1785.122) -- 0:00:27 606500 -- (-1786.005) (-1788.124) [-1786.941] (-1785.262) * (-1785.726) [-1787.838] (-1790.585) (-1786.413) -- 0:00:27 607000 -- [-1785.944] (-1784.730) (-1786.158) (-1785.750) * [-1784.365] (-1785.670) (-1789.595) (-1784.667) -- 0:00:27 607500 -- (-1785.726) (-1784.397) (-1785.427) [-1785.706] * (-1789.148) (-1785.812) (-1784.614) [-1783.781] -- 0:00:27 608000 -- (-1787.287) (-1787.110) [-1788.826] (-1788.424) * (-1784.452) (-1786.778) [-1789.581] (-1785.341) -- 0:00:27 608500 -- (-1786.948) [-1786.093] (-1784.980) (-1785.141) * (-1786.624) [-1784.502] (-1786.660) (-1785.937) -- 0:00:28 609000 -- (-1783.913) [-1785.728] (-1784.932) (-1785.096) * (-1784.374) [-1787.094] (-1787.206) (-1791.870) -- 0:00:28 609500 -- [-1786.098] (-1786.131) (-1786.295) (-1786.065) * [-1785.983] (-1785.306) (-1785.368) (-1788.512) -- 0:00:28 610000 -- (-1788.137) (-1785.452) (-1784.951) [-1787.213] * (-1785.067) (-1783.981) (-1785.029) [-1786.352] -- 0:00:28 Average standard deviation of split frequencies: 0.014410 610500 -- [-1786.670] (-1783.537) (-1787.524) (-1789.103) * (-1785.460) (-1786.797) (-1784.643) [-1785.535] -- 0:00:28 611000 -- (-1786.183) (-1786.804) [-1783.836] (-1784.900) * (-1783.905) (-1785.963) (-1784.528) [-1784.744] -- 0:00:28 611500 -- (-1785.264) (-1787.321) [-1785.154] (-1784.880) * [-1790.462] (-1784.422) (-1787.305) (-1786.913) -- 0:00:27 612000 -- [-1785.989] (-1784.920) (-1787.245) (-1788.426) * [-1785.899] (-1785.559) (-1783.755) (-1784.208) -- 0:00:27 612500 -- (-1786.985) (-1787.828) (-1786.034) [-1785.509] * (-1784.713) [-1787.036] (-1784.112) (-1786.139) -- 0:00:27 613000 -- (-1791.126) [-1785.969] (-1786.254) (-1785.070) * (-1788.263) (-1784.365) (-1786.025) [-1785.301] -- 0:00:27 613500 -- (-1785.168) (-1788.820) (-1785.576) [-1787.075] * (-1786.501) [-1785.354] (-1785.830) (-1783.983) -- 0:00:27 614000 -- (-1785.305) (-1788.092) (-1783.974) [-1785.035] * (-1789.489) (-1790.318) (-1785.230) [-1786.156] -- 0:00:27 614500 -- (-1787.245) [-1787.274] (-1785.314) (-1784.974) * [-1785.337] (-1786.374) (-1786.825) (-1783.954) -- 0:00:27 615000 -- [-1784.932] (-1788.077) (-1792.299) (-1785.025) * (-1786.788) (-1784.511) (-1787.093) [-1788.969] -- 0:00:27 Average standard deviation of split frequencies: 0.014795 615500 -- (-1786.080) (-1786.237) [-1788.099] (-1792.004) * (-1783.506) (-1786.502) (-1786.487) [-1785.603] -- 0:00:27 616000 -- [-1785.461] (-1785.537) (-1788.906) (-1788.525) * (-1785.613) (-1787.495) [-1785.651] (-1786.389) -- 0:00:27 616500 -- (-1787.185) (-1785.472) (-1787.929) [-1784.087] * (-1785.498) [-1784.478] (-1785.003) (-1785.354) -- 0:00:27 617000 -- (-1785.666) (-1789.804) (-1788.805) [-1785.433] * (-1783.960) [-1786.689] (-1784.538) (-1783.783) -- 0:00:27 617500 -- (-1786.717) (-1788.203) (-1783.795) [-1784.065] * (-1784.228) (-1787.500) (-1789.081) [-1783.486] -- 0:00:27 618000 -- (-1785.438) (-1783.531) [-1784.352] (-1785.097) * [-1785.080] (-1784.893) (-1784.340) (-1786.316) -- 0:00:27 618500 -- (-1786.238) (-1785.496) [-1788.162] (-1784.485) * (-1785.706) (-1786.449) [-1786.335] (-1787.059) -- 0:00:27 619000 -- [-1784.959] (-1784.444) (-1788.508) (-1784.482) * (-1788.190) (-1787.000) (-1787.267) [-1790.015] -- 0:00:27 619500 -- (-1786.950) (-1784.663) (-1786.576) [-1787.897] * (-1788.492) (-1790.290) (-1793.648) [-1785.315] -- 0:00:27 620000 -- (-1784.869) (-1785.179) (-1786.828) [-1788.029] * (-1785.375) [-1784.971] (-1786.488) (-1786.266) -- 0:00:26 Average standard deviation of split frequencies: 0.011140 620500 -- [-1785.122] (-1784.739) (-1785.793) (-1786.994) * (-1784.047) (-1784.940) (-1786.350) [-1784.376] -- 0:00:26 621000 -- (-1785.861) (-1787.705) (-1784.557) [-1789.593] * (-1784.894) (-1785.479) (-1786.494) [-1785.735] -- 0:00:26 621500 -- (-1787.558) (-1785.269) (-1784.131) [-1783.776] * [-1785.696] (-1784.675) (-1787.712) (-1785.520) -- 0:00:26 622000 -- (-1784.988) [-1784.341] (-1785.707) (-1788.580) * (-1783.906) [-1783.923] (-1790.342) (-1784.535) -- 0:00:26 622500 -- (-1786.666) (-1784.281) [-1784.330] (-1784.558) * (-1783.976) (-1788.427) (-1788.189) [-1784.973] -- 0:00:26 623000 -- (-1784.099) (-1785.576) [-1784.313] (-1784.749) * [-1783.492] (-1784.849) (-1785.257) (-1784.246) -- 0:00:27 623500 -- (-1786.892) (-1786.441) [-1791.615] (-1786.375) * (-1785.684) (-1784.515) (-1784.370) [-1785.269] -- 0:00:27 624000 -- [-1785.940] (-1785.920) (-1789.540) (-1783.988) * [-1788.307] (-1786.261) (-1785.361) (-1787.193) -- 0:00:27 624500 -- (-1785.356) [-1783.900] (-1784.152) (-1784.133) * (-1785.435) [-1785.690] (-1784.948) (-1791.324) -- 0:00:27 625000 -- (-1785.981) (-1785.242) [-1784.187] (-1784.319) * (-1786.774) (-1785.271) [-1784.595] (-1784.763) -- 0:00:27 Average standard deviation of split frequencies: 0.011045 625500 -- (-1787.694) [-1783.969] (-1783.905) (-1784.912) * [-1784.954] (-1784.802) (-1786.824) (-1784.165) -- 0:00:26 626000 -- (-1784.381) (-1786.136) [-1785.368] (-1785.618) * (-1784.804) [-1785.875] (-1785.354) (-1788.024) -- 0:00:26 626500 -- (-1785.130) (-1783.977) [-1786.629] (-1785.140) * (-1788.291) (-1786.453) (-1784.831) [-1789.721] -- 0:00:26 627000 -- (-1785.779) (-1785.658) [-1786.725] (-1788.925) * (-1785.376) (-1786.002) (-1785.711) [-1786.907] -- 0:00:26 627500 -- [-1788.157] (-1787.526) (-1786.565) (-1787.608) * (-1784.877) (-1788.386) [-1786.335] (-1785.210) -- 0:00:26 628000 -- (-1786.872) (-1785.658) (-1788.537) [-1785.347] * (-1786.887) [-1785.899] (-1785.750) (-1785.806) -- 0:00:26 628500 -- (-1787.517) (-1785.432) [-1785.216] (-1784.334) * (-1784.926) [-1785.165] (-1783.694) (-1785.824) -- 0:00:26 629000 -- (-1784.275) (-1787.223) [-1785.036] (-1787.985) * (-1785.324) (-1785.779) [-1784.476] (-1787.202) -- 0:00:26 629500 -- (-1786.686) (-1783.408) [-1786.503] (-1785.038) * (-1784.992) (-1787.251) (-1789.350) [-1784.670] -- 0:00:26 630000 -- (-1785.166) (-1784.367) (-1787.332) [-1785.688] * (-1784.903) (-1786.067) (-1796.252) [-1784.983] -- 0:00:26 Average standard deviation of split frequencies: 0.012458 630500 -- (-1787.577) (-1784.361) [-1785.247] (-1785.107) * [-1785.079] (-1785.505) (-1787.098) (-1786.868) -- 0:00:26 631000 -- (-1784.468) [-1785.543] (-1785.707) (-1785.264) * (-1788.362) [-1786.779] (-1786.216) (-1785.353) -- 0:00:26 631500 -- (-1784.287) [-1784.834] (-1786.938) (-1785.772) * [-1786.037] (-1789.247) (-1787.079) (-1785.524) -- 0:00:26 632000 -- (-1784.331) [-1784.347] (-1783.896) (-1785.534) * (-1785.935) [-1784.732] (-1785.618) (-1789.618) -- 0:00:26 632500 -- [-1784.200] (-1783.695) (-1785.050) (-1786.197) * [-1784.029] (-1785.709) (-1785.073) (-1787.974) -- 0:00:26 633000 -- (-1784.458) [-1787.686] (-1784.476) (-1786.908) * (-1785.419) [-1784.477] (-1786.001) (-1785.022) -- 0:00:26 633500 -- (-1787.176) (-1786.697) (-1784.908) [-1788.460] * (-1783.977) (-1786.653) (-1785.069) [-1788.029] -- 0:00:26 634000 -- [-1787.262] (-1787.581) (-1787.399) (-1787.879) * (-1786.303) [-1785.048] (-1783.955) (-1784.162) -- 0:00:25 634500 -- (-1785.306) [-1784.852] (-1788.817) (-1785.719) * [-1787.954] (-1787.486) (-1783.880) (-1784.704) -- 0:00:25 635000 -- (-1784.127) [-1786.025] (-1786.678) (-1788.189) * [-1787.690] (-1785.150) (-1785.780) (-1786.501) -- 0:00:25 Average standard deviation of split frequencies: 0.011365 635500 -- (-1786.363) [-1785.433] (-1783.958) (-1790.864) * (-1784.698) (-1788.228) (-1784.905) [-1785.986] -- 0:00:25 636000 -- (-1786.591) (-1786.379) [-1784.050] (-1784.641) * [-1787.102] (-1786.467) (-1785.744) (-1787.984) -- 0:00:25 636500 -- (-1784.259) [-1784.354] (-1785.898) (-1784.536) * (-1786.420) (-1788.286) (-1787.925) [-1785.200] -- 0:00:25 637000 -- (-1788.923) (-1784.980) [-1784.893] (-1786.481) * (-1784.472) (-1786.797) [-1784.957] (-1787.012) -- 0:00:25 637500 -- (-1786.980) [-1785.039] (-1784.595) (-1784.865) * [-1784.183] (-1788.772) (-1784.467) (-1787.727) -- 0:00:26 638000 -- (-1786.060) (-1787.567) (-1788.565) [-1785.174] * (-1786.053) [-1788.376] (-1787.836) (-1787.202) -- 0:00:26 638500 -- (-1787.526) (-1787.682) [-1787.575] (-1787.252) * (-1787.893) (-1784.911) (-1784.366) [-1785.928] -- 0:00:26 639000 -- (-1785.306) (-1786.303) [-1788.741] (-1787.352) * (-1785.954) [-1789.082] (-1785.071) (-1785.872) -- 0:00:25 639500 -- (-1786.036) (-1783.773) [-1784.894] (-1784.841) * (-1785.378) (-1788.577) [-1785.104] (-1785.567) -- 0:00:25 640000 -- (-1784.186) (-1790.688) [-1783.893] (-1786.176) * [-1785.703] (-1787.057) (-1788.118) (-1785.830) -- 0:00:25 Average standard deviation of split frequencies: 0.010792 640500 -- (-1786.936) [-1785.736] (-1786.444) (-1785.381) * (-1785.236) (-1784.865) [-1784.928] (-1785.129) -- 0:00:25 641000 -- (-1790.852) (-1786.916) [-1786.212] (-1785.515) * [-1788.787] (-1785.604) (-1785.099) (-1786.666) -- 0:00:25 641500 -- (-1785.089) (-1789.929) [-1783.738] (-1786.708) * (-1785.774) [-1785.208] (-1784.901) (-1783.682) -- 0:00:25 642000 -- (-1790.084) (-1784.498) [-1784.446] (-1785.742) * [-1785.256] (-1785.308) (-1786.251) (-1784.518) -- 0:00:25 642500 -- (-1785.535) (-1784.802) (-1784.237) [-1785.290] * [-1784.191] (-1785.904) (-1785.229) (-1785.064) -- 0:00:25 643000 -- (-1787.110) (-1783.566) (-1788.590) [-1784.545] * [-1783.920] (-1785.472) (-1785.282) (-1783.678) -- 0:00:25 643500 -- [-1785.435] (-1786.753) (-1786.903) (-1788.610) * (-1786.868) [-1785.797] (-1785.236) (-1785.211) -- 0:00:25 644000 -- (-1784.373) [-1784.925] (-1788.621) (-1790.974) * (-1785.846) (-1790.759) (-1785.144) [-1785.045] -- 0:00:25 644500 -- (-1788.715) (-1784.308) [-1784.910] (-1786.087) * (-1784.880) (-1784.947) (-1784.420) [-1785.697] -- 0:00:25 645000 -- (-1786.653) (-1785.538) [-1785.268] (-1787.186) * (-1783.834) [-1783.656] (-1787.531) (-1785.988) -- 0:00:25 Average standard deviation of split frequencies: 0.011189 645500 -- (-1785.155) (-1784.135) (-1787.030) [-1784.300] * (-1786.436) (-1783.539) [-1786.385] (-1785.020) -- 0:00:25 646000 -- (-1787.769) (-1787.879) (-1789.557) [-1784.873] * (-1784.893) [-1784.772] (-1788.293) (-1787.364) -- 0:00:25 646500 -- (-1784.697) [-1786.689] (-1785.811) (-1784.589) * (-1783.657) (-1788.610) (-1790.208) [-1786.560] -- 0:00:25 647000 -- (-1784.587) [-1784.652] (-1784.319) (-1788.664) * (-1784.030) (-1792.704) [-1783.681] (-1793.388) -- 0:00:25 647500 -- (-1784.791) [-1784.043] (-1787.751) (-1790.806) * (-1785.751) (-1787.921) (-1785.040) [-1787.510] -- 0:00:25 648000 -- (-1785.410) (-1783.639) (-1787.133) [-1786.374] * (-1788.227) (-1784.838) [-1785.140] (-1784.799) -- 0:00:24 648500 -- (-1790.888) (-1784.492) [-1783.772] (-1784.024) * (-1787.162) (-1788.687) (-1784.238) [-1788.018] -- 0:00:24 649000 -- (-1787.144) (-1788.403) (-1789.359) [-1783.634] * (-1789.267) (-1784.106) (-1786.172) [-1784.260] -- 0:00:24 649500 -- (-1789.805) (-1783.502) [-1783.696] (-1788.193) * (-1786.279) [-1785.313] (-1787.400) (-1787.773) -- 0:00:24 650000 -- [-1788.820] (-1786.907) (-1783.735) (-1787.494) * (-1789.450) [-1785.082] (-1783.744) (-1784.714) -- 0:00:24 Average standard deviation of split frequencies: 0.008694 650500 -- [-1784.667] (-1789.042) (-1785.910) (-1785.745) * [-1783.663] (-1784.938) (-1783.657) (-1786.519) -- 0:00:25 651000 -- [-1785.549] (-1785.930) (-1784.643) (-1784.347) * (-1785.144) (-1786.048) (-1785.277) [-1788.665] -- 0:00:25 651500 -- (-1784.558) (-1785.377) [-1785.300] (-1783.760) * (-1785.182) (-1784.843) [-1790.239] (-1789.471) -- 0:00:25 652000 -- (-1785.875) [-1786.513] (-1787.122) (-1784.426) * (-1785.128) (-1784.947) [-1786.442] (-1787.162) -- 0:00:25 652500 -- [-1786.265] (-1788.955) (-1789.567) (-1784.770) * [-1786.251] (-1790.887) (-1784.716) (-1789.018) -- 0:00:25 653000 -- [-1789.320] (-1786.128) (-1787.643) (-1783.700) * (-1783.880) [-1787.989] (-1788.374) (-1785.776) -- 0:00:24 653500 -- [-1784.707] (-1783.346) (-1788.032) (-1783.930) * [-1784.070] (-1796.536) (-1785.245) (-1785.200) -- 0:00:24 654000 -- (-1789.187) (-1787.013) (-1788.261) [-1786.376] * (-1786.832) (-1791.704) (-1785.821) [-1784.278] -- 0:00:24 654500 -- (-1783.791) [-1785.088] (-1786.431) (-1786.691) * [-1785.168] (-1786.492) (-1784.373) (-1788.063) -- 0:00:24 655000 -- (-1784.660) (-1787.055) [-1786.398] (-1786.002) * (-1784.265) (-1784.986) [-1783.485] (-1787.879) -- 0:00:24 Average standard deviation of split frequencies: 0.008144 655500 -- (-1786.819) [-1789.099] (-1786.406) (-1785.790) * (-1786.998) (-1783.425) (-1787.128) [-1785.466] -- 0:00:24 656000 -- (-1784.289) (-1789.714) (-1785.876) [-1787.709] * (-1784.447) (-1785.686) (-1785.707) [-1783.943] -- 0:00:24 656500 -- (-1784.172) (-1784.457) (-1785.834) [-1787.895] * (-1785.289) (-1791.028) (-1785.764) [-1784.519] -- 0:00:24 657000 -- (-1788.843) (-1786.014) [-1785.366] (-1788.931) * [-1783.834] (-1785.961) (-1788.092) (-1784.186) -- 0:00:24 657500 -- (-1790.222) (-1783.732) [-1786.453] (-1787.064) * [-1784.522] (-1787.947) (-1787.418) (-1786.515) -- 0:00:24 658000 -- (-1788.511) (-1787.110) (-1789.533) [-1785.338] * (-1787.922) (-1785.587) (-1786.113) [-1790.280] -- 0:00:24 658500 -- (-1789.125) (-1786.226) [-1784.043] (-1785.039) * (-1784.162) [-1784.158] (-1788.461) (-1785.689) -- 0:00:24 659000 -- (-1787.605) (-1785.308) (-1786.265) [-1786.724] * (-1787.738) (-1783.912) (-1784.899) [-1786.546] -- 0:00:24 659500 -- [-1785.888] (-1783.727) (-1783.615) (-1786.294) * [-1785.539] (-1783.698) (-1788.443) (-1784.115) -- 0:00:24 660000 -- (-1784.339) (-1784.774) (-1789.971) [-1786.769] * (-1784.294) (-1784.282) [-1784.846] (-1786.349) -- 0:00:24 Average standard deviation of split frequencies: 0.009038 660500 -- (-1785.062) (-1785.027) (-1790.535) [-1785.965] * (-1788.690) (-1784.297) (-1786.547) [-1784.086] -- 0:00:24 661000 -- (-1794.247) (-1784.646) (-1783.439) [-1786.476] * (-1787.703) (-1787.806) [-1785.780] (-1785.742) -- 0:00:24 661500 -- (-1787.310) (-1784.908) [-1785.479] (-1788.123) * (-1786.647) (-1787.868) (-1785.008) [-1785.004] -- 0:00:24 662000 -- (-1788.264) (-1785.326) [-1788.392] (-1785.926) * (-1792.954) [-1784.425] (-1785.409) (-1786.566) -- 0:00:23 662500 -- (-1784.288) (-1786.960) [-1787.800] (-1785.170) * (-1785.375) [-1784.039] (-1785.587) (-1785.143) -- 0:00:24 663000 -- (-1784.454) (-1796.889) [-1787.418] (-1785.853) * (-1786.849) (-1785.186) [-1787.261] (-1784.557) -- 0:00:24 663500 -- [-1783.479] (-1787.026) (-1783.781) (-1784.295) * [-1786.901] (-1784.473) (-1789.359) (-1784.903) -- 0:00:24 664000 -- (-1785.857) (-1784.838) (-1784.294) [-1789.660] * (-1788.783) [-1784.871] (-1785.172) (-1786.296) -- 0:00:24 664500 -- [-1785.504] (-1785.394) (-1787.707) (-1788.905) * [-1790.534] (-1785.583) (-1786.760) (-1784.032) -- 0:00:24 665000 -- [-1786.022] (-1787.701) (-1786.405) (-1785.685) * (-1791.506) (-1786.674) [-1787.976] (-1784.622) -- 0:00:24 Average standard deviation of split frequencies: 0.009438 665500 -- (-1786.006) (-1792.666) (-1785.538) [-1784.234] * [-1787.038] (-1784.316) (-1787.677) (-1785.143) -- 0:00:24 666000 -- (-1786.486) (-1788.660) [-1784.653] (-1784.182) * (-1788.131) (-1787.333) [-1786.507] (-1791.077) -- 0:00:24 666500 -- (-1789.244) (-1785.323) [-1785.828] (-1784.497) * (-1783.905) [-1785.401] (-1784.524) (-1787.633) -- 0:00:24 667000 -- (-1788.605) (-1787.505) [-1786.584] (-1784.011) * (-1786.035) (-1785.564) (-1786.780) [-1787.699] -- 0:00:23 667500 -- (-1786.106) (-1792.697) (-1785.202) [-1786.702] * (-1783.481) (-1786.599) [-1787.062] (-1786.223) -- 0:00:23 668000 -- (-1784.480) [-1784.863] (-1789.361) (-1785.009) * (-1783.694) (-1784.814) (-1786.353) [-1785.069] -- 0:00:23 668500 -- (-1785.241) (-1786.223) (-1785.786) [-1784.633] * (-1784.885) (-1786.782) (-1787.175) [-1784.843] -- 0:00:23 669000 -- [-1788.266] (-1784.122) (-1789.997) (-1783.839) * (-1785.496) (-1788.086) [-1784.768] (-1783.902) -- 0:00:23 669500 -- (-1786.035) [-1786.457] (-1787.294) (-1786.369) * [-1786.253] (-1784.849) (-1789.425) (-1786.738) -- 0:00:23 670000 -- (-1785.496) [-1785.999] (-1787.677) (-1790.558) * (-1784.590) (-1787.319) (-1787.197) [-1784.739] -- 0:00:23 Average standard deviation of split frequencies: 0.007966 670500 -- [-1785.783] (-1787.983) (-1786.460) (-1785.935) * [-1783.648] (-1784.869) (-1786.036) (-1784.877) -- 0:00:23 671000 -- (-1786.112) (-1789.627) (-1788.126) [-1784.588] * (-1785.567) (-1784.999) [-1784.412] (-1785.101) -- 0:00:23 671500 -- (-1785.231) (-1786.224) (-1791.549) [-1787.658] * (-1783.945) [-1784.226] (-1785.497) (-1785.358) -- 0:00:23 672000 -- [-1784.629] (-1786.288) (-1785.885) (-1785.943) * (-1785.281) [-1784.401] (-1786.452) (-1785.412) -- 0:00:23 672500 -- (-1785.279) [-1785.312] (-1786.220) (-1787.485) * (-1789.209) (-1784.960) (-1786.112) [-1786.016] -- 0:00:23 673000 -- (-1784.746) (-1788.769) (-1783.927) [-1783.887] * (-1784.355) [-1786.127] (-1785.883) (-1785.401) -- 0:00:23 673500 -- (-1787.568) (-1787.671) [-1785.759] (-1783.820) * [-1786.914] (-1789.387) (-1786.091) (-1784.810) -- 0:00:23 674000 -- (-1787.171) (-1789.677) (-1784.370) [-1784.059] * (-1787.364) (-1784.350) (-1786.009) [-1784.152] -- 0:00:23 674500 -- (-1785.879) [-1791.839] (-1785.185) (-1785.246) * [-1785.894] (-1789.282) (-1785.438) (-1785.222) -- 0:00:23 675000 -- (-1785.819) (-1788.516) (-1785.848) [-1784.655] * [-1784.952] (-1787.043) (-1787.304) (-1784.012) -- 0:00:23 Average standard deviation of split frequencies: 0.009298 675500 -- (-1784.199) (-1785.884) (-1784.116) [-1784.655] * (-1788.463) (-1783.911) (-1785.559) [-1784.565] -- 0:00:23 676000 -- (-1786.230) (-1784.790) [-1785.894] (-1786.990) * (-1789.001) (-1784.457) (-1784.908) [-1784.158] -- 0:00:23 676500 -- (-1793.038) (-1784.991) [-1785.811] (-1785.176) * [-1787.833] (-1787.826) (-1783.832) (-1787.442) -- 0:00:23 677000 -- (-1795.224) [-1784.512] (-1785.730) (-1784.832) * [-1784.758] (-1784.770) (-1783.645) (-1787.161) -- 0:00:23 677500 -- (-1785.384) [-1785.670] (-1786.264) (-1784.181) * [-1786.558] (-1784.312) (-1786.044) (-1789.646) -- 0:00:23 678000 -- [-1784.627] (-1786.346) (-1787.284) (-1785.508) * (-1785.670) [-1786.241] (-1785.075) (-1784.588) -- 0:00:23 678500 -- (-1785.953) (-1783.937) (-1787.208) [-1789.065] * (-1788.980) (-1786.807) [-1784.531] (-1783.488) -- 0:00:23 679000 -- (-1786.326) (-1784.804) (-1788.749) [-1787.876] * (-1784.527) (-1783.761) [-1786.484] (-1785.601) -- 0:00:23 679500 -- (-1786.799) (-1785.610) [-1784.128] (-1788.167) * (-1786.298) (-1784.318) [-1785.887] (-1786.799) -- 0:00:23 680000 -- (-1784.787) (-1790.517) (-1784.452) [-1785.131] * (-1785.074) (-1790.608) [-1786.486] (-1786.611) -- 0:00:23 Average standard deviation of split frequencies: 0.008772 680500 -- (-1785.648) [-1786.988] (-1786.725) (-1789.891) * (-1785.068) (-1783.857) (-1787.381) [-1785.137] -- 0:00:23 681000 -- (-1785.538) [-1784.480] (-1786.801) (-1787.771) * (-1783.566) (-1783.773) [-1786.577] (-1787.367) -- 0:00:22 681500 -- (-1785.392) (-1785.066) [-1785.535] (-1787.441) * (-1785.047) [-1786.730] (-1796.044) (-1785.002) -- 0:00:22 682000 -- (-1787.005) (-1783.854) [-1785.026] (-1787.371) * [-1784.385] (-1789.315) (-1788.760) (-1787.131) -- 0:00:22 682500 -- (-1785.180) (-1785.539) (-1783.714) [-1786.548] * (-1789.615) [-1784.333] (-1784.769) (-1784.141) -- 0:00:22 683000 -- (-1783.843) [-1783.591] (-1784.101) (-1784.389) * [-1787.577] (-1785.290) (-1783.710) (-1785.887) -- 0:00:22 683500 -- (-1785.613) [-1785.112] (-1784.823) (-1786.067) * [-1785.059] (-1785.693) (-1784.553) (-1783.954) -- 0:00:22 684000 -- (-1784.850) [-1785.490] (-1786.490) (-1785.000) * (-1787.480) [-1785.899] (-1784.957) (-1788.214) -- 0:00:22 684500 -- (-1786.566) [-1784.179] (-1791.206) (-1792.837) * (-1786.286) [-1784.171] (-1791.118) (-1783.977) -- 0:00:22 685000 -- (-1787.706) (-1784.808) [-1784.294] (-1788.618) * [-1786.718] (-1786.353) (-1790.740) (-1783.720) -- 0:00:22 Average standard deviation of split frequencies: 0.006872 685500 -- (-1786.179) (-1788.607) [-1786.258] (-1786.792) * (-1784.866) [-1784.926] (-1788.244) (-1785.130) -- 0:00:22 686000 -- [-1788.874] (-1790.458) (-1786.572) (-1785.972) * (-1784.571) [-1784.235] (-1785.895) (-1785.792) -- 0:00:22 686500 -- [-1786.061] (-1785.629) (-1784.759) (-1787.132) * (-1786.340) [-1788.211] (-1789.568) (-1784.854) -- 0:00:22 687000 -- (-1790.795) (-1784.582) (-1786.437) [-1784.328] * [-1788.654] (-1785.205) (-1785.767) (-1785.738) -- 0:00:22 687500 -- (-1786.555) [-1784.919] (-1785.988) (-1784.958) * (-1785.781) (-1790.411) (-1786.171) [-1784.925] -- 0:00:22 688000 -- (-1783.592) [-1784.479] (-1785.531) (-1787.982) * (-1784.143) (-1788.919) (-1784.507) [-1786.565] -- 0:00:22 688500 -- (-1783.904) (-1785.657) [-1783.855] (-1785.598) * (-1784.573) (-1787.163) (-1784.024) [-1786.535] -- 0:00:22 689000 -- [-1786.326] (-1783.943) (-1783.876) (-1785.880) * [-1783.567] (-1784.395) (-1784.931) (-1784.103) -- 0:00:22 689500 -- [-1785.925] (-1784.679) (-1784.147) (-1786.192) * (-1785.764) [-1785.449] (-1789.441) (-1783.623) -- 0:00:22 690000 -- (-1786.074) [-1787.906] (-1785.063) (-1784.826) * [-1783.487] (-1785.456) (-1786.908) (-1786.375) -- 0:00:22 Average standard deviation of split frequencies: 0.007280 690500 -- (-1785.407) [-1788.843] (-1785.698) (-1786.051) * [-1786.933] (-1786.729) (-1785.069) (-1784.559) -- 0:00:22 691000 -- [-1786.795] (-1785.082) (-1792.191) (-1785.413) * (-1787.581) (-1790.778) (-1785.332) [-1784.275] -- 0:00:22 691500 -- (-1783.654) (-1787.908) (-1785.104) [-1785.165] * (-1784.821) (-1785.987) [-1786.180] (-1784.805) -- 0:00:22 692000 -- [-1784.781] (-1785.229) (-1785.663) (-1788.764) * (-1791.209) [-1788.799] (-1786.092) (-1787.124) -- 0:00:22 692500 -- (-1785.988) (-1785.584) (-1786.705) [-1785.504] * [-1784.749] (-1784.907) (-1784.580) (-1785.931) -- 0:00:22 693000 -- [-1784.788] (-1784.358) (-1787.615) (-1783.876) * (-1784.144) (-1790.916) (-1786.525) [-1784.755] -- 0:00:22 693500 -- (-1787.820) (-1786.919) [-1788.223] (-1783.359) * (-1785.562) (-1788.308) [-1785.498] (-1786.284) -- 0:00:22 694000 -- (-1789.730) [-1784.564] (-1788.697) (-1784.354) * (-1784.768) (-1784.125) [-1784.339] (-1786.341) -- 0:00:22 694500 -- (-1787.499) (-1786.802) [-1785.256] (-1785.732) * [-1784.121] (-1784.358) (-1785.229) (-1785.174) -- 0:00:21 695000 -- (-1788.535) (-1788.054) (-1784.303) [-1784.543] * (-1785.792) (-1784.610) (-1784.144) [-1784.811] -- 0:00:21 Average standard deviation of split frequencies: 0.008128 695500 -- (-1783.991) (-1786.408) (-1785.297) [-1784.864] * (-1785.407) (-1784.334) (-1785.815) [-1783.917] -- 0:00:21 696000 -- (-1787.304) [-1783.711] (-1786.981) (-1785.127) * (-1789.194) (-1784.058) [-1784.678] (-1783.940) -- 0:00:21 696500 -- (-1785.335) (-1784.235) (-1788.710) [-1785.441] * (-1785.690) (-1784.440) [-1784.995] (-1785.768) -- 0:00:21 697000 -- (-1784.397) [-1787.888] (-1785.247) (-1788.329) * (-1784.913) (-1785.710) [-1784.542] (-1786.209) -- 0:00:21 697500 -- [-1786.140] (-1784.567) (-1783.556) (-1784.079) * [-1785.243] (-1785.879) (-1787.327) (-1787.254) -- 0:00:21 698000 -- (-1785.131) (-1786.524) [-1784.568] (-1786.647) * (-1785.490) [-1784.149] (-1786.653) (-1789.735) -- 0:00:21 698500 -- (-1784.252) [-1786.428] (-1788.794) (-1784.629) * (-1784.993) [-1785.008] (-1783.577) (-1785.578) -- 0:00:21 699000 -- (-1784.880) (-1784.477) [-1785.929] (-1787.572) * (-1784.043) [-1785.923] (-1785.803) (-1785.969) -- 0:00:21 699500 -- (-1786.563) [-1785.775] (-1789.210) (-1787.025) * [-1785.479] (-1788.636) (-1788.368) (-1784.318) -- 0:00:21 700000 -- (-1784.256) (-1786.450) (-1784.771) [-1786.508] * (-1785.247) [-1786.915] (-1785.241) (-1785.063) -- 0:00:21 Average standard deviation of split frequencies: 0.007625 700500 -- [-1784.527] (-1786.386) (-1785.482) (-1785.438) * [-1783.600] (-1787.017) (-1786.978) (-1785.797) -- 0:00:21 701000 -- (-1788.967) (-1784.471) [-1785.738] (-1783.964) * (-1789.645) [-1786.190] (-1784.591) (-1787.166) -- 0:00:21 701500 -- (-1785.015) (-1786.378) [-1784.977] (-1785.330) * (-1789.879) (-1784.361) [-1784.292] (-1784.339) -- 0:00:21 702000 -- (-1787.552) [-1785.694] (-1785.509) (-1785.196) * (-1786.016) (-1784.498) (-1789.888) [-1783.573] -- 0:00:21 702500 -- (-1789.888) (-1785.512) [-1786.562] (-1784.914) * (-1786.219) (-1783.524) (-1786.837) [-1784.678] -- 0:00:21 703000 -- (-1788.444) [-1785.137] (-1787.821) (-1786.254) * [-1785.025] (-1784.072) (-1785.274) (-1784.825) -- 0:00:21 703500 -- (-1788.409) [-1784.730] (-1786.106) (-1785.981) * (-1783.735) (-1784.785) (-1785.969) [-1785.139] -- 0:00:21 704000 -- (-1786.607) (-1785.884) (-1784.307) [-1783.586] * (-1786.554) (-1784.595) (-1787.741) [-1785.776] -- 0:00:21 704500 -- [-1786.721] (-1784.730) (-1784.405) (-1785.393) * (-1791.606) (-1791.107) (-1788.455) [-1786.250] -- 0:00:21 705000 -- [-1785.624] (-1789.937) (-1783.817) (-1792.134) * (-1787.958) (-1787.343) [-1785.081] (-1787.598) -- 0:00:21 Average standard deviation of split frequencies: 0.008458 705500 -- [-1786.106] (-1784.477) (-1786.284) (-1786.396) * (-1785.491) (-1786.764) [-1786.180] (-1786.813) -- 0:00:21 706000 -- (-1784.524) [-1784.323] (-1784.751) (-1787.114) * (-1788.531) (-1785.445) (-1785.020) [-1787.048] -- 0:00:21 706500 -- (-1786.153) [-1785.708] (-1787.712) (-1785.149) * (-1786.776) (-1785.311) (-1785.839) [-1784.368] -- 0:00:21 707000 -- (-1783.828) [-1785.596] (-1786.897) (-1784.421) * (-1786.899) (-1785.324) [-1786.683] (-1785.929) -- 0:00:21 707500 -- (-1783.790) (-1784.271) [-1785.074] (-1784.205) * (-1786.664) [-1785.286] (-1784.579) (-1785.377) -- 0:00:21 708000 -- (-1787.262) (-1786.371) [-1783.977] (-1786.978) * (-1786.875) (-1785.977) (-1795.102) [-1785.159] -- 0:00:21 708500 -- (-1789.722) (-1785.813) (-1785.176) [-1786.634] * (-1784.513) (-1784.793) [-1784.716] (-1792.142) -- 0:00:20 709000 -- (-1785.450) [-1784.321] (-1786.018) (-1790.647) * (-1785.264) [-1784.384] (-1786.113) (-1786.367) -- 0:00:20 709500 -- (-1786.071) (-1790.168) [-1785.379] (-1790.501) * [-1784.863] (-1784.578) (-1784.264) (-1784.349) -- 0:00:20 710000 -- (-1787.885) (-1789.091) (-1788.608) [-1784.292] * (-1785.096) (-1786.399) [-1784.334] (-1785.478) -- 0:00:20 Average standard deviation of split frequencies: 0.007518 710500 -- (-1786.681) (-1788.246) [-1784.085] (-1784.170) * (-1783.776) [-1786.428] (-1785.277) (-1783.473) -- 0:00:20 711000 -- (-1787.443) [-1785.292] (-1787.629) (-1785.256) * [-1785.114] (-1786.458) (-1784.735) (-1783.307) -- 0:00:20 711500 -- [-1785.120] (-1783.933) (-1786.418) (-1784.945) * [-1787.909] (-1785.042) (-1784.335) (-1788.551) -- 0:00:20 712000 -- [-1785.705] (-1783.663) (-1789.613) (-1786.516) * [-1784.985] (-1784.243) (-1790.464) (-1789.504) -- 0:00:20 712500 -- (-1786.226) [-1786.998] (-1786.617) (-1786.272) * [-1785.744] (-1788.208) (-1784.389) (-1785.350) -- 0:00:20 713000 -- (-1786.678) (-1787.859) [-1786.609] (-1783.404) * (-1784.476) (-1788.406) (-1786.071) [-1785.943] -- 0:00:20 713500 -- (-1785.207) (-1785.262) [-1784.267] (-1786.717) * (-1784.201) (-1786.202) [-1784.121] (-1790.083) -- 0:00:20 714000 -- (-1785.689) (-1786.221) [-1786.452] (-1787.695) * (-1786.120) [-1787.793] (-1785.119) (-1786.806) -- 0:00:20 714500 -- [-1785.458] (-1784.858) (-1784.989) (-1786.101) * (-1785.761) [-1786.074] (-1786.821) (-1787.773) -- 0:00:20 715000 -- (-1791.122) [-1785.087] (-1784.397) (-1787.949) * (-1783.891) [-1784.879] (-1787.343) (-1786.470) -- 0:00:20 Average standard deviation of split frequencies: 0.006145 715500 -- (-1785.302) (-1785.542) (-1787.028) [-1785.024] * (-1786.987) [-1784.867] (-1784.032) (-1788.265) -- 0:00:20 716000 -- (-1784.354) [-1785.449] (-1784.399) (-1786.355) * [-1787.384] (-1784.658) (-1785.387) (-1787.706) -- 0:00:20 716500 -- (-1784.145) [-1786.473] (-1784.713) (-1784.623) * [-1785.634] (-1786.581) (-1791.265) (-1786.881) -- 0:00:20 717000 -- [-1785.095] (-1788.714) (-1784.569) (-1788.006) * [-1785.928] (-1783.520) (-1788.959) (-1784.854) -- 0:00:20 717500 -- (-1784.894) (-1787.735) [-1785.761] (-1788.309) * (-1785.036) (-1785.460) (-1788.215) [-1784.957] -- 0:00:20 718000 -- (-1784.765) (-1785.929) (-1784.676) [-1789.310] * [-1788.324] (-1785.105) (-1788.153) (-1787.643) -- 0:00:20 718500 -- (-1785.905) [-1786.490] (-1787.109) (-1785.575) * (-1784.551) [-1785.575] (-1785.860) (-1784.971) -- 0:00:20 719000 -- (-1785.741) [-1784.418] (-1787.511) (-1784.961) * (-1783.936) [-1784.230] (-1787.482) (-1786.647) -- 0:00:20 719500 -- (-1784.589) [-1785.623] (-1787.331) (-1784.349) * (-1784.723) [-1786.690] (-1789.053) (-1787.996) -- 0:00:20 720000 -- (-1786.211) (-1785.748) [-1788.526] (-1789.309) * (-1784.720) (-1783.973) (-1787.356) [-1784.749] -- 0:00:20 Average standard deviation of split frequencies: 0.004797 720500 -- [-1785.730] (-1785.228) (-1785.072) (-1788.278) * (-1785.778) (-1783.828) [-1789.606] (-1785.108) -- 0:00:20 721000 -- (-1784.032) (-1784.253) [-1785.176] (-1786.996) * (-1785.247) (-1784.111) [-1783.825] (-1788.306) -- 0:00:20 721500 -- [-1784.730] (-1783.349) (-1788.605) (-1787.932) * [-1784.701] (-1786.534) (-1787.376) (-1785.317) -- 0:00:20 722000 -- [-1785.631] (-1790.727) (-1785.001) (-1786.355) * [-1783.267] (-1786.796) (-1786.874) (-1786.069) -- 0:00:20 722500 -- (-1785.206) [-1786.720] (-1785.548) (-1783.840) * (-1783.402) [-1784.996] (-1786.446) (-1786.303) -- 0:00:19 723000 -- (-1785.392) (-1789.566) (-1787.945) [-1783.457] * (-1783.785) [-1784.609] (-1786.541) (-1785.476) -- 0:00:19 723500 -- (-1786.403) (-1791.394) [-1787.508] (-1783.768) * [-1787.473] (-1785.437) (-1788.961) (-1787.050) -- 0:00:19 724000 -- [-1788.044] (-1784.102) (-1787.162) (-1784.701) * (-1787.231) [-1784.917] (-1786.084) (-1787.707) -- 0:00:19 724500 -- (-1790.384) (-1787.762) (-1785.425) [-1784.739] * (-1785.801) (-1786.622) [-1784.025] (-1784.586) -- 0:00:19 725000 -- (-1787.708) (-1788.580) (-1786.128) [-1786.114] * (-1783.764) (-1784.917) (-1786.273) [-1785.175] -- 0:00:19 Average standard deviation of split frequencies: 0.002597 725500 -- (-1784.934) (-1790.159) [-1785.554] (-1784.190) * (-1784.301) [-1785.114] (-1784.894) (-1784.520) -- 0:00:19 726000 -- [-1784.711] (-1787.021) (-1786.641) (-1784.157) * (-1786.463) [-1785.645] (-1784.202) (-1784.563) -- 0:00:19 726500 -- (-1784.709) (-1786.139) [-1784.103] (-1784.693) * (-1786.875) (-1783.984) [-1784.417] (-1786.926) -- 0:00:19 727000 -- [-1784.124] (-1786.405) (-1787.475) (-1784.890) * (-1785.874) (-1783.996) [-1784.870] (-1785.095) -- 0:00:19 727500 -- (-1784.831) (-1786.007) (-1788.485) [-1785.691] * [-1784.649] (-1784.192) (-1783.784) (-1787.850) -- 0:00:19 728000 -- (-1784.465) [-1785.272] (-1786.859) (-1787.966) * (-1787.598) (-1784.510) (-1784.296) [-1788.019] -- 0:00:19 728500 -- (-1786.262) (-1785.349) [-1784.707] (-1784.044) * (-1787.761) (-1783.781) (-1784.348) [-1784.972] -- 0:00:19 729000 -- [-1783.661] (-1785.422) (-1783.940) (-1785.542) * (-1786.953) [-1784.967] (-1786.572) (-1785.997) -- 0:00:19 729500 -- (-1783.812) (-1785.513) [-1787.267] (-1789.895) * (-1788.506) (-1786.215) (-1786.303) [-1786.167] -- 0:00:19 730000 -- (-1784.383) (-1784.872) (-1785.612) [-1786.916] * (-1785.175) (-1788.978) (-1786.941) [-1785.544] -- 0:00:19 Average standard deviation of split frequencies: 0.004301 730500 -- [-1786.296] (-1789.485) (-1786.357) (-1783.505) * [-1786.637] (-1785.948) (-1784.293) (-1788.223) -- 0:00:19 731000 -- [-1784.774] (-1788.019) (-1785.192) (-1786.158) * (-1784.919) (-1785.690) [-1784.757] (-1784.800) -- 0:00:19 731500 -- (-1786.970) (-1788.938) (-1786.782) [-1784.613] * (-1784.723) (-1785.641) [-1785.205] (-1784.664) -- 0:00:19 732000 -- (-1786.483) [-1785.106] (-1787.572) (-1788.726) * (-1785.691) (-1783.846) [-1784.079] (-1795.989) -- 0:00:19 732500 -- (-1785.362) [-1785.349] (-1785.792) (-1785.780) * [-1786.134] (-1784.823) (-1788.279) (-1787.590) -- 0:00:19 733000 -- [-1785.105] (-1787.525) (-1787.352) (-1786.600) * (-1783.516) (-1785.039) [-1784.881] (-1793.978) -- 0:00:19 733500 -- (-1787.365) (-1791.102) [-1784.768] (-1784.959) * (-1785.319) (-1787.902) [-1787.354] (-1785.006) -- 0:00:19 734000 -- (-1784.453) (-1787.097) [-1786.074] (-1785.326) * (-1789.721) [-1783.412] (-1786.744) (-1787.910) -- 0:00:19 734500 -- (-1784.673) [-1786.162] (-1785.145) (-1784.169) * (-1787.046) [-1786.396] (-1785.617) (-1786.401) -- 0:00:19 735000 -- (-1786.241) (-1784.847) (-1783.950) [-1784.209] * (-1789.808) (-1787.152) [-1786.153] (-1784.868) -- 0:00:19 Average standard deviation of split frequencies: 0.004697 735500 -- (-1784.964) [-1785.514] (-1786.282) (-1787.054) * [-1785.930] (-1786.895) (-1787.795) (-1785.223) -- 0:00:19 736000 -- (-1784.635) [-1786.455] (-1786.063) (-1786.721) * (-1787.348) [-1785.645] (-1784.836) (-1787.488) -- 0:00:19 736500 -- (-1785.786) [-1783.706] (-1784.668) (-1784.126) * (-1788.875) (-1783.827) [-1785.389] (-1786.147) -- 0:00:18 737000 -- (-1786.722) (-1784.221) [-1783.750] (-1786.975) * [-1785.587] (-1784.690) (-1784.807) (-1783.686) -- 0:00:18 737500 -- (-1786.309) [-1790.572] (-1789.543) (-1784.368) * (-1786.409) (-1784.782) [-1787.885] (-1784.698) -- 0:00:18 738000 -- (-1787.665) (-1787.652) (-1785.218) [-1789.706] * (-1786.199) [-1788.947] (-1788.549) (-1786.062) -- 0:00:18 738500 -- (-1784.260) [-1787.175] (-1786.542) (-1784.038) * (-1784.829) [-1786.233] (-1786.697) (-1784.334) -- 0:00:18 739000 -- (-1785.782) (-1785.048) [-1788.219] (-1787.084) * [-1785.110] (-1786.930) (-1789.219) (-1787.469) -- 0:00:18 739500 -- [-1785.461] (-1790.074) (-1786.074) (-1788.065) * [-1783.847] (-1785.240) (-1788.072) (-1785.155) -- 0:00:18 740000 -- (-1785.544) (-1787.739) (-1786.622) [-1784.814] * (-1785.305) [-1786.556] (-1786.485) (-1785.824) -- 0:00:18 Average standard deviation of split frequencies: 0.004667 740500 -- (-1785.562) (-1785.510) [-1784.884] (-1784.338) * (-1785.139) [-1784.554] (-1786.762) (-1786.522) -- 0:00:18 741000 -- (-1784.514) (-1785.964) [-1785.216] (-1791.923) * (-1785.545) [-1784.790] (-1789.186) (-1787.760) -- 0:00:18 741500 -- [-1784.561] (-1785.170) (-1783.698) (-1788.128) * [-1785.030] (-1785.539) (-1785.495) (-1787.475) -- 0:00:18 742000 -- (-1783.988) (-1785.969) [-1783.783] (-1787.217) * (-1783.426) (-1784.627) [-1786.618] (-1790.368) -- 0:00:18 742500 -- (-1784.351) (-1784.446) [-1783.875] (-1787.225) * [-1788.985] (-1784.583) (-1784.372) (-1785.757) -- 0:00:18 743000 -- [-1785.792] (-1788.067) (-1783.939) (-1783.708) * (-1786.592) (-1785.577) (-1785.631) [-1783.858] -- 0:00:18 743500 -- (-1787.705) (-1786.515) (-1786.815) [-1784.609] * [-1784.421] (-1786.197) (-1785.548) (-1785.087) -- 0:00:18 744000 -- (-1784.832) (-1786.493) (-1788.205) [-1786.435] * (-1783.670) [-1786.607] (-1784.755) (-1784.676) -- 0:00:18 744500 -- [-1786.745] (-1785.042) (-1787.770) (-1785.870) * [-1786.990] (-1788.533) (-1784.492) (-1784.852) -- 0:00:18 745000 -- (-1786.629) (-1784.175) [-1787.106] (-1788.358) * (-1785.989) [-1784.255] (-1786.722) (-1786.523) -- 0:00:18 Average standard deviation of split frequencies: 0.005055 745500 -- (-1783.627) [-1784.432] (-1785.779) (-1785.600) * (-1788.384) (-1784.630) [-1787.555] (-1785.295) -- 0:00:18 746000 -- [-1786.039] (-1784.874) (-1784.535) (-1792.469) * (-1784.464) (-1785.342) [-1786.320] (-1785.881) -- 0:00:18 746500 -- (-1785.851) [-1784.760] (-1786.258) (-1786.080) * (-1784.378) (-1785.528) [-1785.702] (-1785.041) -- 0:00:18 747000 -- [-1784.992] (-1785.839) (-1785.915) (-1787.204) * (-1788.307) (-1786.574) (-1784.884) [-1784.179] -- 0:00:18 747500 -- (-1787.453) (-1789.906) (-1787.200) [-1785.756] * (-1786.103) [-1786.194] (-1784.949) (-1786.538) -- 0:00:18 748000 -- [-1786.419] (-1789.888) (-1788.563) (-1787.048) * [-1786.611] (-1788.125) (-1785.004) (-1786.374) -- 0:00:18 748500 -- (-1785.278) (-1786.443) (-1789.750) [-1784.937] * (-1787.781) [-1786.354] (-1785.927) (-1784.246) -- 0:00:18 749000 -- [-1783.790] (-1786.613) (-1785.059) (-1783.818) * [-1785.576] (-1786.782) (-1784.241) (-1784.772) -- 0:00:18 749500 -- (-1785.357) (-1784.595) (-1784.629) [-1783.823] * (-1784.728) [-1784.316] (-1786.769) (-1787.000) -- 0:00:18 750000 -- (-1791.822) (-1784.494) (-1785.627) [-1783.756] * (-1786.393) (-1785.061) [-1786.655] (-1786.845) -- 0:00:18 Average standard deviation of split frequencies: 0.006280 750500 -- [-1786.954] (-1787.275) (-1785.209) (-1784.897) * [-1785.173] (-1786.511) (-1786.329) (-1786.642) -- 0:00:17 751000 -- (-1786.213) (-1783.820) [-1784.122] (-1785.310) * (-1786.342) (-1784.107) [-1785.513] (-1785.406) -- 0:00:17 751500 -- (-1783.440) [-1788.296] (-1785.178) (-1785.603) * [-1786.736] (-1786.000) (-1785.390) (-1785.768) -- 0:00:17 752000 -- (-1784.046) (-1785.063) [-1789.397] (-1785.522) * (-1785.376) [-1784.339] (-1785.146) (-1785.223) -- 0:00:17 752500 -- (-1786.485) [-1784.094] (-1785.960) (-1783.563) * (-1787.588) (-1784.901) [-1784.640] (-1783.864) -- 0:00:17 753000 -- (-1786.309) (-1785.627) [-1788.833] (-1783.843) * [-1786.158] (-1786.765) (-1789.652) (-1786.544) -- 0:00:17 753500 -- [-1786.782] (-1788.124) (-1785.164) (-1784.584) * (-1788.175) [-1783.917] (-1785.158) (-1785.072) -- 0:00:17 754000 -- (-1789.652) (-1785.795) [-1786.256] (-1783.683) * [-1786.554] (-1785.058) (-1784.947) (-1784.351) -- 0:00:17 754500 -- (-1784.347) (-1787.709) [-1787.408] (-1783.368) * (-1786.561) [-1787.199] (-1784.922) (-1783.519) -- 0:00:17 755000 -- (-1785.909) (-1784.760) [-1784.324] (-1784.419) * (-1789.129) [-1785.112] (-1786.805) (-1785.140) -- 0:00:17 Average standard deviation of split frequencies: 0.005820 755500 -- [-1785.374] (-1787.222) (-1785.444) (-1785.024) * [-1787.670] (-1786.344) (-1785.822) (-1787.442) -- 0:00:17 756000 -- (-1785.295) (-1787.898) (-1787.530) [-1785.017] * (-1784.539) (-1788.610) (-1785.955) [-1786.240] -- 0:00:17 756500 -- (-1789.507) (-1788.638) [-1785.446] (-1786.805) * (-1788.433) [-1786.945] (-1785.825) (-1783.593) -- 0:00:17 757000 -- [-1784.493] (-1784.895) (-1784.984) (-1786.538) * (-1783.828) (-1787.417) (-1786.361) [-1784.288] -- 0:00:17 757500 -- (-1784.573) (-1785.376) [-1786.079] (-1783.948) * (-1785.090) (-1791.618) [-1785.322] (-1786.187) -- 0:00:17 758000 -- (-1787.248) (-1784.714) (-1784.666) [-1785.971] * (-1787.814) [-1785.111] (-1786.116) (-1784.791) -- 0:00:17 758500 -- (-1786.312) (-1785.440) [-1785.841] (-1785.823) * (-1787.892) (-1785.090) (-1785.476) [-1785.266] -- 0:00:17 759000 -- [-1784.386] (-1785.137) (-1785.752) (-1785.611) * (-1786.986) (-1784.516) [-1784.448] (-1792.269) -- 0:00:17 759500 -- (-1784.325) [-1785.929] (-1786.907) (-1790.006) * (-1784.603) (-1784.987) [-1785.925] (-1786.233) -- 0:00:17 760000 -- (-1784.197) (-1785.590) (-1786.266) [-1785.079] * (-1783.875) (-1783.790) (-1784.124) [-1785.512] -- 0:00:17 Average standard deviation of split frequencies: 0.004958 760500 -- (-1787.616) (-1785.527) [-1787.538] (-1786.291) * (-1786.436) (-1786.418) (-1785.789) [-1784.705] -- 0:00:17 761000 -- (-1792.356) (-1786.857) (-1783.640) [-1786.175] * (-1786.836) (-1784.474) (-1791.322) [-1786.213] -- 0:00:17 761500 -- (-1787.949) (-1786.367) (-1786.209) [-1785.004] * [-1784.601] (-1785.571) (-1795.040) (-1790.212) -- 0:00:17 762000 -- (-1786.171) [-1784.356] (-1785.760) (-1784.721) * (-1786.254) (-1787.232) (-1785.762) [-1785.303] -- 0:00:17 762500 -- (-1785.448) (-1785.209) [-1785.427] (-1784.245) * [-1786.064] (-1788.440) (-1785.550) (-1788.420) -- 0:00:17 763000 -- [-1783.623] (-1786.691) (-1786.094) (-1785.200) * [-1785.986] (-1786.602) (-1788.318) (-1783.928) -- 0:00:17 763500 -- (-1788.687) (-1786.999) (-1785.997) [-1785.706] * (-1786.440) (-1788.379) (-1785.654) [-1786.304] -- 0:00:17 764000 -- (-1786.276) (-1786.368) [-1788.065] (-1785.836) * (-1784.415) [-1784.735] (-1785.541) (-1787.508) -- 0:00:16 764500 -- (-1785.096) [-1788.888] (-1785.999) (-1786.496) * (-1784.025) (-1784.829) [-1783.751] (-1784.841) -- 0:00:16 765000 -- (-1787.511) [-1786.417] (-1787.698) (-1787.250) * (-1784.827) (-1784.233) (-1785.269) [-1785.632] -- 0:00:16 Average standard deviation of split frequencies: 0.003692 765500 -- [-1784.470] (-1783.961) (-1785.265) (-1788.086) * (-1786.185) [-1784.035] (-1784.738) (-1784.138) -- 0:00:16 766000 -- (-1790.406) (-1787.394) (-1788.976) [-1785.520] * (-1785.722) (-1788.379) (-1785.217) [-1784.434] -- 0:00:16 766500 -- (-1785.294) (-1783.526) [-1785.117] (-1785.109) * [-1785.118] (-1787.808) (-1785.334) (-1784.855) -- 0:00:16 767000 -- (-1785.635) [-1783.929] (-1785.460) (-1783.981) * [-1789.378] (-1786.930) (-1784.392) (-1785.205) -- 0:00:16 767500 -- (-1788.054) (-1784.796) (-1784.200) [-1783.558] * [-1784.438] (-1785.169) (-1785.483) (-1788.109) -- 0:00:16 768000 -- (-1786.153) (-1784.718) (-1794.281) [-1784.278] * [-1784.688] (-1784.037) (-1783.956) (-1785.877) -- 0:00:16 768500 -- [-1783.968] (-1786.076) (-1790.075) (-1784.804) * [-1786.029] (-1784.926) (-1785.339) (-1787.120) -- 0:00:16 769000 -- [-1783.648] (-1786.615) (-1791.896) (-1785.121) * (-1786.961) (-1785.260) (-1786.988) [-1784.651] -- 0:00:16 769500 -- (-1784.817) (-1787.453) [-1784.594] (-1783.876) * (-1784.082) (-1785.519) [-1784.879] (-1787.998) -- 0:00:16 770000 -- (-1790.117) [-1784.923] (-1790.446) (-1789.524) * (-1793.574) (-1789.995) [-1784.149] (-1789.136) -- 0:00:16 Average standard deviation of split frequencies: 0.004078 770500 -- [-1786.212] (-1784.421) (-1784.280) (-1786.523) * [-1785.153] (-1786.856) (-1785.359) (-1786.656) -- 0:00:16 771000 -- (-1785.271) [-1786.773] (-1785.299) (-1785.012) * (-1785.990) [-1784.331] (-1785.636) (-1784.096) -- 0:00:16 771500 -- (-1787.517) [-1784.168] (-1786.337) (-1787.893) * (-1785.345) (-1786.898) [-1784.616] (-1787.441) -- 0:00:16 772000 -- (-1788.078) (-1787.719) (-1787.294) [-1784.518] * (-1785.895) [-1785.605] (-1784.962) (-1784.304) -- 0:00:16 772500 -- [-1785.766] (-1784.532) (-1784.857) (-1784.644) * [-1786.608] (-1785.663) (-1784.935) (-1783.890) -- 0:00:16 773000 -- (-1783.658) (-1783.752) (-1786.425) [-1786.729] * [-1784.845] (-1784.505) (-1786.685) (-1787.968) -- 0:00:16 773500 -- (-1785.663) (-1786.207) [-1785.205] (-1784.665) * (-1784.148) (-1786.723) [-1791.763] (-1784.471) -- 0:00:16 774000 -- (-1785.681) (-1784.933) (-1788.437) [-1787.193] * (-1784.605) (-1785.414) (-1788.307) [-1785.621] -- 0:00:16 774500 -- (-1784.806) [-1791.231] (-1788.699) (-1784.553) * (-1786.197) (-1787.313) [-1789.709] (-1784.630) -- 0:00:16 775000 -- (-1787.789) (-1786.541) (-1785.212) [-1784.217] * (-1785.708) (-1785.509) (-1787.315) [-1788.472] -- 0:00:16 Average standard deviation of split frequencies: 0.004050 775500 -- [-1787.346] (-1786.411) (-1785.043) (-1784.407) * [-1785.124] (-1785.901) (-1786.090) (-1784.316) -- 0:00:16 776000 -- (-1784.200) (-1784.431) (-1784.768) [-1784.913] * (-1787.448) (-1789.398) (-1785.830) [-1783.922] -- 0:00:16 776500 -- (-1788.007) (-1785.930) [-1786.320] (-1785.942) * (-1785.213) (-1786.413) (-1786.171) [-1785.762] -- 0:00:16 777000 -- (-1785.780) (-1787.957) [-1787.303] (-1786.637) * (-1786.185) (-1785.672) [-1788.553] (-1787.401) -- 0:00:16 777500 -- (-1785.645) (-1784.938) (-1784.513) [-1788.123] * (-1785.275) (-1785.697) [-1784.008] (-1787.878) -- 0:00:16 778000 -- (-1786.219) (-1786.623) [-1784.584] (-1785.994) * (-1785.649) (-1784.291) (-1785.136) [-1783.867] -- 0:00:15 778500 -- (-1787.168) [-1783.749] (-1784.159) (-1788.893) * (-1785.463) (-1783.676) (-1785.090) [-1787.200] -- 0:00:15 779000 -- (-1785.260) (-1783.745) [-1785.334] (-1785.939) * (-1784.672) [-1783.995] (-1784.440) (-1786.283) -- 0:00:15 779500 -- [-1784.605] (-1785.000) (-1786.468) (-1787.521) * [-1784.558] (-1789.525) (-1784.436) (-1790.258) -- 0:00:15 780000 -- (-1785.735) (-1786.821) (-1785.595) [-1788.640] * [-1788.504] (-1786.707) (-1784.514) (-1788.193) -- 0:00:15 Average standard deviation of split frequencies: 0.003623 780500 -- [-1784.867] (-1786.980) (-1784.510) (-1791.031) * (-1786.881) [-1785.831] (-1785.886) (-1784.978) -- 0:00:15 781000 -- (-1785.394) (-1786.343) (-1784.154) [-1784.497] * (-1788.015) (-1786.891) [-1784.793] (-1784.826) -- 0:00:15 781500 -- [-1785.904] (-1784.485) (-1787.844) (-1785.299) * (-1785.628) (-1784.146) [-1784.486] (-1784.966) -- 0:00:15 782000 -- (-1784.267) [-1787.544] (-1784.945) (-1786.072) * (-1784.913) (-1784.485) [-1786.354] (-1785.449) -- 0:00:15 782500 -- (-1785.191) [-1786.222] (-1787.775) (-1784.610) * [-1786.547] (-1785.007) (-1788.847) (-1785.493) -- 0:00:15 783000 -- (-1785.886) [-1783.644] (-1787.562) (-1784.992) * (-1786.018) (-1787.987) [-1785.790] (-1789.159) -- 0:00:15 783500 -- (-1783.292) (-1784.907) [-1784.813] (-1788.682) * (-1784.163) [-1783.717] (-1787.622) (-1784.491) -- 0:00:15 784000 -- (-1786.704) (-1785.317) (-1786.090) [-1786.191] * (-1784.562) (-1785.893) (-1786.621) [-1786.546] -- 0:00:15 784500 -- (-1785.437) (-1783.598) (-1786.381) [-1786.872] * (-1783.572) (-1788.911) [-1785.852] (-1787.164) -- 0:00:15 785000 -- (-1788.457) [-1784.358] (-1786.868) (-1786.027) * (-1787.324) (-1790.075) (-1787.267) [-1787.882] -- 0:00:15 Average standard deviation of split frequencies: 0.003599 785500 -- (-1783.632) [-1784.203] (-1787.064) (-1784.801) * (-1786.689) (-1787.146) [-1786.316] (-1785.604) -- 0:00:15 786000 -- (-1784.121) (-1784.963) (-1785.880) [-1784.745] * (-1784.640) [-1784.396] (-1787.246) (-1787.307) -- 0:00:15 786500 -- [-1786.274] (-1785.276) (-1785.365) (-1786.406) * (-1785.359) (-1786.605) [-1787.502] (-1795.045) -- 0:00:15 787000 -- (-1792.193) (-1785.313) (-1785.677) [-1786.784] * (-1787.629) (-1788.846) (-1785.502) [-1786.571] -- 0:00:15 787500 -- (-1784.694) (-1789.098) [-1784.412] (-1785.332) * (-1785.752) (-17