--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:53:49 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0141/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -344.76 -347.89
2 -344.77 -348.26
--------------------------------------
TOTAL -344.76 -348.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894678 0.088258 0.394370 1.519389 0.863336 1299.86 1400.43 1.001
r(A<->C){all} 0.159576 0.018549 0.000093 0.436396 0.121492 165.48 195.12 1.000
r(A<->G){all} 0.161443 0.018251 0.000030 0.439253 0.126382 217.16 239.18 1.002
r(A<->T){all} 0.167405 0.020025 0.000028 0.458592 0.128345 162.02 199.96 1.000
r(C<->G){all} 0.157167 0.017755 0.000031 0.418328 0.122672 207.95 292.52 1.004
r(C<->T){all} 0.177621 0.021971 0.000175 0.475461 0.138615 253.22 274.08 1.003
r(G<->T){all} 0.176788 0.021803 0.000003 0.466215 0.133663 186.45 205.84 1.000
pi(A){all} 0.227261 0.000697 0.174545 0.276150 0.227037 1306.71 1336.31 1.000
pi(C){all} 0.323670 0.000881 0.267949 0.383024 0.323266 1289.02 1347.25 1.000
pi(G){all} 0.273354 0.000776 0.218414 0.327107 0.272760 1316.28 1338.53 1.000
pi(T){all} 0.175716 0.000554 0.132111 0.221963 0.174780 1357.91 1408.63 1.000
alpha{1,2} 0.429228 0.237845 0.000238 1.449755 0.247098 1263.31 1267.18 1.000
alpha{3} 0.452109 0.234900 0.000521 1.432846 0.288085 1047.58 1137.31 1.000
pinvar{all} 0.993178 0.000068 0.977784 0.999999 0.995809 1100.47 1190.18 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -331.393716
Model 2: PositiveSelection -331.393713
Model 0: one-ratio -331.393717
Model 7: beta -331.393721
Model 8: beta&w>1 -331.393715
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 5.999999984851456E-6
Model 8 vs 7 1.200000008338975E-5
>C1
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C2
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C3
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C4
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C5
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C6
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
C1 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C2 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C3 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C4 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C5 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C6 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
**************************************************
C1 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C2 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C3 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C4 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C5 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C6 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2520]--->[2520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C2 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C3 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C4 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C5 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
C6 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
**************************************************
C1 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C2 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C3 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C4 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C5 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
C6 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
C2 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
C3 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
C4 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
C5 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
C6 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
**************************************************
C1 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
C2 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
C3 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
C4 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
C5 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
C6 TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
**************************************************
C1 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
C2 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
C3 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
C4 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
C5 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
C6 GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
**************************************************
C1 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
C2 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
C3 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
C4 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
C5 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
C6 AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
**************************************************
C1 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
C2 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
C3 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
C4 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
C5 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
C6 TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
**************************************************
C1 GT
C2 GT
C3 GT
C4 GT
C5 GT
C6 GT
**
>C1
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C2
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C3
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C4
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C5
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C6
ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT
TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG
GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG
AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG
TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA
GT
>C1
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C2
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C3
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C4
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C5
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
>C6
MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 252 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791151
Setting output file names to "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2015352727
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0768293489
Seed = 1226470712
Swapseed = 1579791151
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -563.988083 -- -24.965149
Chain 2 -- -563.988083 -- -24.965149
Chain 3 -- -563.988051 -- -24.965149
Chain 4 -- -563.988083 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -563.988083 -- -24.965149
Chain 2 -- -563.987997 -- -24.965149
Chain 3 -- -563.987997 -- -24.965149
Chain 4 -- -563.988051 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-563.988] (-563.988) (-563.988) (-563.988) * [-563.988] (-563.988) (-563.988) (-563.988)
500 -- (-361.180) [-351.830] (-352.700) (-361.309) * (-358.487) (-352.096) (-353.323) [-355.541] -- 0:00:00
1000 -- (-357.160) (-358.538) [-351.942] (-358.806) * [-349.886] (-357.796) (-355.695) (-352.881) -- 0:00:00
1500 -- (-354.645) (-357.847) [-355.089] (-357.770) * (-362.079) (-356.918) [-352.913] (-350.809) -- 0:00:00
2000 -- (-354.670) [-354.133] (-359.218) (-351.690) * [-355.312] (-357.886) (-352.500) (-349.304) -- 0:00:00
2500 -- [-351.019] (-354.334) (-360.040) (-358.222) * (-354.698) (-353.221) [-349.269] (-351.194) -- 0:00:00
3000 -- (-352.968) (-357.309) (-358.501) [-351.434] * (-356.258) (-349.880) (-356.710) [-352.874] -- 0:00:00
3500 -- (-360.065) (-356.372) (-353.259) [-354.618] * [-350.574] (-351.796) (-355.392) (-351.942) -- 0:00:00
4000 -- (-354.291) (-362.451) [-354.324] (-353.828) * [-352.670] (-356.112) (-365.851) (-357.511) -- 0:00:00
4500 -- (-361.649) (-353.660) (-359.869) [-357.186] * [-352.312] (-356.471) (-355.336) (-351.190) -- 0:00:00
5000 -- [-348.609] (-350.818) (-351.503) (-350.162) * [-355.108] (-353.014) (-356.142) (-353.744) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-363.756) (-350.534) (-366.049) [-355.437] * (-352.033) (-357.817) (-355.793) [-347.951] -- 0:00:00
6000 -- (-353.879) (-353.023) (-358.143) [-353.278] * [-358.428] (-355.509) (-357.047) (-355.205) -- 0:00:00
6500 -- [-355.346] (-353.886) (-356.578) (-353.719) * (-360.159) (-352.427) [-350.277] (-358.568) -- 0:00:00
7000 -- [-349.549] (-350.098) (-346.499) (-351.080) * [-351.327] (-362.773) (-354.954) (-359.661) -- 0:00:00
7500 -- (-360.554) (-358.218) [-346.566] (-353.340) * (-357.636) (-354.141) [-354.525] (-353.446) -- 0:00:00
8000 -- [-352.709] (-354.660) (-344.600) (-355.710) * [-350.061] (-352.622) (-355.932) (-352.561) -- 0:00:00
8500 -- (-359.457) (-358.892) [-344.576] (-360.736) * (-357.974) (-353.485) (-357.229) [-352.195] -- 0:00:00
9000 -- (-351.367) (-355.927) [-344.310] (-356.639) * (-360.542) (-353.939) [-352.953] (-354.381) -- 0:00:00
9500 -- (-358.148) [-357.713] (-344.699) (-357.515) * [-351.575] (-355.364) (-355.851) (-353.539) -- 0:00:00
10000 -- [-349.832] (-359.796) (-344.708) (-359.318) * (-365.111) (-358.258) [-351.695] (-355.472) -- 0:00:00
Average standard deviation of split frequencies: 0.077340
10500 -- [-351.301] (-353.677) (-348.395) (-355.505) * (-361.379) [-357.139] (-360.012) (-356.859) -- 0:01:34
11000 -- (-350.647) (-355.703) [-345.964] (-353.718) * (-356.515) (-350.202) (-351.506) [-353.346] -- 0:01:29
11500 -- (-357.870) [-356.538] (-346.331) (-359.275) * [-344.475] (-356.940) (-354.976) (-356.484) -- 0:01:25
12000 -- (-356.156) (-356.991) (-347.586) [-351.519] * (-345.445) (-351.567) (-355.969) [-353.338] -- 0:01:22
12500 -- (-354.544) (-351.410) [-345.075] (-356.194) * (-346.111) (-352.387) [-355.575] (-363.061) -- 0:01:19
13000 -- [-350.498] (-359.640) (-346.766) (-364.733) * (-347.214) [-350.387] (-354.612) (-361.026) -- 0:01:15
13500 -- (-361.747) (-357.304) (-346.315) [-352.513] * (-347.278) (-356.252) (-354.110) [-355.889] -- 0:01:13
14000 -- (-351.558) [-353.138] (-345.023) (-355.131) * (-344.552) [-354.218] (-365.214) (-356.471) -- 0:01:10
14500 -- [-343.985] (-355.115) (-344.684) (-372.358) * (-346.541) (-352.237) (-352.586) [-351.863] -- 0:01:07
15000 -- (-346.561) (-355.675) [-343.869] (-369.533) * [-343.349] (-352.605) (-359.859) (-350.620) -- 0:01:05
Average standard deviation of split frequencies: 0.060562
15500 -- [-343.368] (-352.038) (-343.438) (-361.583) * (-344.157) [-358.831] (-357.965) (-356.648) -- 0:01:03
16000 -- (-344.420) (-356.079) [-346.433] (-367.085) * (-345.609) (-355.537) [-350.785] (-353.596) -- 0:01:01
16500 -- (-344.347) [-355.044] (-346.782) (-360.280) * (-343.756) (-357.741) [-350.733] (-353.533) -- 0:00:59
17000 -- (-345.969) [-349.335] (-346.127) (-349.618) * [-345.254] (-362.182) (-354.292) (-354.804) -- 0:00:57
17500 -- (-350.936) (-355.694) (-344.210) [-344.289] * (-344.054) (-355.167) [-350.963] (-365.950) -- 0:00:56
18000 -- (-344.670) (-356.853) [-343.839] (-345.110) * (-346.479) (-365.784) [-354.032] (-355.144) -- 0:00:54
18500 -- (-343.943) [-361.941] (-345.423) (-344.953) * (-351.061) (-364.661) [-353.692] (-352.880) -- 0:00:53
19000 -- [-344.271] (-354.070) (-347.961) (-345.232) * [-351.520] (-363.498) (-361.123) (-352.264) -- 0:00:51
19500 -- [-349.764] (-355.002) (-347.619) (-345.110) * (-343.828) (-356.541) (-354.532) [-354.314] -- 0:00:50
20000 -- (-350.334) (-357.119) [-345.913] (-346.417) * (-343.523) [-349.906] (-353.254) (-355.987) -- 0:00:49
Average standard deviation of split frequencies: 0.055012
20500 -- [-345.987] (-351.947) (-346.299) (-344.659) * (-344.694) (-350.080) (-355.766) [-354.064] -- 0:00:47
21000 -- [-346.695] (-352.221) (-349.044) (-343.445) * [-344.469] (-349.556) (-360.620) (-355.158) -- 0:00:46
21500 -- (-351.742) (-352.576) [-345.243] (-343.892) * (-345.489) (-353.423) (-352.368) [-357.963] -- 0:00:45
22000 -- (-345.645) [-351.795] (-344.953) (-347.623) * (-346.275) (-350.470) [-349.937] (-360.430) -- 0:00:44
22500 -- (-347.415) [-353.784] (-344.706) (-348.107) * (-347.091) (-347.867) [-350.469] (-358.211) -- 0:00:43
23000 -- (-347.591) [-351.582] (-346.092) (-346.645) * (-349.206) (-346.842) (-352.462) [-361.878] -- 0:00:42
23500 -- (-344.784) [-354.579] (-344.674) (-346.419) * (-344.816) [-343.598] (-360.353) (-362.207) -- 0:00:41
24000 -- [-345.802] (-357.235) (-343.338) (-348.464) * [-345.252] (-344.266) (-367.711) (-350.561) -- 0:00:40
24500 -- (-348.518) (-358.541) (-343.736) [-344.394] * (-348.764) (-346.488) [-367.740] (-345.657) -- 0:00:39
25000 -- [-344.890] (-357.469) (-344.871) (-346.935) * [-345.651] (-343.293) (-358.395) (-344.251) -- 0:00:39
Average standard deviation of split frequencies: 0.045759
25500 -- (-345.324) (-359.435) [-345.713] (-345.154) * (-347.077) (-345.747) (-350.643) [-347.033] -- 0:01:16
26000 -- (-345.273) (-366.285) [-345.618] (-345.991) * (-348.252) (-345.369) [-348.596] (-348.173) -- 0:01:14
26500 -- (-347.573) (-350.317) [-345.560] (-344.769) * (-343.877) (-349.115) [-344.950] (-344.579) -- 0:01:13
27000 -- [-347.512] (-348.638) (-348.056) (-344.771) * (-344.364) (-345.420) (-345.143) [-347.349] -- 0:01:12
27500 -- [-346.070] (-350.989) (-344.673) (-346.848) * (-345.044) [-346.056] (-343.798) (-344.733) -- 0:01:10
28000 -- (-345.021) (-353.729) (-349.844) [-344.679] * (-345.916) (-346.938) [-346.218] (-347.677) -- 0:01:09
28500 -- (-347.629) (-360.749) (-346.427) [-344.029] * (-343.147) (-345.411) [-345.694] (-351.760) -- 0:01:08
29000 -- [-346.436] (-356.927) (-346.304) (-343.831) * (-343.642) (-344.124) [-346.046] (-346.182) -- 0:01:06
29500 -- (-344.623) [-353.699] (-344.193) (-345.421) * [-344.645] (-343.884) (-347.651) (-345.970) -- 0:01:05
30000 -- (-348.249) (-355.414) [-345.349] (-344.392) * (-347.239) (-346.306) [-344.249] (-346.619) -- 0:01:04
Average standard deviation of split frequencies: 0.036893
30500 -- (-350.331) (-361.816) (-345.939) [-343.759] * (-344.311) (-345.122) [-343.996] (-343.578) -- 0:01:03
31000 -- [-344.773] (-357.216) (-345.348) (-345.349) * (-346.948) [-345.093] (-343.587) (-344.257) -- 0:01:02
31500 -- (-345.912) (-357.016) (-348.665) [-347.749] * (-345.753) (-344.064) [-345.022] (-348.210) -- 0:01:01
32000 -- (-345.897) [-355.578] (-343.460) (-346.990) * (-346.540) [-344.643] (-344.204) (-343.712) -- 0:01:00
32500 -- (-345.421) (-355.117) (-345.273) [-349.126] * (-346.367) (-347.766) (-347.010) [-348.838] -- 0:00:59
33000 -- [-344.516] (-359.113) (-348.413) (-349.667) * (-343.444) (-345.562) (-343.823) [-344.745] -- 0:00:58
33500 -- (-345.347) (-357.890) (-347.733) [-345.507] * (-344.310) (-346.492) (-346.629) [-347.037] -- 0:00:57
34000 -- [-344.986] (-358.670) (-344.627) (-346.785) * (-345.124) (-344.857) (-343.791) [-345.006] -- 0:00:56
34500 -- (-350.241) (-348.741) [-345.299] (-343.708) * (-344.659) (-347.643) [-344.537] (-345.149) -- 0:00:55
35000 -- (-344.029) (-363.788) [-343.750] (-344.487) * (-344.287) (-349.198) (-343.587) [-345.381] -- 0:00:55
Average standard deviation of split frequencies: 0.037498
35500 -- (-343.643) (-353.551) (-347.281) [-346.028] * (-345.989) (-346.684) [-343.122] (-347.132) -- 0:00:54
36000 -- (-344.984) (-354.674) [-346.520] (-350.880) * (-344.550) [-346.069] (-344.009) (-349.988) -- 0:00:53
36500 -- [-343.444] (-352.874) (-344.798) (-345.140) * (-344.150) [-346.844] (-343.015) (-350.272) -- 0:00:52
37000 -- [-345.802] (-360.772) (-345.266) (-346.765) * [-344.360] (-344.370) (-345.128) (-344.718) -- 0:00:52
37500 -- (-344.852) (-355.500) (-344.821) [-344.157] * (-347.446) (-343.866) [-346.654] (-348.515) -- 0:00:51
38000 -- (-345.245) (-355.364) [-345.432] (-345.569) * (-346.726) (-343.884) [-344.529] (-351.772) -- 0:00:50
38500 -- [-345.641] (-350.185) (-350.289) (-351.327) * (-343.900) (-343.995) [-344.153] (-345.969) -- 0:00:49
39000 -- (-344.536) [-356.228] (-345.938) (-348.683) * (-343.515) [-343.375] (-345.812) (-345.250) -- 0:00:49
39500 -- (-344.185) (-358.433) [-344.490] (-344.022) * (-346.580) (-345.332) (-343.933) [-345.731] -- 0:00:48
40000 -- (-348.258) (-355.478) [-346.122] (-343.647) * [-347.564] (-344.879) (-344.806) (-344.970) -- 0:00:48
Average standard deviation of split frequencies: 0.038088
40500 -- (-351.367) (-350.876) [-344.014] (-343.934) * [-344.653] (-343.378) (-344.667) (-347.651) -- 0:00:47
41000 -- [-348.299] (-349.002) (-346.095) (-347.791) * [-344.557] (-344.788) (-345.280) (-346.846) -- 0:00:46
41500 -- (-343.255) [-359.126] (-344.471) (-346.419) * (-344.393) (-347.511) (-344.766) [-346.829] -- 0:00:46
42000 -- [-344.910] (-351.738) (-348.711) (-346.160) * (-345.562) (-346.855) [-345.751] (-346.475) -- 0:01:08
42500 -- [-344.165] (-356.113) (-347.806) (-349.138) * (-343.705) [-349.488] (-345.163) (-345.337) -- 0:01:07
43000 -- [-346.393] (-354.624) (-346.316) (-346.597) * [-344.446] (-345.676) (-344.316) (-346.124) -- 0:01:06
43500 -- (-343.756) [-359.516] (-347.452) (-346.901) * [-346.779] (-343.676) (-347.039) (-348.248) -- 0:01:05
44000 -- (-344.862) (-351.036) [-344.328] (-343.681) * (-343.426) (-345.646) (-344.459) [-344.848] -- 0:01:05
44500 -- (-346.189) [-348.007] (-346.191) (-343.758) * [-347.519] (-343.898) (-343.461) (-346.964) -- 0:01:04
45000 -- (-347.052) (-354.798) [-347.075] (-348.707) * (-345.656) (-345.413) [-344.717] (-346.395) -- 0:01:03
Average standard deviation of split frequencies: 0.035624
45500 -- (-345.467) (-357.274) (-346.067) [-345.159] * (-345.848) (-344.949) [-345.141] (-343.994) -- 0:01:02
46000 -- (-345.808) (-356.008) (-344.864) [-343.689] * [-345.371] (-348.753) (-347.870) (-344.767) -- 0:01:02
46500 -- (-345.889) (-345.485) [-346.304] (-343.532) * (-346.474) (-344.481) [-345.722] (-346.320) -- 0:01:01
47000 -- [-345.275] (-344.039) (-347.094) (-346.592) * [-343.747] (-344.826) (-345.478) (-352.138) -- 0:01:00
47500 -- (-345.967) (-348.154) (-343.587) [-344.357] * (-345.106) [-345.116] (-347.017) (-349.436) -- 0:01:00
48000 -- (-346.284) (-346.679) [-350.458] (-344.277) * (-344.717) (-345.883) (-345.573) [-346.305] -- 0:00:59
48500 -- (-344.852) (-344.344) (-346.631) [-343.859] * [-348.049] (-346.584) (-345.149) (-344.802) -- 0:00:58
49000 -- (-343.880) (-344.205) (-343.830) [-346.831] * (-352.411) [-345.075] (-346.896) (-343.618) -- 0:00:58
49500 -- [-344.547] (-345.372) (-346.235) (-345.809) * (-343.884) [-343.439] (-345.483) (-343.688) -- 0:00:57
50000 -- (-348.346) [-346.764] (-344.539) (-351.465) * (-348.205) (-344.576) [-345.507] (-344.751) -- 0:00:57
Average standard deviation of split frequencies: 0.031013
50500 -- (-344.919) (-346.284) (-345.024) [-348.982] * (-345.396) (-349.034) [-346.397] (-344.415) -- 0:00:56
51000 -- (-345.789) (-343.955) (-344.289) [-350.998] * (-344.978) (-349.997) [-344.086] (-344.091) -- 0:00:55
51500 -- (-345.083) (-349.018) [-344.070] (-346.717) * [-344.027] (-346.915) (-348.920) (-343.535) -- 0:00:55
52000 -- (-347.058) (-346.408) [-344.183] (-347.169) * (-345.024) (-346.800) (-347.958) [-345.042] -- 0:00:54
52500 -- (-349.749) (-346.631) (-344.405) [-345.677] * (-345.112) (-344.588) (-350.156) [-344.707] -- 0:00:54
53000 -- (-347.868) [-345.519] (-348.392) (-343.491) * [-345.572] (-347.927) (-346.189) (-344.859) -- 0:00:53
53500 -- (-345.838) (-344.436) (-345.754) [-345.352] * (-345.979) (-343.548) (-345.398) [-344.014] -- 0:00:53
54000 -- (-343.642) [-347.990] (-345.145) (-344.241) * (-346.071) (-343.376) [-347.643] (-345.304) -- 0:00:52
54500 -- (-346.129) (-344.882) (-345.283) [-343.930] * (-343.223) [-344.431] (-343.953) (-345.621) -- 0:00:52
55000 -- (-345.380) (-344.855) (-348.295) [-343.841] * (-345.338) (-346.402) (-347.637) [-344.417] -- 0:00:51
Average standard deviation of split frequencies: 0.027779
55500 -- [-343.684] (-343.932) (-346.516) (-344.676) * [-344.584] (-345.208) (-343.803) (-344.917) -- 0:00:51
56000 -- [-344.876] (-344.172) (-344.593) (-344.456) * (-343.692) (-346.039) (-349.630) [-344.744] -- 0:00:50
56500 -- (-348.359) [-347.082] (-344.887) (-343.797) * (-344.296) [-349.725] (-349.182) (-347.614) -- 0:01:06
57000 -- (-348.416) (-346.964) [-344.659] (-345.417) * (-345.708) [-345.694] (-348.411) (-346.985) -- 0:01:06
57500 -- (-345.094) (-345.127) [-344.036] (-346.299) * (-344.812) (-344.288) (-345.302) [-344.082] -- 0:01:05
58000 -- [-347.056] (-345.544) (-344.194) (-345.536) * (-345.597) (-350.935) [-345.171] (-348.286) -- 0:01:04
58500 -- (-344.682) (-356.585) [-343.829] (-348.784) * (-345.696) [-347.019] (-348.349) (-344.120) -- 0:01:04
59000 -- (-343.201) (-344.027) [-344.583] (-348.452) * (-343.426) (-345.381) [-344.863] (-345.613) -- 0:01:03
59500 -- (-344.449) [-344.255] (-345.539) (-345.387) * (-343.574) (-348.640) (-346.593) [-343.833] -- 0:01:03
60000 -- [-344.522] (-345.084) (-348.689) (-347.872) * (-347.100) (-345.234) [-348.840] (-347.425) -- 0:01:02
Average standard deviation of split frequencies: 0.025254
60500 -- (-345.623) (-349.931) (-345.091) [-346.569] * (-348.295) (-345.760) (-344.951) [-345.534] -- 0:01:02
61000 -- (-344.141) (-348.249) (-346.215) [-347.309] * (-344.086) [-345.347] (-346.270) (-346.712) -- 0:01:01
61500 -- (-348.831) (-346.684) [-346.751] (-349.706) * (-344.524) (-348.480) [-346.122] (-344.718) -- 0:01:01
62000 -- [-343.323] (-344.830) (-346.217) (-345.357) * (-345.970) (-344.200) [-348.070] (-349.940) -- 0:01:00
62500 -- [-344.194] (-343.305) (-345.491) (-348.296) * (-346.272) (-350.689) [-346.079] (-345.933) -- 0:01:00
63000 -- [-343.273] (-345.600) (-343.875) (-345.492) * (-344.706) [-347.506] (-344.892) (-345.767) -- 0:00:59
63500 -- [-345.108] (-347.231) (-344.934) (-345.712) * (-347.883) (-345.166) (-347.230) [-343.637] -- 0:00:58
64000 -- [-349.118] (-348.695) (-345.269) (-344.657) * [-347.686] (-346.785) (-348.903) (-346.360) -- 0:00:58
64500 -- (-347.828) (-345.821) [-345.134] (-349.944) * (-345.862) (-348.981) (-344.775) [-343.980] -- 0:00:58
65000 -- (-344.130) (-347.616) (-345.306) [-346.112] * [-345.504] (-344.018) (-347.089) (-345.987) -- 0:00:57
Average standard deviation of split frequencies: 0.027209
65500 -- (-344.487) (-345.609) (-348.675) [-348.425] * (-345.415) (-347.474) [-346.090] (-346.405) -- 0:00:57
66000 -- (-348.247) (-344.705) (-347.187) [-347.134] * (-345.870) (-346.933) [-345.837] (-343.881) -- 0:00:56
66500 -- [-345.527] (-343.794) (-347.217) (-343.522) * [-346.568] (-343.244) (-347.139) (-345.712) -- 0:00:56
67000 -- (-345.404) (-344.049) (-347.224) [-345.441] * [-346.564] (-345.498) (-343.715) (-344.970) -- 0:00:55
67500 -- (-344.810) (-344.821) (-350.282) [-348.900] * (-351.861) (-346.267) (-344.264) [-346.677] -- 0:00:55
68000 -- (-346.406) [-347.999] (-345.407) (-348.027) * (-343.517) (-345.615) (-344.981) [-344.767] -- 0:00:54
68500 -- (-344.085) [-348.471] (-344.550) (-346.046) * [-344.161] (-345.186) (-343.943) (-345.110) -- 0:00:54
69000 -- [-345.060] (-344.108) (-344.376) (-344.299) * (-346.671) (-343.759) (-345.168) [-344.256] -- 0:00:53
69500 -- [-344.044] (-344.645) (-346.737) (-343.525) * (-346.027) [-344.222] (-348.762) (-351.551) -- 0:00:53
70000 -- [-345.547] (-345.590) (-345.391) (-347.066) * [-346.663] (-345.675) (-343.460) (-345.361) -- 0:00:53
Average standard deviation of split frequencies: 0.025413
70500 -- [-344.605] (-346.660) (-344.136) (-349.320) * (-351.474) (-345.640) (-344.385) [-345.010] -- 0:00:52
71000 -- (-346.364) (-348.987) (-344.495) [-345.942] * [-349.698] (-344.023) (-346.500) (-344.871) -- 0:00:52
71500 -- (-349.363) (-350.499) [-345.183] (-345.112) * (-345.265) (-344.138) (-348.550) [-349.126] -- 0:00:51
72000 -- (-343.943) (-347.108) (-348.000) [-345.064] * [-348.185] (-347.101) (-345.489) (-351.803) -- 0:00:51
72500 -- [-343.453] (-347.903) (-347.499) (-345.868) * (-345.281) (-347.390) [-344.954] (-345.431) -- 0:01:03
73000 -- (-345.696) [-346.507] (-345.619) (-345.336) * (-345.823) [-345.326] (-344.711) (-345.776) -- 0:01:03
73500 -- (-346.518) (-344.176) [-343.931] (-343.971) * (-346.277) (-345.261) [-343.619] (-343.966) -- 0:01:03
74000 -- (-346.413) [-345.163] (-343.843) (-346.085) * (-344.353) (-345.771) (-344.410) [-344.422] -- 0:01:02
74500 -- (-345.833) (-345.120) [-344.228] (-344.539) * [-344.212] (-346.333) (-348.119) (-347.742) -- 0:01:02
75000 -- (-346.537) (-353.796) (-345.970) [-344.517] * [-345.426] (-346.140) (-347.474) (-346.505) -- 0:01:01
Average standard deviation of split frequencies: 0.024515
75500 -- (-345.604) (-352.254) (-346.099) [-345.089] * (-344.570) [-344.671] (-346.474) (-343.788) -- 0:01:01
76000 -- (-344.313) (-345.865) [-345.387] (-344.435) * (-345.035) [-344.460] (-346.023) (-344.955) -- 0:01:00
76500 -- (-346.429) (-346.820) [-344.572] (-347.371) * [-344.782] (-347.249) (-346.235) (-344.924) -- 0:01:00
77000 -- [-343.993] (-343.475) (-344.092) (-347.943) * (-349.099) (-345.804) [-345.185] (-347.676) -- 0:00:59
77500 -- (-345.197) (-344.384) [-344.591] (-346.127) * (-345.569) (-343.919) (-349.078) [-345.625] -- 0:00:59
78000 -- (-344.928) (-346.595) [-344.813] (-345.546) * [-343.967] (-345.807) (-345.694) (-346.802) -- 0:00:59
78500 -- [-343.181] (-343.666) (-344.564) (-345.779) * [-344.104] (-346.661) (-346.993) (-345.307) -- 0:00:58
79000 -- (-344.873) [-345.019] (-344.254) (-347.309) * (-345.376) (-345.339) [-346.970] (-346.238) -- 0:00:58
79500 -- (-346.700) (-345.015) (-346.270) [-343.789] * (-344.686) (-344.684) [-345.381] (-344.728) -- 0:00:57
80000 -- (-348.863) (-344.662) [-347.608] (-344.866) * (-344.783) (-346.079) [-344.669] (-347.368) -- 0:00:57
Average standard deviation of split frequencies: 0.023083
80500 -- [-344.033] (-345.401) (-347.029) (-345.650) * [-343.190] (-344.112) (-344.830) (-346.346) -- 0:00:57
81000 -- (-346.839) (-344.802) [-345.314] (-345.925) * (-345.220) [-344.739] (-345.036) (-345.289) -- 0:00:56
81500 -- (-346.705) (-344.886) [-346.915] (-345.789) * (-344.423) (-343.386) [-345.052] (-344.218) -- 0:00:56
82000 -- (-344.466) (-344.217) [-344.220] (-346.684) * (-345.188) (-348.723) [-345.424] (-347.050) -- 0:00:55
82500 -- (-345.896) [-343.870] (-344.691) (-349.145) * (-344.960) (-352.692) (-344.081) [-344.369] -- 0:00:55
83000 -- [-344.630] (-345.389) (-344.557) (-345.414) * [-345.668] (-351.596) (-345.267) (-343.561) -- 0:00:55
83500 -- [-343.879] (-346.873) (-345.658) (-343.907) * (-343.889) [-346.521] (-346.102) (-345.143) -- 0:00:54
84000 -- (-343.841) (-343.300) (-347.346) [-345.667] * (-348.803) [-345.866] (-347.506) (-347.075) -- 0:00:54
84500 -- (-344.034) (-345.245) [-346.143] (-345.878) * (-344.917) [-343.777] (-346.087) (-344.350) -- 0:00:54
85000 -- [-343.907] (-344.783) (-345.249) (-345.684) * (-343.289) (-345.341) [-344.075] (-345.140) -- 0:00:53
Average standard deviation of split frequencies: 0.026102
85500 -- (-344.297) (-346.148) (-345.976) [-349.480] * (-344.099) (-344.928) [-346.120] (-346.648) -- 0:00:53
86000 -- (-344.950) [-347.124] (-345.662) (-348.746) * (-349.326) (-344.856) (-345.103) [-344.960] -- 0:00:53
86500 -- (-343.262) (-345.049) (-344.557) [-346.785] * (-346.263) (-346.470) [-345.004] (-349.571) -- 0:00:52
87000 -- (-345.258) (-345.891) (-347.297) [-345.077] * (-346.876) (-345.172) [-345.824] (-343.874) -- 0:00:52
87500 -- (-344.491) (-345.123) (-343.560) [-344.809] * (-344.277) (-344.590) (-345.914) [-346.127] -- 0:00:52
88000 -- [-344.374] (-346.060) (-345.012) (-354.741) * [-345.480] (-344.627) (-348.888) (-344.647) -- 0:00:51
88500 -- [-345.058] (-344.341) (-347.031) (-346.675) * (-343.257) [-349.710] (-343.905) (-346.603) -- 0:00:51
89000 -- (-344.236) (-346.502) [-348.248] (-344.898) * (-343.854) [-343.956] (-344.063) (-345.657) -- 0:00:51
89500 -- (-347.508) (-351.086) (-345.996) [-345.039] * (-346.033) (-345.845) [-343.901] (-343.860) -- 0:00:50
90000 -- (-344.653) (-349.111) (-346.657) [-345.953] * [-346.096] (-344.050) (-349.355) (-347.551) -- 0:01:00
Average standard deviation of split frequencies: 0.024815
90500 -- (-343.865) (-345.269) (-344.377) [-345.238] * (-345.675) (-346.143) [-347.425] (-348.065) -- 0:01:00
91000 -- (-344.825) [-346.190] (-346.394) (-343.719) * (-345.169) (-346.708) [-343.957] (-343.963) -- 0:00:59
91500 -- (-346.408) (-344.906) (-347.280) [-345.277] * [-346.137] (-344.082) (-343.658) (-349.131) -- 0:00:59
92000 -- (-346.223) (-344.334) (-345.046) [-345.512] * [-346.468] (-346.860) (-346.897) (-346.490) -- 0:00:59
92500 -- (-346.363) (-344.523) [-345.959] (-346.331) * (-347.214) (-346.701) [-345.327] (-344.323) -- 0:00:58
93000 -- (-345.552) (-345.622) (-343.368) [-345.535] * (-343.377) [-346.001] (-346.533) (-346.107) -- 0:00:58
93500 -- (-343.949) (-347.764) (-344.692) [-349.071] * (-345.160) [-347.119] (-343.415) (-345.288) -- 0:00:58
94000 -- (-344.194) [-344.796] (-345.986) (-345.530) * (-344.307) (-346.370) (-346.338) [-345.215] -- 0:00:57
94500 -- (-344.038) (-349.437) (-345.381) [-343.823] * (-344.870) (-345.141) (-347.243) [-343.824] -- 0:00:57
95000 -- (-344.990) (-345.617) (-344.478) [-345.685] * (-345.426) (-346.739) [-345.250] (-345.937) -- 0:00:57
Average standard deviation of split frequencies: 0.024786
95500 -- (-344.257) [-343.763] (-343.913) (-345.262) * (-346.421) [-345.413] (-345.344) (-345.434) -- 0:00:56
96000 -- (-350.372) [-343.282] (-344.583) (-345.171) * (-345.858) (-344.039) [-343.481] (-346.725) -- 0:00:56
96500 -- (-349.552) [-344.553] (-351.098) (-345.021) * (-346.389) [-344.070] (-348.151) (-347.827) -- 0:00:56
97000 -- (-344.695) (-346.114) (-349.675) [-346.436] * (-345.427) [-343.912] (-347.640) (-349.724) -- 0:00:55
97500 -- (-347.868) (-345.618) [-345.086] (-348.991) * (-345.332) (-347.767) (-345.562) [-344.459] -- 0:00:55
98000 -- (-347.329) [-345.564] (-345.300) (-343.982) * (-346.322) (-345.734) [-344.015] (-345.827) -- 0:00:55
98500 -- (-350.308) (-345.448) [-348.598] (-347.318) * (-344.238) (-343.939) [-343.491] (-345.443) -- 0:00:54
99000 -- (-344.212) [-348.102] (-346.773) (-345.224) * (-346.701) [-344.666] (-344.801) (-344.299) -- 0:00:54
99500 -- [-343.785] (-345.902) (-344.848) (-346.055) * (-346.456) (-346.189) (-349.397) [-347.287] -- 0:00:54
100000 -- (-344.368) (-345.124) (-344.243) [-344.146] * (-346.586) [-345.650] (-347.599) (-349.943) -- 0:00:54
Average standard deviation of split frequencies: 0.025053
100500 -- (-343.209) [-343.707] (-347.057) (-344.915) * (-345.795) (-343.892) (-343.358) [-343.895] -- 0:00:53
101000 -- [-344.112] (-344.767) (-345.262) (-347.165) * (-353.320) [-345.403] (-344.171) (-347.577) -- 0:00:53
101500 -- (-344.959) (-348.946) (-345.139) [-345.568] * (-344.184) (-344.472) (-346.728) [-347.965] -- 0:00:53
102000 -- (-345.115) (-348.149) (-343.242) [-347.490] * (-347.805) (-343.507) [-343.824] (-347.008) -- 0:00:52
102500 -- (-346.263) (-346.228) [-344.595] (-353.164) * (-345.673) (-346.694) [-343.622] (-344.178) -- 0:00:52
103000 -- (-345.579) (-344.373) [-346.011] (-352.830) * [-349.415] (-345.653) (-346.254) (-346.077) -- 0:00:52
103500 -- [-343.893] (-344.639) (-345.490) (-344.264) * (-346.805) (-344.946) (-344.274) [-344.879] -- 0:00:51
104000 -- (-346.063) [-344.804] (-345.132) (-345.438) * [-346.083] (-347.492) (-346.190) (-349.518) -- 0:00:51
104500 -- (-346.439) (-347.968) (-344.491) [-345.838] * (-345.387) [-346.846] (-346.919) (-344.107) -- 0:00:51
105000 -- (-345.911) (-344.508) [-344.064] (-345.058) * (-344.520) (-344.441) (-346.362) [-346.207] -- 0:00:51
Average standard deviation of split frequencies: 0.024354
105500 -- [-348.874] (-348.088) (-344.180) (-349.326) * [-346.481] (-344.305) (-344.864) (-346.926) -- 0:00:50
106000 -- (-346.574) (-345.467) (-345.228) [-345.538] * (-346.124) [-344.038] (-347.558) (-343.728) -- 0:00:50
106500 -- (-345.151) (-343.482) (-347.581) [-346.745] * (-348.139) [-345.566] (-347.810) (-346.446) -- 0:00:58
107000 -- (-345.636) [-345.295] (-343.989) (-348.493) * [-345.387] (-345.366) (-344.026) (-344.137) -- 0:00:58
107500 -- (-344.885) (-344.000) (-343.627) [-347.291] * [-345.262] (-350.717) (-343.771) (-346.946) -- 0:00:58
108000 -- (-345.141) (-347.415) [-344.584] (-347.267) * [-346.083] (-349.168) (-344.287) (-344.305) -- 0:00:57
108500 -- (-344.208) (-349.673) (-343.987) [-344.809] * (-345.665) (-348.907) (-347.344) [-345.496] -- 0:00:57
109000 -- (-345.500) (-349.011) (-347.329) [-346.577] * (-345.445) (-349.273) (-346.087) [-344.508] -- 0:00:57
109500 -- (-345.105) (-344.569) [-344.466] (-345.593) * [-345.022] (-347.455) (-344.618) (-346.493) -- 0:00:56
110000 -- (-345.389) (-346.466) [-345.151] (-346.048) * (-344.251) (-347.650) (-346.349) [-345.018] -- 0:00:56
Average standard deviation of split frequencies: 0.021747
110500 -- (-343.812) (-344.535) (-347.131) [-345.244] * (-345.102) (-347.753) [-344.685] (-343.360) -- 0:00:56
111000 -- (-343.504) [-344.980] (-347.335) (-344.907) * (-346.515) [-345.146] (-349.079) (-347.223) -- 0:00:56
111500 -- (-345.063) [-345.872] (-348.385) (-345.674) * [-348.066] (-352.101) (-347.894) (-347.421) -- 0:00:55
112000 -- (-344.140) [-347.658] (-345.200) (-347.462) * (-349.179) [-349.504] (-345.590) (-344.119) -- 0:00:55
112500 -- (-348.156) (-346.825) (-346.369) [-346.886] * (-345.436) [-346.225] (-344.849) (-347.127) -- 0:00:55
113000 -- (-346.742) (-345.388) [-343.698] (-345.933) * (-344.793) [-345.430] (-346.506) (-345.516) -- 0:00:54
113500 -- [-344.417] (-349.028) (-344.038) (-344.661) * (-343.425) (-345.989) (-346.966) [-344.647] -- 0:00:54
114000 -- (-344.026) (-347.242) (-345.963) [-348.910] * (-344.447) (-344.853) [-344.665] (-346.755) -- 0:00:54
114500 -- (-345.159) (-348.598) (-346.801) [-346.450] * [-343.760] (-346.652) (-347.438) (-345.177) -- 0:00:54
115000 -- [-344.647] (-344.106) (-349.450) (-345.789) * [-344.057] (-345.386) (-343.910) (-347.153) -- 0:00:53
Average standard deviation of split frequencies: 0.021222
115500 -- [-344.164] (-343.885) (-345.741) (-349.775) * (-344.404) (-343.947) [-345.813] (-347.505) -- 0:00:53
116000 -- (-347.933) [-346.417] (-345.364) (-346.680) * (-345.467) (-346.540) (-344.776) [-345.778] -- 0:00:53
116500 -- (-351.100) (-346.951) [-343.729] (-343.107) * (-345.337) (-345.986) (-347.096) [-345.884] -- 0:00:53
117000 -- (-345.708) (-344.800) [-345.639] (-344.819) * (-344.925) (-345.498) (-344.956) [-345.304] -- 0:00:52
117500 -- [-346.508] (-343.994) (-344.782) (-347.206) * (-346.343) (-345.779) (-344.956) [-345.792] -- 0:00:52
118000 -- (-345.456) (-348.144) [-348.090] (-349.581) * (-346.862) (-343.847) (-345.949) [-345.435] -- 0:00:52
118500 -- (-346.251) (-344.926) [-346.155] (-344.606) * [-344.653] (-348.689) (-347.496) (-347.049) -- 0:00:52
119000 -- (-343.173) [-352.299] (-346.361) (-347.499) * (-344.692) (-355.222) [-347.238] (-343.640) -- 0:00:51
119500 -- (-347.334) (-344.613) (-345.646) [-343.721] * (-345.855) [-349.461] (-347.757) (-343.914) -- 0:00:51
120000 -- (-344.824) [-345.814] (-346.484) (-343.236) * (-345.823) (-346.445) (-345.620) [-346.095] -- 0:00:51
Average standard deviation of split frequencies: 0.018711
120500 -- (-345.462) (-345.198) (-346.065) [-344.802] * (-345.369) (-345.005) [-345.204] (-344.605) -- 0:00:51
121000 -- (-344.624) [-343.418] (-345.371) (-348.520) * [-344.948] (-345.222) (-349.531) (-344.660) -- 0:00:50
121500 -- (-346.250) (-344.810) (-344.231) [-344.421] * [-345.711] (-347.178) (-346.073) (-345.084) -- 0:00:50
122000 -- (-344.913) [-344.139] (-345.264) (-345.062) * (-346.198) (-346.048) [-344.992] (-345.205) -- 0:00:50
122500 -- (-344.013) (-343.748) (-347.973) [-345.490] * [-344.679] (-345.413) (-346.222) (-345.624) -- 0:00:50
123000 -- (-344.073) [-343.531] (-346.897) (-343.895) * (-344.984) [-344.865] (-348.334) (-345.304) -- 0:00:57
123500 -- (-344.038) (-346.534) (-345.150) [-349.379] * (-345.193) [-344.619] (-347.700) (-351.443) -- 0:00:56
124000 -- (-343.586) (-346.604) (-345.297) [-344.044] * (-348.421) [-344.783] (-343.614) (-344.812) -- 0:00:56
124500 -- [-346.907] (-347.553) (-344.518) (-344.736) * [-345.326] (-344.316) (-344.391) (-343.724) -- 0:00:56
125000 -- (-345.094) (-343.607) [-346.940] (-346.714) * (-346.046) [-344.082] (-345.096) (-343.456) -- 0:00:56
Average standard deviation of split frequencies: 0.020203
125500 -- (-345.274) [-345.443] (-344.156) (-346.987) * [-346.757] (-344.466) (-344.653) (-346.998) -- 0:00:55
126000 -- (-350.195) (-344.612) (-344.803) [-343.964] * (-345.564) (-345.880) [-343.932] (-344.608) -- 0:00:55
126500 -- (-344.727) [-345.782] (-348.464) (-345.944) * (-344.994) (-344.381) (-343.955) [-345.901] -- 0:00:55
127000 -- (-344.933) (-344.346) (-344.145) [-346.205] * (-346.390) (-345.417) (-347.808) [-344.646] -- 0:00:54
127500 -- [-344.064] (-348.413) (-345.578) (-345.605) * (-346.872) [-347.133] (-347.872) (-344.662) -- 0:00:54
128000 -- (-346.309) [-344.348] (-344.447) (-345.132) * (-345.314) (-349.432) (-343.937) [-344.626] -- 0:00:54
128500 -- (-343.670) (-345.461) [-344.623] (-346.748) * (-344.282) (-346.714) (-347.870) [-344.749] -- 0:00:54
129000 -- [-345.458] (-346.395) (-344.075) (-344.162) * [-345.573] (-345.625) (-345.336) (-345.490) -- 0:00:54
129500 -- (-344.379) (-344.892) [-344.648] (-347.495) * (-346.067) (-347.634) (-344.665) [-344.971] -- 0:00:53
130000 -- (-346.370) [-346.556] (-343.841) (-345.910) * (-347.536) (-344.209) [-343.730] (-344.919) -- 0:00:53
Average standard deviation of split frequencies: 0.020203
130500 -- [-344.650] (-347.091) (-345.700) (-346.255) * (-343.769) [-349.092] (-345.642) (-344.696) -- 0:00:53
131000 -- (-345.639) [-344.154] (-346.607) (-345.742) * (-346.047) [-349.451] (-343.198) (-345.333) -- 0:00:53
131500 -- [-345.894] (-352.381) (-346.965) (-345.060) * [-343.917] (-349.932) (-345.938) (-349.168) -- 0:00:52
132000 -- [-346.597] (-347.742) (-345.780) (-347.104) * [-343.127] (-346.783) (-344.074) (-346.051) -- 0:00:52
132500 -- (-346.019) (-344.633) (-347.885) [-345.717] * (-347.998) [-345.755] (-344.296) (-344.938) -- 0:00:52
133000 -- [-344.585] (-343.423) (-348.201) (-345.198) * [-345.756] (-345.707) (-343.831) (-343.392) -- 0:00:52
133500 -- [-344.100] (-347.751) (-347.132) (-349.309) * (-346.773) (-345.948) (-349.601) [-345.046] -- 0:00:51
134000 -- (-343.081) (-345.907) [-345.519] (-348.440) * (-350.092) [-344.583] (-345.066) (-344.557) -- 0:00:51
134500 -- (-344.080) (-346.414) (-344.084) [-344.628] * (-346.136) (-346.970) (-346.383) [-343.487] -- 0:00:51
135000 -- (-344.325) [-345.025] (-346.380) (-344.460) * (-348.807) [-345.075] (-351.482) (-343.775) -- 0:00:51
Average standard deviation of split frequencies: 0.019338
135500 -- [-344.200] (-344.268) (-350.146) (-345.055) * (-345.004) (-345.146) (-345.022) [-344.355] -- 0:00:51
136000 -- (-343.723) [-346.684] (-345.005) (-347.183) * (-344.094) [-346.958] (-344.266) (-344.652) -- 0:00:50
136500 -- [-343.890] (-344.475) (-344.972) (-347.099) * (-343.583) (-344.074) (-345.798) [-344.148] -- 0:00:50
137000 -- (-345.094) (-346.078) (-344.909) [-345.050] * (-346.414) (-347.132) [-345.818] (-343.803) -- 0:00:50
137500 -- (-343.987) (-344.520) (-344.738) [-343.671] * (-348.146) (-345.867) (-349.754) [-345.561] -- 0:00:50
138000 -- (-344.870) (-343.876) (-345.387) [-343.888] * (-347.532) (-345.340) (-344.980) [-346.173] -- 0:00:49
138500 -- (-344.446) (-345.305) (-346.634) [-344.088] * (-345.960) (-343.745) [-348.210] (-349.367) -- 0:00:55
139000 -- (-345.675) (-344.259) (-343.915) [-343.408] * (-346.732) (-344.467) (-348.657) [-345.947] -- 0:00:55
139500 -- (-346.228) (-343.523) (-345.139) [-345.682] * (-347.216) (-344.870) [-348.044] (-347.613) -- 0:00:55
140000 -- [-345.765] (-345.404) (-350.782) (-349.603) * (-346.847) (-345.298) [-346.144] (-345.567) -- 0:00:55
Average standard deviation of split frequencies: 0.021871
140500 -- [-344.514] (-343.992) (-346.279) (-345.399) * (-343.339) (-346.107) (-343.439) [-344.118] -- 0:00:55
141000 -- (-344.130) (-344.443) [-346.660] (-344.383) * (-344.366) (-347.096) [-344.250] (-343.469) -- 0:00:54
141500 -- [-343.877] (-347.115) (-350.872) (-343.401) * (-347.973) (-344.755) (-347.155) [-345.764] -- 0:00:54
142000 -- [-344.577] (-344.966) (-348.870) (-343.774) * [-344.860] (-344.395) (-348.231) (-347.847) -- 0:00:54
142500 -- [-345.779] (-344.249) (-350.379) (-344.366) * (-344.638) (-344.120) (-345.060) [-344.392] -- 0:00:54
143000 -- (-343.849) (-344.715) [-350.811] (-343.590) * (-343.448) (-344.351) [-344.388] (-346.541) -- 0:00:53
143500 -- (-351.160) (-344.489) (-344.516) [-345.230] * (-348.181) (-344.723) [-344.426] (-348.756) -- 0:00:53
144000 -- (-349.975) (-344.750) (-345.079) [-345.479] * [-349.970] (-345.807) (-344.543) (-348.456) -- 0:00:53
144500 -- (-352.555) (-343.467) [-345.226] (-347.536) * (-344.178) [-345.905] (-344.016) (-347.189) -- 0:00:53
145000 -- [-343.946] (-344.821) (-347.207) (-345.620) * (-346.410) (-346.414) [-346.902] (-349.080) -- 0:00:53
Average standard deviation of split frequencies: 0.022140
145500 -- [-344.224] (-347.834) (-348.428) (-344.903) * [-346.876] (-345.278) (-347.083) (-348.310) -- 0:00:52
146000 -- (-348.470) (-345.431) [-344.072] (-345.485) * (-344.976) [-345.459] (-345.219) (-343.495) -- 0:00:52
146500 -- (-349.605) [-345.841] (-348.776) (-344.732) * (-344.852) (-343.521) (-343.466) [-349.165] -- 0:00:52
147000 -- (-348.741) (-344.172) [-347.256] (-345.738) * (-347.483) [-343.511] (-344.992) (-346.039) -- 0:00:52
147500 -- [-353.082] (-345.629) (-343.308) (-346.687) * (-343.983) (-344.454) (-344.991) [-343.993] -- 0:00:52
148000 -- [-347.005] (-346.503) (-346.647) (-344.990) * (-346.484) (-344.813) [-344.801] (-347.523) -- 0:00:51
148500 -- (-346.107) (-348.098) (-344.099) [-348.523] * (-344.382) (-345.957) [-343.643] (-347.464) -- 0:00:51
149000 -- (-343.370) (-346.779) [-345.262] (-347.875) * [-343.708] (-344.202) (-343.122) (-350.830) -- 0:00:51
149500 -- (-343.818) (-344.933) (-346.539) [-345.319] * (-344.833) [-346.798] (-343.847) (-345.804) -- 0:00:51
150000 -- (-344.063) (-344.490) [-345.978] (-349.497) * [-345.233] (-343.910) (-345.448) (-347.115) -- 0:00:51
Average standard deviation of split frequencies: 0.021745
150500 -- [-344.637] (-345.592) (-348.939) (-345.803) * (-348.305) [-345.234] (-345.264) (-344.321) -- 0:00:50
151000 -- (-347.568) [-344.734] (-344.779) (-345.753) * (-345.492) (-344.650) [-345.475] (-344.334) -- 0:00:50
151500 -- [-345.369] (-346.825) (-346.763) (-344.557) * (-344.169) (-343.255) [-344.387] (-343.944) -- 0:00:50
152000 -- (-344.585) (-344.353) (-345.819) [-344.710] * [-344.447] (-344.129) (-344.769) (-343.901) -- 0:00:50
152500 -- (-345.845) [-344.611] (-348.137) (-345.051) * (-345.301) (-345.531) [-344.808] (-348.539) -- 0:00:55
153000 -- [-344.233] (-344.642) (-347.931) (-345.702) * (-346.693) [-344.645] (-346.389) (-346.986) -- 0:00:55
153500 -- (-343.475) (-344.632) (-348.240) [-344.332] * (-345.500) [-343.650] (-343.421) (-346.795) -- 0:00:55
154000 -- [-345.489] (-346.704) (-345.973) (-347.228) * (-347.405) (-345.168) [-345.581] (-345.361) -- 0:00:54
154500 -- [-343.360] (-346.753) (-347.634) (-347.300) * (-347.962) (-347.764) [-345.563] (-345.497) -- 0:00:54
155000 -- (-344.941) (-345.301) (-348.778) [-346.695] * (-345.304) (-347.164) [-347.248] (-345.573) -- 0:00:54
Average standard deviation of split frequencies: 0.020199
155500 -- (-344.119) [-344.393] (-345.180) (-345.275) * [-343.761] (-345.277) (-348.269) (-344.062) -- 0:00:54
156000 -- (-344.032) [-344.687] (-345.375) (-345.070) * (-347.033) [-345.850] (-348.988) (-345.716) -- 0:00:54
156500 -- [-343.535] (-343.697) (-346.389) (-344.669) * (-345.118) (-344.031) (-344.629) [-345.735] -- 0:00:53
157000 -- [-345.215] (-344.167) (-343.653) (-348.031) * (-346.923) [-343.284] (-347.476) (-345.340) -- 0:00:53
157500 -- (-345.397) (-344.528) [-344.300] (-348.073) * (-346.926) (-344.951) (-348.227) [-344.582] -- 0:00:53
158000 -- (-344.413) (-345.119) [-344.246] (-347.713) * [-346.100] (-347.576) (-345.671) (-346.921) -- 0:00:53
158500 -- (-346.760) (-346.170) [-344.100] (-348.646) * [-343.962] (-347.268) (-344.837) (-345.445) -- 0:00:53
159000 -- (-347.132) (-345.700) (-346.303) [-344.472] * (-343.666) [-344.690] (-344.959) (-344.169) -- 0:00:52
159500 -- (-344.981) [-344.596] (-348.190) (-345.266) * (-343.496) (-344.134) (-346.860) [-347.547] -- 0:00:52
160000 -- [-343.974] (-346.404) (-350.092) (-344.753) * (-344.499) [-344.407] (-346.732) (-344.913) -- 0:00:52
Average standard deviation of split frequencies: 0.020701
160500 -- (-345.082) (-344.554) [-354.173] (-343.962) * (-344.936) (-344.707) [-345.304] (-345.644) -- 0:00:52
161000 -- [-346.215] (-345.066) (-350.337) (-343.997) * (-343.468) (-343.999) (-346.870) [-344.386] -- 0:00:52
161500 -- (-346.916) (-352.507) (-345.464) [-348.014] * (-345.599) [-343.979] (-346.726) (-347.675) -- 0:00:51
162000 -- (-345.664) [-345.058] (-344.457) (-345.703) * (-346.265) (-346.783) (-347.447) [-345.914] -- 0:00:51
162500 -- (-346.740) (-343.309) [-344.083] (-345.316) * (-346.775) (-348.890) (-349.684) [-344.146] -- 0:00:51
163000 -- (-344.806) (-348.391) (-349.961) [-347.776] * (-344.087) (-345.767) [-345.459] (-345.394) -- 0:00:51
163500 -- (-347.491) (-345.587) (-346.623) [-343.822] * (-345.529) (-347.300) (-346.283) [-344.247] -- 0:00:51
164000 -- (-343.768) (-343.768) [-345.090] (-347.491) * (-344.179) (-347.932) (-347.144) [-346.798] -- 0:00:50
164500 -- (-347.243) (-349.589) (-346.616) [-346.117] * (-347.614) (-347.513) (-349.795) [-344.045] -- 0:00:50
165000 -- (-345.278) (-346.927) (-348.072) [-347.672] * (-345.286) [-346.286] (-343.870) (-350.268) -- 0:00:50
Average standard deviation of split frequencies: 0.021772
165500 -- (-343.910) (-350.765) (-344.562) [-345.452] * (-343.942) [-345.393] (-345.259) (-347.063) -- 0:00:50
166000 -- (-346.754) (-347.277) [-345.477] (-345.202) * (-348.184) [-347.024] (-347.571) (-348.970) -- 0:00:50
166500 -- [-346.861] (-344.323) (-345.456) (-347.989) * [-345.717] (-343.253) (-344.751) (-346.457) -- 0:00:55
167000 -- (-346.488) (-347.233) (-345.056) [-344.983] * (-345.063) [-343.384] (-343.996) (-345.251) -- 0:00:54
167500 -- (-343.881) [-344.219] (-344.830) (-345.641) * (-343.532) [-344.051] (-343.684) (-345.495) -- 0:00:54
168000 -- (-344.364) [-344.648] (-343.412) (-343.372) * [-344.323] (-343.451) (-347.688) (-347.740) -- 0:00:54
168500 -- (-344.933) [-343.451] (-345.044) (-346.596) * [-344.320] (-347.635) (-344.737) (-343.973) -- 0:00:54
169000 -- [-343.391] (-346.236) (-343.848) (-345.213) * [-346.093] (-346.378) (-346.460) (-343.863) -- 0:00:54
169500 -- [-345.176] (-346.028) (-344.195) (-346.629) * (-347.106) [-345.008] (-347.786) (-351.053) -- 0:00:53
170000 -- (-347.329) (-345.142) [-348.474] (-346.868) * (-345.253) [-351.087] (-343.882) (-345.752) -- 0:00:53
Average standard deviation of split frequencies: 0.019795
170500 -- [-345.007] (-343.183) (-343.141) (-346.181) * [-343.345] (-350.111) (-344.107) (-346.457) -- 0:00:53
171000 -- (-346.197) [-343.859] (-345.337) (-346.033) * (-344.539) (-348.081) (-344.255) [-346.042] -- 0:00:53
171500 -- (-345.429) [-343.498] (-347.475) (-348.203) * [-345.474] (-346.915) (-343.254) (-345.190) -- 0:00:53
172000 -- (-344.666) (-346.282) (-348.844) [-344.891] * (-345.109) (-347.412) [-343.922] (-347.058) -- 0:00:52
172500 -- (-344.029) (-345.712) [-345.936] (-344.258) * (-350.752) (-343.987) (-345.431) [-346.271] -- 0:00:52
173000 -- (-347.656) (-354.677) (-345.582) [-347.186] * (-345.266) [-345.098] (-344.556) (-345.844) -- 0:00:52
173500 -- (-343.820) (-348.310) [-347.619] (-346.083) * (-346.672) [-345.106] (-346.587) (-345.875) -- 0:00:52
174000 -- (-345.161) (-344.854) [-347.027] (-344.307) * [-345.108] (-345.297) (-350.138) (-349.626) -- 0:00:52
174500 -- (-343.273) (-345.100) (-347.470) [-347.291] * (-346.053) (-351.561) (-344.578) [-344.049] -- 0:00:52
175000 -- (-344.937) (-343.534) [-347.823] (-348.691) * [-347.148] (-347.382) (-348.908) (-346.994) -- 0:00:51
Average standard deviation of split frequencies: 0.020482
175500 -- (-348.638) [-345.908] (-346.485) (-345.850) * (-344.718) (-345.650) [-345.458] (-346.004) -- 0:00:51
176000 -- (-347.596) (-346.941) (-344.034) [-345.501] * (-346.472) (-343.767) [-344.428] (-345.910) -- 0:00:51
176500 -- (-344.431) (-345.716) (-345.937) [-345.944] * (-347.269) (-345.913) (-344.948) [-344.861] -- 0:00:51
177000 -- (-347.065) [-343.850] (-346.028) (-348.197) * [-347.771] (-345.999) (-343.712) (-344.585) -- 0:00:51
177500 -- (-344.419) (-346.013) [-344.567] (-345.199) * (-344.276) [-347.975] (-346.255) (-344.380) -- 0:00:50
178000 -- (-344.698) (-347.602) [-344.424] (-344.657) * (-344.665) (-345.337) (-346.560) [-345.544] -- 0:00:50
178500 -- (-345.249) (-345.502) [-344.268] (-345.952) * (-343.853) (-347.807) (-345.694) [-344.789] -- 0:00:50
179000 -- (-344.389) (-343.815) [-346.410] (-352.636) * (-345.736) (-350.792) (-344.116) [-345.277] -- 0:00:50
179500 -- (-345.751) (-346.042) (-349.907) [-345.161] * (-345.306) (-344.590) [-344.200] (-346.243) -- 0:00:50
180000 -- (-345.370) [-346.418] (-345.559) (-344.721) * [-347.992] (-343.929) (-346.609) (-347.834) -- 0:00:50
Average standard deviation of split frequencies: 0.020548
180500 -- (-345.640) (-348.178) [-345.720] (-347.747) * (-345.744) (-344.435) (-345.602) [-349.424] -- 0:00:49
181000 -- [-344.117] (-345.737) (-346.806) (-347.166) * (-346.549) [-344.521] (-344.727) (-348.827) -- 0:00:49
181500 -- (-343.625) [-349.232] (-347.330) (-348.529) * (-348.573) [-344.782] (-345.491) (-344.250) -- 0:00:54
182000 -- (-346.724) [-343.257] (-345.505) (-348.950) * (-346.805) (-345.608) [-345.707] (-346.050) -- 0:00:53
182500 -- (-343.867) [-346.097] (-344.960) (-344.270) * (-345.933) (-345.406) (-345.377) [-347.770] -- 0:00:53
183000 -- (-343.651) [-345.291] (-344.350) (-345.492) * (-348.416) [-346.304] (-345.669) (-344.642) -- 0:00:53
183500 -- (-347.634) [-345.947] (-346.846) (-350.883) * (-347.768) (-344.882) (-347.487) [-346.971] -- 0:00:53
184000 -- (-348.269) (-345.023) (-348.313) [-345.340] * (-345.854) (-345.142) (-345.339) [-349.666] -- 0:00:53
184500 -- (-345.283) (-344.549) [-347.326] (-343.825) * (-344.801) (-346.292) [-343.404] (-347.053) -- 0:00:53
185000 -- (-344.738) [-345.555] (-346.600) (-343.765) * [-345.252] (-344.956) (-349.503) (-344.762) -- 0:00:52
Average standard deviation of split frequencies: 0.017341
185500 -- [-346.728] (-347.748) (-345.580) (-343.335) * [-346.895] (-345.874) (-345.046) (-345.039) -- 0:00:52
186000 -- (-343.780) (-343.623) (-348.311) [-346.757] * (-350.463) (-348.453) [-348.348] (-345.807) -- 0:00:52
186500 -- (-344.217) (-343.356) (-348.535) [-345.883] * (-346.742) (-344.167) [-347.853] (-348.275) -- 0:00:52
187000 -- [-344.367] (-345.957) (-344.160) (-346.566) * [-346.357] (-344.711) (-350.820) (-345.473) -- 0:00:52
187500 -- [-345.877] (-345.388) (-345.552) (-347.173) * [-346.211] (-343.807) (-348.695) (-345.793) -- 0:00:52
188000 -- (-346.479) (-343.784) [-346.696] (-344.957) * [-345.358] (-344.483) (-347.449) (-348.370) -- 0:00:51
188500 -- [-344.984] (-344.728) (-343.995) (-346.246) * (-347.363) (-345.338) [-346.011] (-346.353) -- 0:00:51
189000 -- (-345.106) (-344.255) (-345.547) [-346.882] * (-349.419) (-344.655) (-347.692) [-344.893] -- 0:00:51
189500 -- (-344.813) [-344.961] (-345.223) (-344.709) * (-346.276) (-346.751) [-351.466] (-344.118) -- 0:00:51
190000 -- (-344.591) (-344.677) (-346.028) [-343.645] * (-344.338) [-344.139] (-345.915) (-346.257) -- 0:00:51
Average standard deviation of split frequencies: 0.017719
190500 -- (-345.386) (-345.598) (-344.752) [-343.357] * (-349.895) [-345.622] (-351.338) (-345.418) -- 0:00:50
191000 -- [-343.685] (-349.433) (-348.416) (-343.515) * (-347.100) (-344.199) [-347.642] (-344.384) -- 0:00:50
191500 -- [-343.634] (-345.007) (-343.242) (-344.699) * (-348.443) [-343.373] (-345.889) (-346.126) -- 0:00:50
192000 -- [-344.100] (-346.033) (-344.679) (-345.103) * (-345.231) (-343.804) [-343.671] (-345.521) -- 0:00:50
192500 -- (-346.079) (-346.048) [-344.296] (-350.453) * (-345.018) [-344.865] (-346.514) (-345.152) -- 0:00:50
193000 -- (-343.924) (-345.370) (-345.525) [-345.593] * (-345.170) [-344.332] (-345.441) (-345.198) -- 0:00:50
193500 -- [-344.147] (-347.385) (-344.282) (-345.181) * [-344.334] (-345.688) (-347.941) (-345.443) -- 0:00:50
194000 -- (-343.321) (-345.687) (-345.305) [-344.112] * (-343.938) [-345.952] (-346.526) (-343.986) -- 0:00:49
194500 -- (-349.168) (-344.693) (-344.746) [-344.386] * (-347.569) (-344.775) [-344.905] (-348.152) -- 0:00:49
195000 -- (-346.371) (-345.457) [-345.083] (-343.338) * (-345.200) (-346.055) (-344.603) [-344.825] -- 0:00:49
Average standard deviation of split frequencies: 0.017216
195500 -- (-345.261) (-345.359) [-343.931] (-345.646) * (-346.049) (-343.983) [-345.547] (-345.459) -- 0:00:49
196000 -- (-344.538) (-346.520) (-346.382) [-347.923] * (-345.869) (-344.832) [-343.772] (-348.568) -- 0:00:49
196500 -- (-346.345) [-347.060] (-345.768) (-345.613) * (-344.165) [-344.106] (-343.723) (-350.615) -- 0:00:49
197000 -- (-349.323) (-345.797) (-345.231) [-345.487] * (-344.466) (-347.283) (-344.731) [-344.838] -- 0:00:48
197500 -- (-346.257) [-345.058] (-344.290) (-345.606) * (-346.162) (-348.629) (-343.983) [-346.430] -- 0:00:48
198000 -- (-345.072) (-345.522) (-347.907) [-343.765] * (-347.023) [-344.586] (-346.927) (-349.606) -- 0:00:48
198500 -- (-343.605) [-346.968] (-345.397) (-347.123) * (-344.869) (-343.413) (-345.114) [-346.264] -- 0:00:52
199000 -- (-345.308) (-344.009) [-343.953] (-345.762) * (-343.956) (-344.767) [-346.043] (-348.945) -- 0:00:52
199500 -- (-346.287) (-346.590) [-344.347] (-346.613) * [-345.290] (-344.781) (-349.111) (-349.107) -- 0:00:52
200000 -- (-346.985) (-346.572) [-344.554] (-349.540) * (-348.154) [-345.622] (-346.573) (-347.203) -- 0:00:51
Average standard deviation of split frequencies: 0.017227
200500 -- (-351.838) [-346.690] (-345.418) (-347.348) * (-346.736) (-344.992) [-348.533] (-344.175) -- 0:00:51
201000 -- (-349.484) [-345.142] (-347.406) (-348.837) * (-343.630) (-345.869) (-344.728) [-345.619] -- 0:00:51
201500 -- (-347.892) (-346.895) [-345.016] (-346.568) * (-348.213) [-348.220] (-345.284) (-343.606) -- 0:00:51
202000 -- (-346.572) (-345.129) (-347.695) [-346.370] * (-345.130) (-344.816) [-344.330] (-344.908) -- 0:00:51
202500 -- (-346.147) [-343.706] (-344.656) (-346.810) * (-345.101) [-343.597] (-344.674) (-347.119) -- 0:00:51
203000 -- (-347.530) (-349.621) (-345.324) [-345.978] * [-344.920] (-344.545) (-347.573) (-345.580) -- 0:00:51
203500 -- (-343.981) (-345.469) (-346.514) [-346.130] * (-345.146) [-345.731] (-344.899) (-346.557) -- 0:00:50
204000 -- (-344.251) [-351.920] (-345.093) (-347.524) * (-344.292) (-344.032) (-353.751) [-347.459] -- 0:00:50
204500 -- (-345.168) [-348.478] (-345.175) (-344.703) * (-343.940) (-345.409) (-345.086) [-343.702] -- 0:00:50
205000 -- (-343.801) (-344.381) [-344.513] (-345.496) * [-345.196] (-344.768) (-351.300) (-346.998) -- 0:00:50
Average standard deviation of split frequencies: 0.015537
205500 -- (-345.131) [-343.851] (-346.675) (-344.921) * (-344.692) (-345.559) (-346.723) [-346.765] -- 0:00:50
206000 -- (-347.599) (-343.873) [-344.586] (-348.152) * (-345.740) (-348.080) (-350.095) [-347.444] -- 0:00:50
206500 -- (-345.430) (-346.468) [-343.576] (-346.582) * [-343.831] (-346.754) (-346.097) (-344.926) -- 0:00:49
207000 -- (-344.559) [-348.199] (-347.867) (-348.384) * (-343.896) [-346.413] (-348.362) (-346.000) -- 0:00:49
207500 -- [-343.588] (-343.974) (-344.717) (-347.601) * [-344.447] (-346.488) (-347.813) (-344.908) -- 0:00:49
208000 -- (-343.352) (-343.694) [-344.246] (-345.685) * [-344.330] (-345.765) (-347.223) (-344.971) -- 0:00:49
208500 -- [-345.302] (-347.338) (-346.659) (-346.753) * [-344.674] (-346.570) (-344.604) (-345.586) -- 0:00:49
209000 -- (-344.524) (-346.346) [-344.900] (-346.672) * (-343.668) [-347.211] (-353.530) (-344.193) -- 0:00:49
209500 -- (-346.557) (-350.364) [-346.364] (-347.103) * (-344.315) (-346.924) (-345.570) [-344.206] -- 0:00:49
210000 -- (-344.739) (-344.392) (-346.627) [-347.118] * (-343.376) (-345.501) [-345.426] (-343.695) -- 0:00:48
Average standard deviation of split frequencies: 0.016322
210500 -- (-345.062) (-345.378) [-345.303] (-350.206) * [-344.934] (-345.026) (-345.840) (-345.056) -- 0:00:48
211000 -- (-346.258) (-345.135) (-343.693) [-344.964] * (-344.946) [-343.479] (-344.968) (-346.473) -- 0:00:48
211500 -- [-348.723] (-345.881) (-345.459) (-344.244) * (-344.845) (-345.191) [-344.131] (-347.271) -- 0:00:48
212000 -- [-343.683] (-346.172) (-345.696) (-345.672) * (-346.972) [-347.300] (-344.039) (-346.309) -- 0:00:48
212500 -- [-345.599] (-344.553) (-346.923) (-344.058) * (-345.996) (-345.444) [-343.940] (-346.627) -- 0:00:48
213000 -- (-345.280) [-347.154] (-345.589) (-343.949) * (-345.435) [-348.354] (-344.752) (-347.285) -- 0:00:48
213500 -- (-347.095) (-345.169) (-346.381) [-344.234] * (-346.304) (-347.811) [-344.583] (-345.929) -- 0:00:47
214000 -- (-343.581) [-343.800] (-345.865) (-344.632) * [-348.627] (-344.531) (-343.522) (-348.047) -- 0:00:47
214500 -- (-346.539) (-348.264) [-346.996] (-345.082) * (-345.124) [-346.248] (-345.315) (-346.630) -- 0:00:47
215000 -- (-345.731) [-346.120] (-344.211) (-345.940) * (-345.841) [-344.935] (-343.566) (-346.887) -- 0:00:47
Average standard deviation of split frequencies: 0.016432
215500 -- (-343.447) [-346.462] (-343.658) (-343.661) * [-343.859] (-345.106) (-344.116) (-347.268) -- 0:00:50
216000 -- (-343.938) (-348.198) [-345.059] (-343.518) * [-346.121] (-343.578) (-346.661) (-343.959) -- 0:00:50
216500 -- (-344.130) (-344.841) [-345.932] (-345.063) * (-350.258) [-343.614] (-346.239) (-345.735) -- 0:00:50
217000 -- (-346.618) (-345.461) (-354.843) [-344.382] * (-345.337) (-345.201) [-346.781] (-345.317) -- 0:00:50
217500 -- (-345.094) (-345.913) [-343.975] (-350.075) * (-348.232) (-345.894) (-349.049) [-344.163] -- 0:00:50
218000 -- (-347.290) [-344.643] (-345.016) (-346.505) * (-344.491) (-345.229) [-343.376] (-343.955) -- 0:00:50
218500 -- (-347.700) (-344.884) [-345.285] (-344.079) * (-350.681) (-343.386) [-345.888] (-345.736) -- 0:00:50
219000 -- (-346.608) (-346.094) (-347.359) [-345.536] * [-348.428] (-343.430) (-343.774) (-345.751) -- 0:00:49
219500 -- [-345.366] (-344.526) (-345.516) (-343.114) * [-345.119] (-345.069) (-348.963) (-347.549) -- 0:00:49
220000 -- (-345.076) (-345.798) [-344.121] (-343.910) * [-343.781] (-347.379) (-345.342) (-344.130) -- 0:00:49
Average standard deviation of split frequencies: 0.016965
220500 -- [-347.280] (-346.580) (-347.710) (-344.489) * (-346.209) [-343.644] (-343.543) (-345.561) -- 0:00:49
221000 -- (-344.218) [-347.973] (-346.052) (-344.851) * (-347.218) (-347.745) [-347.793] (-343.792) -- 0:00:49
221500 -- [-343.122] (-345.670) (-344.694) (-344.850) * (-344.724) [-346.930] (-344.815) (-345.081) -- 0:00:49
222000 -- (-343.934) (-346.942) (-344.994) [-344.136] * (-345.494) (-344.421) (-346.161) [-345.445] -- 0:00:49
222500 -- [-347.856] (-346.522) (-346.444) (-343.805) * (-345.285) (-345.363) [-344.672] (-346.292) -- 0:00:48
223000 -- (-347.486) [-347.816] (-346.214) (-348.181) * [-343.808] (-346.414) (-343.188) (-346.762) -- 0:00:48
223500 -- [-344.856] (-349.421) (-347.151) (-347.375) * [-344.149] (-346.569) (-344.621) (-348.765) -- 0:00:48
224000 -- (-343.605) (-349.884) (-344.579) [-343.498] * [-344.806] (-347.019) (-344.451) (-344.305) -- 0:00:48
224500 -- (-345.711) (-348.850) (-347.271) [-343.965] * [-343.540] (-348.970) (-345.640) (-345.458) -- 0:00:48
225000 -- (-344.473) (-348.808) [-347.621] (-344.502) * (-347.305) (-347.737) [-343.659] (-345.642) -- 0:00:48
Average standard deviation of split frequencies: 0.015951
225500 -- [-343.776] (-348.692) (-345.079) (-345.061) * [-344.460] (-345.767) (-343.374) (-346.044) -- 0:00:48
226000 -- (-343.766) (-343.104) [-346.637] (-346.671) * (-347.134) (-344.359) (-343.645) [-344.892] -- 0:00:47
226500 -- (-343.961) (-343.863) [-345.442] (-344.605) * [-344.801] (-351.443) (-344.916) (-346.381) -- 0:00:47
227000 -- [-343.796] (-344.066) (-344.363) (-345.348) * (-346.366) (-344.910) (-345.926) [-344.928] -- 0:00:47
227500 -- (-346.415) (-345.823) (-344.451) [-345.016] * (-344.426) [-345.014] (-349.024) (-345.349) -- 0:00:47
228000 -- (-347.183) (-346.355) (-344.277) [-348.614] * (-343.523) (-346.022) [-343.858] (-345.470) -- 0:00:47
228500 -- (-347.480) (-344.058) (-347.415) [-345.595] * (-345.495) (-345.315) (-344.750) [-345.062] -- 0:00:47
229000 -- [-346.139] (-345.245) (-343.923) (-346.837) * (-344.522) (-346.627) [-345.690] (-344.093) -- 0:00:47
229500 -- (-347.804) (-345.217) (-344.306) [-344.727] * (-344.688) (-351.003) (-347.607) [-343.123] -- 0:00:47
230000 -- (-348.366) (-347.929) (-345.268) [-345.261] * (-346.915) [-344.929] (-344.787) (-343.316) -- 0:00:46
Average standard deviation of split frequencies: 0.015508
230500 -- (-346.112) (-345.715) [-345.478] (-343.633) * (-346.627) (-343.616) (-345.841) [-343.579] -- 0:00:46
231000 -- (-350.116) (-343.856) (-343.801) [-346.376] * (-343.790) [-346.090] (-345.934) (-345.042) -- 0:00:46
231500 -- (-350.735) (-343.718) [-346.933] (-348.418) * (-343.071) (-346.507) (-346.114) [-344.731] -- 0:00:46
232000 -- (-346.591) [-347.521] (-345.796) (-344.469) * (-343.315) (-348.706) (-344.329) [-344.544] -- 0:00:46
232500 -- (-345.299) (-344.569) (-346.172) [-346.365] * (-344.113) [-344.827] (-345.719) (-345.050) -- 0:00:46
233000 -- (-344.573) (-344.550) (-344.370) [-344.500] * (-344.637) [-344.341] (-345.542) (-343.602) -- 0:00:49
233500 -- (-346.548) (-345.093) [-344.025] (-345.107) * (-349.079) [-348.049] (-347.037) (-344.572) -- 0:00:49
234000 -- (-349.641) (-346.851) (-343.850) [-344.269] * (-344.741) (-343.958) [-346.662] (-345.002) -- 0:00:49
234500 -- (-346.627) [-346.446] (-343.906) (-346.202) * (-345.271) (-343.853) [-343.654] (-346.047) -- 0:00:48
235000 -- (-346.101) [-346.188] (-343.371) (-344.567) * (-347.371) [-348.122] (-345.863) (-346.386) -- 0:00:48
Average standard deviation of split frequencies: 0.016215
235500 -- (-347.313) (-343.534) [-343.732] (-345.619) * [-345.485] (-349.785) (-344.533) (-343.963) -- 0:00:48
236000 -- (-346.674) [-345.723] (-343.411) (-344.251) * (-346.483) (-345.116) [-343.302] (-347.458) -- 0:00:48
236500 -- (-345.802) (-344.866) [-343.068] (-346.340) * [-346.757] (-352.013) (-347.197) (-347.731) -- 0:00:48
237000 -- (-344.049) (-349.292) (-345.069) [-346.651] * [-345.186] (-350.378) (-345.708) (-348.584) -- 0:00:48
237500 -- (-345.184) (-344.887) [-344.741] (-347.025) * (-343.834) [-343.793] (-344.111) (-349.132) -- 0:00:48
238000 -- (-344.215) (-345.446) [-343.560] (-345.188) * (-343.974) (-346.554) [-345.436] (-347.463) -- 0:00:48
238500 -- (-345.691) (-345.654) (-343.599) [-344.171] * (-346.737) (-346.352) (-347.919) [-344.895] -- 0:00:47
239000 -- (-346.475) (-349.713) [-346.011] (-344.800) * (-344.334) (-347.231) (-346.426) [-346.719] -- 0:00:47
239500 -- (-346.505) (-348.972) [-349.070] (-345.555) * [-344.587] (-344.204) (-344.308) (-349.430) -- 0:00:47
240000 -- (-344.237) (-344.018) [-345.977] (-345.126) * [-343.905] (-344.957) (-352.320) (-346.614) -- 0:00:47
Average standard deviation of split frequencies: 0.015670
240500 -- (-343.659) [-343.583] (-344.532) (-343.513) * (-344.417) (-345.467) [-347.242] (-346.691) -- 0:00:47
241000 -- (-345.934) (-344.462) (-343.917) [-346.564] * (-344.276) (-347.620) (-344.213) [-343.642] -- 0:00:47
241500 -- (-345.369) [-345.429] (-345.542) (-347.537) * (-347.149) (-343.676) [-345.334] (-343.298) -- 0:00:47
242000 -- (-344.189) (-345.293) [-345.489] (-346.599) * (-346.893) (-344.021) (-344.823) [-348.044] -- 0:00:46
242500 -- [-344.647] (-343.609) (-345.187) (-344.019) * (-344.089) [-344.753] (-345.428) (-344.083) -- 0:00:46
243000 -- (-345.018) (-344.188) (-346.863) [-345.883] * [-344.262] (-345.786) (-345.664) (-346.030) -- 0:00:46
243500 -- (-343.581) [-345.281] (-346.295) (-345.874) * (-343.716) (-346.290) (-345.563) [-343.909] -- 0:00:46
244000 -- (-343.367) [-345.016] (-348.238) (-347.491) * (-347.041) [-344.346] (-344.466) (-347.840) -- 0:00:46
244500 -- [-345.191] (-343.332) (-347.858) (-347.037) * (-347.347) [-344.482] (-346.145) (-346.223) -- 0:00:46
245000 -- (-343.799) (-345.453) [-343.866] (-346.526) * [-344.897] (-349.093) (-346.367) (-346.003) -- 0:00:46
Average standard deviation of split frequencies: 0.015935
245500 -- (-344.015) [-345.962] (-344.987) (-346.117) * (-347.907) (-351.258) (-345.590) [-348.245] -- 0:00:46
246000 -- (-343.840) (-349.314) [-344.275] (-346.861) * (-345.310) [-344.720] (-344.075) (-345.156) -- 0:00:45
246500 -- (-343.697) (-347.656) [-345.532] (-346.948) * (-346.677) (-343.724) [-344.194] (-346.672) -- 0:00:45
247000 -- (-344.297) (-344.747) [-344.760] (-346.067) * (-347.426) [-348.577] (-344.393) (-346.663) -- 0:00:45
247500 -- (-347.096) [-343.327] (-344.425) (-344.384) * (-348.172) (-347.299) [-344.213] (-345.962) -- 0:00:45
248000 -- (-344.268) (-349.943) [-344.026] (-345.263) * [-343.740] (-344.601) (-349.408) (-347.397) -- 0:00:45
248500 -- (-345.703) (-346.724) (-344.151) [-347.158] * (-346.397) [-343.039] (-346.863) (-344.435) -- 0:00:45
249000 -- [-345.125] (-347.809) (-344.812) (-346.135) * (-345.224) (-343.707) [-346.917] (-346.347) -- 0:00:45
249500 -- (-346.932) [-344.367] (-345.146) (-344.992) * (-345.183) (-345.398) (-347.452) [-347.176] -- 0:00:45
250000 -- (-350.469) (-345.029) (-343.467) [-345.208] * (-346.645) (-344.859) [-343.252] (-346.539) -- 0:00:48
Average standard deviation of split frequencies: 0.015540
250500 -- (-348.345) (-344.251) [-346.806] (-345.392) * (-345.835) (-345.206) [-345.906] (-344.304) -- 0:00:47
251000 -- [-344.654] (-344.583) (-344.652) (-345.077) * (-344.625) (-348.685) (-344.725) [-343.478] -- 0:00:47
251500 -- (-345.163) (-347.926) [-344.599] (-344.777) * (-346.332) (-349.997) [-344.010] (-345.456) -- 0:00:47
252000 -- (-345.127) [-345.362] (-345.569) (-351.029) * [-344.032] (-346.038) (-344.957) (-345.649) -- 0:00:47
252500 -- (-347.347) (-349.315) (-344.440) [-346.537] * (-352.074) [-344.712] (-346.540) (-346.539) -- 0:00:47
253000 -- (-350.713) (-350.441) (-350.685) [-349.073] * (-346.481) [-345.227] (-352.241) (-357.696) -- 0:00:47
253500 -- (-349.057) [-344.788] (-346.997) (-345.967) * [-344.818] (-348.543) (-344.840) (-346.130) -- 0:00:47
254000 -- [-344.378] (-344.091) (-343.321) (-344.764) * [-346.334] (-353.284) (-343.483) (-346.105) -- 0:00:46
254500 -- (-345.693) [-346.516] (-344.850) (-345.383) * (-348.112) [-344.675] (-344.535) (-344.316) -- 0:00:46
255000 -- [-346.410] (-348.761) (-343.749) (-344.947) * (-345.861) (-344.278) (-344.294) [-347.323] -- 0:00:46
Average standard deviation of split frequencies: 0.014828
255500 -- (-343.864) (-353.620) (-344.243) [-343.666] * (-347.880) (-351.294) [-343.958] (-344.824) -- 0:00:46
256000 -- [-344.423] (-345.881) (-344.646) (-345.859) * (-346.003) [-345.990] (-344.386) (-345.208) -- 0:00:46
256500 -- (-345.144) (-346.890) (-347.272) [-344.496] * (-344.822) [-346.577] (-344.437) (-344.712) -- 0:00:46
257000 -- (-345.088) (-346.783) (-345.407) [-346.632] * (-350.824) (-351.836) (-343.806) [-346.333] -- 0:00:46
257500 -- [-345.115] (-345.150) (-343.887) (-344.376) * (-344.362) (-345.302) (-347.695) [-345.138] -- 0:00:46
258000 -- (-344.318) (-346.108) (-344.517) [-346.693] * (-344.327) (-345.978) [-346.542] (-351.704) -- 0:00:46
258500 -- (-343.525) [-349.196] (-349.040) (-346.078) * (-344.306) (-344.239) (-346.282) [-348.004] -- 0:00:45
259000 -- (-343.395) [-343.581] (-346.169) (-346.667) * (-345.458) [-344.178] (-348.838) (-345.613) -- 0:00:45
259500 -- (-343.965) (-345.434) [-349.172] (-343.495) * [-345.138] (-347.549) (-347.663) (-348.066) -- 0:00:45
260000 -- (-345.705) [-344.484] (-347.273) (-345.918) * (-345.483) (-344.975) [-346.212] (-344.500) -- 0:00:45
Average standard deviation of split frequencies: 0.013230
260500 -- (-344.044) [-344.254] (-347.785) (-344.728) * (-344.397) [-343.922] (-349.667) (-345.484) -- 0:00:45
261000 -- [-345.015] (-347.986) (-344.666) (-348.208) * [-345.021] (-345.060) (-346.960) (-348.209) -- 0:00:45
261500 -- (-347.328) (-348.125) (-343.224) [-345.019] * (-345.269) [-344.512] (-345.033) (-347.060) -- 0:00:45
262000 -- (-349.293) (-352.435) (-343.273) [-348.001] * (-346.014) (-344.223) [-345.261] (-345.042) -- 0:00:45
262500 -- [-345.549] (-345.996) (-346.263) (-348.469) * [-346.193] (-346.628) (-353.447) (-347.056) -- 0:00:44
263000 -- (-343.728) [-345.134] (-345.479) (-347.758) * [-345.787] (-347.446) (-347.335) (-346.587) -- 0:00:44
263500 -- (-345.436) [-343.555] (-348.600) (-350.192) * [-345.878] (-344.619) (-346.532) (-348.957) -- 0:00:44
264000 -- [-343.460] (-343.081) (-347.774) (-343.703) * (-347.124) (-345.560) (-347.115) [-344.804] -- 0:00:44
264500 -- (-344.392) (-343.148) [-345.679] (-344.607) * (-348.156) (-346.574) [-345.361] (-346.469) -- 0:00:44
265000 -- (-346.141) [-344.962] (-346.379) (-346.103) * (-344.008) (-348.059) (-345.743) [-346.500] -- 0:00:44
Average standard deviation of split frequencies: 0.012219
265500 -- [-347.173] (-343.600) (-344.695) (-344.582) * (-344.701) [-344.169] (-343.453) (-344.537) -- 0:00:44
266000 -- (-347.291) [-345.353] (-345.770) (-344.312) * (-344.488) (-345.719) (-344.637) [-345.496] -- 0:00:44
266500 -- (-345.537) [-346.766] (-343.958) (-347.746) * (-346.018) (-343.482) (-344.484) [-346.008] -- 0:00:46
267000 -- [-345.155] (-345.987) (-345.667) (-345.680) * (-345.970) [-348.948] (-344.700) (-346.137) -- 0:00:46
267500 -- (-346.535) (-345.319) [-345.479] (-344.714) * (-345.021) (-345.647) (-344.664) [-344.676] -- 0:00:46
268000 -- (-348.972) (-345.899) (-345.563) [-346.390] * (-345.770) (-345.444) [-345.804] (-345.197) -- 0:00:46
268500 -- (-349.002) (-343.897) [-343.806] (-346.309) * (-345.500) (-345.098) (-349.536) [-349.847] -- 0:00:46
269000 -- [-345.482] (-344.162) (-344.533) (-346.625) * (-349.809) (-347.638) (-349.780) [-346.298] -- 0:00:46
269500 -- (-345.075) [-344.693] (-350.754) (-348.741) * (-352.713) [-344.855] (-349.557) (-349.046) -- 0:00:46
270000 -- (-345.668) [-344.286] (-348.728) (-349.364) * (-348.252) [-344.165] (-347.068) (-347.243) -- 0:00:45
Average standard deviation of split frequencies: 0.012579
270500 -- [-345.727] (-345.023) (-345.231) (-348.545) * (-345.261) [-348.316] (-345.804) (-343.629) -- 0:00:45
271000 -- (-346.097) (-345.481) (-346.642) [-345.307] * (-349.344) [-344.481] (-345.518) (-345.674) -- 0:00:45
271500 -- [-345.262] (-345.058) (-349.478) (-344.477) * [-347.404] (-347.102) (-344.575) (-344.828) -- 0:00:45
272000 -- [-346.837] (-344.221) (-345.698) (-346.943) * (-345.941) (-343.737) [-344.624] (-345.997) -- 0:00:45
272500 -- (-347.282) (-343.836) [-346.202] (-345.403) * (-346.692) (-348.297) [-344.875] (-345.581) -- 0:00:45
273000 -- [-346.504] (-345.523) (-346.248) (-347.568) * [-347.656] (-345.205) (-344.011) (-350.659) -- 0:00:45
273500 -- (-345.696) (-346.669) (-344.341) [-346.124] * (-344.376) (-343.981) (-344.957) [-348.804] -- 0:00:45
274000 -- (-346.709) (-344.984) (-346.639) [-346.540] * (-343.805) (-345.034) (-345.376) [-343.351] -- 0:00:45
274500 -- (-344.990) (-344.937) (-344.592) [-347.795] * (-343.866) (-346.874) [-347.882] (-346.010) -- 0:00:44
275000 -- (-346.345) [-344.126] (-344.475) (-346.348) * [-343.625] (-344.486) (-347.652) (-347.443) -- 0:00:44
Average standard deviation of split frequencies: 0.012810
275500 -- (-351.513) (-346.755) [-344.732] (-344.110) * [-348.014] (-343.469) (-344.862) (-346.267) -- 0:00:44
276000 -- (-345.755) (-347.601) [-343.456] (-345.810) * [-345.250] (-347.583) (-344.816) (-347.884) -- 0:00:44
276500 -- (-345.032) (-344.737) [-345.858] (-345.495) * [-347.660] (-345.472) (-343.385) (-345.283) -- 0:00:44
277000 -- (-345.424) [-346.471] (-347.283) (-345.338) * (-348.099) [-348.657] (-350.436) (-345.397) -- 0:00:44
277500 -- [-344.592] (-346.162) (-345.151) (-345.039) * [-344.523] (-351.815) (-344.519) (-343.507) -- 0:00:44
278000 -- (-346.091) (-343.694) (-345.006) [-344.243] * [-347.916] (-346.625) (-345.607) (-344.499) -- 0:00:44
278500 -- [-345.011] (-344.863) (-344.441) (-346.842) * (-345.320) (-347.179) (-346.430) [-344.367] -- 0:00:44
279000 -- (-348.002) (-347.954) [-344.722] (-346.605) * (-344.106) (-345.732) (-349.100) [-344.214] -- 0:00:43
279500 -- (-345.537) [-343.398] (-346.293) (-346.879) * (-346.675) [-344.941] (-346.483) (-348.624) -- 0:00:43
280000 -- (-347.416) (-344.600) (-344.969) [-346.028] * (-346.854) (-343.967) [-344.256] (-345.245) -- 0:00:43
Average standard deviation of split frequencies: 0.012784
280500 -- (-347.920) (-346.743) (-343.509) [-345.609] * (-345.740) (-348.291) (-344.330) [-343.979] -- 0:00:43
281000 -- (-345.489) (-344.504) (-346.172) [-343.943] * (-347.539) (-345.428) (-345.793) [-344.172] -- 0:00:43
281500 -- (-346.219) [-344.396] (-345.808) (-345.622) * [-345.695] (-346.066) (-345.482) (-352.052) -- 0:00:43
282000 -- (-343.960) (-344.922) (-344.902) [-344.646] * [-344.588] (-344.213) (-344.128) (-348.459) -- 0:00:43
282500 -- [-347.236] (-345.935) (-346.895) (-343.814) * [-344.721] (-345.193) (-349.130) (-346.686) -- 0:00:43
283000 -- (-344.263) (-346.377) (-347.609) [-344.912] * [-343.425] (-346.668) (-343.855) (-347.250) -- 0:00:45
283500 -- (-343.233) (-347.318) [-345.148] (-343.584) * (-344.963) (-345.868) (-343.850) [-344.618] -- 0:00:45
284000 -- (-344.889) (-347.747) (-347.896) [-344.778] * (-345.077) (-344.883) [-343.688] (-346.678) -- 0:00:45
284500 -- (-347.322) (-349.956) (-347.402) [-344.334] * (-343.430) (-347.623) [-345.935] (-345.267) -- 0:00:45
285000 -- (-344.428) (-345.394) (-346.721) [-344.401] * (-343.820) (-353.427) [-347.083] (-344.604) -- 0:00:45
Average standard deviation of split frequencies: 0.012492
285500 -- (-344.334) (-344.425) [-346.168] (-344.685) * (-349.277) [-343.643] (-347.619) (-347.903) -- 0:00:45
286000 -- [-344.061] (-345.522) (-344.835) (-347.796) * (-349.063) [-346.083] (-344.467) (-344.177) -- 0:00:44
286500 -- [-345.360] (-345.312) (-343.775) (-349.230) * [-345.503] (-348.618) (-345.257) (-344.919) -- 0:00:44
287000 -- (-352.053) (-345.138) [-343.647] (-344.884) * (-344.310) [-343.535] (-346.288) (-345.870) -- 0:00:44
287500 -- [-345.011] (-347.814) (-344.291) (-344.851) * (-345.204) (-345.265) (-345.225) [-347.180] -- 0:00:44
288000 -- (-352.008) (-348.458) [-347.828] (-347.153) * [-344.133] (-343.195) (-345.255) (-347.890) -- 0:00:44
288500 -- [-344.842] (-346.532) (-350.509) (-344.758) * [-343.992] (-344.870) (-345.844) (-345.748) -- 0:00:44
289000 -- [-349.033] (-344.663) (-345.588) (-346.980) * (-343.985) (-345.033) (-345.957) [-345.209] -- 0:00:44
289500 -- [-344.258] (-344.045) (-345.563) (-347.095) * (-345.859) (-345.128) (-347.602) [-344.137] -- 0:00:44
290000 -- (-343.638) [-344.556] (-345.547) (-345.577) * (-343.684) [-346.764] (-346.901) (-343.666) -- 0:00:44
Average standard deviation of split frequencies: 0.012035
290500 -- (-346.592) (-345.490) [-346.692] (-346.851) * (-345.702) (-346.152) (-344.725) [-344.254] -- 0:00:43
291000 -- [-344.721] (-344.289) (-347.552) (-343.830) * [-344.529] (-346.423) (-345.163) (-344.672) -- 0:00:43
291500 -- (-347.225) (-345.263) (-344.657) [-345.549] * [-345.610] (-344.413) (-344.450) (-344.217) -- 0:00:43
292000 -- (-346.457) (-344.574) (-346.141) [-346.304] * (-346.409) [-348.928] (-345.342) (-345.100) -- 0:00:43
292500 -- (-345.407) [-345.704] (-345.703) (-345.632) * (-344.571) (-345.755) (-347.889) [-345.395] -- 0:00:43
293000 -- (-346.648) (-347.483) [-345.372] (-345.659) * (-344.122) (-345.942) (-346.703) [-345.119] -- 0:00:43
293500 -- [-347.622] (-344.695) (-345.317) (-345.318) * (-344.647) (-347.289) [-345.966] (-344.921) -- 0:00:43
294000 -- (-352.119) (-346.540) (-345.236) [-345.365] * [-344.174] (-345.161) (-346.998) (-347.878) -- 0:00:43
294500 -- (-351.803) (-343.954) [-344.184] (-346.326) * [-345.138] (-344.260) (-347.909) (-344.629) -- 0:00:43
295000 -- (-346.907) (-350.755) (-344.343) [-348.503] * (-346.511) (-344.926) (-345.349) [-344.146] -- 0:00:43
Average standard deviation of split frequencies: 0.012272
295500 -- (-347.965) [-347.647] (-343.949) (-344.715) * (-347.097) [-344.740] (-344.745) (-344.580) -- 0:00:42
296000 -- (-350.407) (-346.379) [-344.518] (-345.326) * [-345.454] (-345.513) (-344.431) (-347.469) -- 0:00:42
296500 -- (-350.073) (-349.946) [-344.853] (-344.655) * (-346.906) [-345.039] (-348.162) (-347.010) -- 0:00:42
297000 -- [-344.513] (-345.396) (-343.791) (-344.610) * (-347.150) (-343.269) (-346.573) [-345.320] -- 0:00:42
297500 -- (-348.550) [-347.018] (-346.543) (-349.555) * (-350.917) [-344.370] (-344.742) (-346.417) -- 0:00:42
298000 -- (-350.066) [-344.469] (-347.117) (-345.614) * [-346.980] (-344.671) (-345.162) (-345.719) -- 0:00:42
298500 -- (-345.171) [-346.416] (-344.508) (-345.797) * [-345.943] (-344.716) (-346.167) (-350.012) -- 0:00:42
299000 -- (-346.463) [-346.351] (-344.861) (-345.225) * [-345.725] (-346.035) (-348.365) (-347.790) -- 0:00:44
299500 -- [-347.471] (-345.270) (-346.046) (-346.017) * (-344.865) (-344.966) (-348.619) [-344.845] -- 0:00:44
300000 -- (-346.999) [-348.376] (-349.465) (-344.861) * (-344.035) (-349.596) (-347.641) [-346.055] -- 0:00:44
Average standard deviation of split frequencies: 0.011672
300500 -- (-346.198) (-346.971) (-347.397) [-344.829] * (-345.196) [-348.679] (-348.501) (-344.249) -- 0:00:44
301000 -- (-344.219) [-347.494] (-345.257) (-345.244) * (-347.197) (-345.660) (-344.724) [-344.023] -- 0:00:44
301500 -- (-344.739) (-345.276) [-343.876] (-344.106) * (-345.187) (-347.609) [-345.724] (-345.457) -- 0:00:44
302000 -- [-344.967] (-343.599) (-344.031) (-343.536) * [-344.607] (-344.983) (-345.813) (-344.573) -- 0:00:43
302500 -- (-345.279) (-344.432) [-345.689] (-348.982) * [-344.993] (-348.414) (-344.826) (-344.189) -- 0:00:43
303000 -- [-347.906] (-345.005) (-345.760) (-344.687) * (-347.780) [-345.342] (-346.951) (-344.854) -- 0:00:43
303500 -- (-344.169) (-344.416) (-345.483) [-343.968] * (-350.354) (-344.664) [-345.089] (-347.936) -- 0:00:43
304000 -- (-344.901) (-349.947) [-345.167] (-346.761) * (-344.381) (-345.442) (-345.151) [-346.115] -- 0:00:43
304500 -- [-345.060] (-345.895) (-343.856) (-347.217) * (-344.056) (-345.160) (-343.729) [-348.737] -- 0:00:43
305000 -- (-343.652) (-343.735) [-345.281] (-344.843) * (-347.141) [-345.218] (-344.955) (-350.540) -- 0:00:43
Average standard deviation of split frequencies: 0.011896
305500 -- (-346.231) [-345.014] (-348.249) (-343.605) * [-344.743] (-345.415) (-350.665) (-349.669) -- 0:00:43
306000 -- (-350.049) [-343.327] (-344.103) (-345.054) * (-345.959) [-347.538] (-345.312) (-349.314) -- 0:00:43
306500 -- (-345.740) (-343.499) [-346.413] (-344.490) * (-346.204) (-346.910) [-345.791] (-344.706) -- 0:00:42
307000 -- (-347.843) [-345.738] (-346.313) (-344.424) * [-344.752] (-345.541) (-346.310) (-343.872) -- 0:00:42
307500 -- (-345.672) [-344.406] (-343.775) (-349.667) * (-347.978) (-344.192) (-343.914) [-343.464] -- 0:00:42
308000 -- (-354.881) (-344.484) [-347.519] (-347.459) * (-346.896) (-344.536) (-345.036) [-344.090] -- 0:00:42
308500 -- (-348.254) (-344.562) [-344.260] (-345.433) * [-344.397] (-343.626) (-344.843) (-344.738) -- 0:00:42
309000 -- [-345.684] (-344.670) (-346.953) (-348.868) * (-344.717) [-343.366] (-345.917) (-343.224) -- 0:00:42
309500 -- (-346.965) [-343.686] (-345.975) (-344.455) * (-345.940) [-344.091] (-345.146) (-343.856) -- 0:00:42
310000 -- (-345.639) [-345.393] (-343.691) (-344.810) * (-345.481) (-343.414) (-343.967) [-343.671] -- 0:00:42
Average standard deviation of split frequencies: 0.010941
310500 -- [-348.691] (-343.925) (-344.229) (-344.746) * (-343.840) (-346.471) [-346.822] (-345.368) -- 0:00:42
311000 -- [-347.523] (-345.201) (-344.602) (-346.704) * [-346.110] (-344.571) (-346.707) (-349.311) -- 0:00:42
311500 -- (-345.431) [-344.841] (-349.126) (-345.548) * (-346.361) (-343.656) [-344.842] (-347.313) -- 0:00:41
312000 -- (-346.302) (-352.741) (-346.350) [-346.387] * (-344.217) [-345.286] (-344.863) (-345.802) -- 0:00:41
312500 -- (-346.792) [-345.061] (-347.293) (-347.629) * (-344.128) (-346.933) [-344.796] (-347.132) -- 0:00:41
313000 -- (-345.495) [-347.024] (-346.337) (-346.327) * [-345.261] (-346.818) (-350.164) (-345.805) -- 0:00:41
313500 -- (-345.264) (-345.046) (-346.963) [-344.885] * (-343.455) [-348.069] (-345.854) (-346.548) -- 0:00:41
314000 -- (-344.135) (-347.375) (-344.280) [-343.590] * (-345.338) [-345.185] (-343.972) (-345.641) -- 0:00:43
314500 -- [-343.383] (-346.429) (-348.027) (-349.746) * [-343.870] (-345.114) (-346.628) (-345.052) -- 0:00:43
315000 -- (-345.441) [-346.604] (-343.462) (-347.807) * (-345.910) [-345.568] (-344.422) (-346.022) -- 0:00:43
Average standard deviation of split frequencies: 0.010028
315500 -- (-346.194) (-348.178) [-344.164] (-350.995) * (-347.841) [-348.065] (-347.903) (-348.583) -- 0:00:43
316000 -- (-345.953) (-344.247) [-344.805] (-343.938) * [-346.713] (-349.000) (-346.557) (-344.429) -- 0:00:43
316500 -- (-346.500) (-344.798) [-344.214] (-344.274) * [-344.365] (-344.722) (-344.506) (-346.366) -- 0:00:43
317000 -- (-344.559) (-344.992) [-346.978] (-345.421) * [-344.001] (-349.932) (-346.426) (-345.141) -- 0:00:43
317500 -- (-345.432) (-344.617) (-345.108) [-348.523] * (-345.388) (-343.852) (-345.203) [-343.327] -- 0:00:42
318000 -- (-343.357) (-345.323) (-343.285) [-348.827] * (-345.454) [-345.495] (-344.763) (-345.202) -- 0:00:42
318500 -- [-345.366] (-344.669) (-346.002) (-347.397) * (-343.383) (-345.060) [-343.978] (-343.631) -- 0:00:42
319000 -- (-344.089) (-344.457) (-345.385) [-346.284] * (-345.667) [-343.286] (-344.247) (-344.282) -- 0:00:42
319500 -- (-348.109) (-344.095) [-345.089] (-345.901) * [-346.251] (-347.225) (-346.372) (-346.194) -- 0:00:42
320000 -- (-345.868) (-348.539) (-344.535) [-346.244] * (-348.593) [-345.832] (-344.679) (-345.040) -- 0:00:42
Average standard deviation of split frequencies: 0.011142
320500 -- (-349.080) (-345.913) [-346.830] (-348.917) * [-345.825] (-346.594) (-344.513) (-349.102) -- 0:00:42
321000 -- (-345.562) [-345.401] (-345.281) (-343.618) * [-345.237] (-346.974) (-347.684) (-344.429) -- 0:00:42
321500 -- (-352.091) (-344.563) (-348.080) [-344.044] * (-344.524) (-344.939) (-346.409) [-346.319] -- 0:00:42
322000 -- (-346.976) (-344.376) (-345.312) [-344.013] * (-344.696) [-345.964] (-347.880) (-345.301) -- 0:00:42
322500 -- (-348.643) (-343.385) (-345.016) [-345.550] * (-344.133) (-345.486) (-345.593) [-344.933] -- 0:00:42
323000 -- (-344.315) (-343.457) [-346.564] (-346.936) * (-343.731) [-345.194] (-344.912) (-345.334) -- 0:00:41
323500 -- (-345.831) [-343.677] (-348.666) (-346.491) * (-344.178) (-345.005) (-346.064) [-345.140] -- 0:00:41
324000 -- (-345.736) (-343.324) (-349.805) [-345.502] * (-343.454) (-344.611) (-344.812) [-344.253] -- 0:00:41
324500 -- (-344.478) (-343.642) (-345.144) [-346.880] * (-344.682) (-344.986) [-343.806] (-345.701) -- 0:00:41
325000 -- (-344.355) [-344.309] (-344.524) (-348.020) * (-343.345) [-343.130] (-345.728) (-346.097) -- 0:00:41
Average standard deviation of split frequencies: 0.010579
325500 -- (-345.208) (-344.061) (-346.458) [-346.193] * (-344.906) (-344.671) (-343.429) [-345.213] -- 0:00:41
326000 -- [-343.374] (-344.649) (-347.992) (-344.751) * (-346.748) (-348.145) [-343.494] (-345.806) -- 0:00:41
326500 -- (-346.654) [-346.180] (-347.793) (-344.624) * (-347.493) (-343.819) [-343.621] (-344.194) -- 0:00:41
327000 -- (-344.378) (-345.353) (-347.987) [-344.930] * [-343.678] (-344.567) (-345.256) (-343.836) -- 0:00:41
327500 -- (-344.764) (-344.895) (-348.060) [-348.429] * [-345.214] (-345.385) (-345.918) (-344.150) -- 0:00:41
328000 -- (-348.452) (-344.314) [-347.766] (-346.261) * (-344.477) (-346.489) (-346.782) [-346.079] -- 0:00:40
328500 -- (-348.520) [-347.644] (-344.240) (-345.900) * (-344.223) (-346.204) [-344.011] (-347.072) -- 0:00:40
329000 -- [-345.348] (-346.145) (-344.266) (-344.501) * (-344.028) [-346.814] (-344.067) (-350.221) -- 0:00:40
329500 -- (-347.645) (-344.162) [-343.382] (-347.877) * [-345.115] (-344.531) (-344.618) (-346.451) -- 0:00:42
330000 -- (-344.846) (-344.145) [-344.501] (-347.081) * [-343.935] (-344.354) (-343.822) (-348.332) -- 0:00:42
Average standard deviation of split frequencies: 0.011330
330500 -- (-344.003) (-346.400) [-346.166] (-345.292) * [-344.552] (-346.121) (-344.374) (-345.914) -- 0:00:42
331000 -- (-344.372) (-345.459) [-344.210] (-345.648) * (-347.641) (-344.607) (-349.123) [-346.795] -- 0:00:42
331500 -- (-347.262) (-343.746) [-344.757] (-347.234) * (-347.256) (-347.744) [-347.874] (-347.201) -- 0:00:42
332000 -- [-349.674] (-345.462) (-347.789) (-349.038) * (-343.689) (-346.199) [-345.408] (-346.639) -- 0:00:42
332500 -- (-350.518) (-344.523) (-346.171) [-344.998] * [-345.153] (-346.651) (-347.076) (-343.172) -- 0:00:42
333000 -- (-346.876) (-346.714) [-344.579] (-348.040) * [-344.988] (-347.428) (-344.102) (-343.786) -- 0:00:42
333500 -- (-344.963) [-344.021] (-343.940) (-346.789) * (-346.334) (-348.096) (-347.164) [-344.485] -- 0:00:41
334000 -- (-345.469) [-345.659] (-344.417) (-348.468) * (-345.912) (-344.397) [-344.111] (-344.949) -- 0:00:41
334500 -- [-345.279] (-347.410) (-344.202) (-347.102) * (-344.204) (-346.134) (-346.761) [-345.746] -- 0:00:41
335000 -- [-343.737] (-343.410) (-343.512) (-348.287) * (-345.578) (-344.311) (-346.211) [-346.138] -- 0:00:41
Average standard deviation of split frequencies: 0.011519
335500 -- (-345.045) (-344.395) (-350.476) [-345.836] * [-343.806] (-346.124) (-345.204) (-345.619) -- 0:00:41
336000 -- (-344.039) [-345.505] (-348.545) (-345.148) * (-344.059) (-350.250) [-344.989] (-343.819) -- 0:00:41
336500 -- (-343.554) (-352.196) (-346.879) [-345.360] * (-352.684) (-346.043) (-343.737) [-344.603] -- 0:00:41
337000 -- (-343.895) (-345.440) [-347.679] (-348.316) * (-346.073) (-346.347) (-343.547) [-345.160] -- 0:00:41
337500 -- (-346.522) (-343.685) [-344.359] (-345.020) * [-344.229] (-349.149) (-343.954) (-350.202) -- 0:00:41
338000 -- [-347.059] (-344.642) (-345.531) (-347.318) * [-345.184] (-345.507) (-346.807) (-344.920) -- 0:00:41
338500 -- (-343.890) (-346.208) [-346.126] (-345.956) * [-345.863] (-346.574) (-348.579) (-347.056) -- 0:00:41
339000 -- (-346.069) (-345.723) (-345.366) [-345.084] * (-349.815) (-344.851) [-347.031] (-345.986) -- 0:00:40
339500 -- (-345.585) (-345.470) (-346.690) [-346.169] * (-348.466) (-344.140) (-345.719) [-344.877] -- 0:00:40
340000 -- (-345.848) [-346.467] (-344.533) (-345.991) * (-346.964) [-345.751] (-346.979) (-344.540) -- 0:00:40
Average standard deviation of split frequencies: 0.011070
340500 -- (-344.549) [-344.671] (-343.690) (-345.253) * (-344.587) [-346.182] (-344.215) (-344.806) -- 0:00:40
341000 -- [-346.488] (-344.333) (-346.022) (-343.570) * (-346.456) [-343.816] (-344.652) (-343.628) -- 0:00:40
341500 -- (-346.658) (-348.104) (-345.843) [-343.344] * (-345.964) (-345.208) (-343.747) [-345.038] -- 0:00:40
342000 -- (-343.830) [-344.346] (-344.427) (-343.534) * [-345.907] (-346.404) (-343.946) (-345.268) -- 0:00:40
342500 -- [-343.991] (-344.483) (-345.714) (-349.113) * (-344.446) (-344.979) (-344.455) [-344.450] -- 0:00:40
343000 -- (-344.823) [-345.932] (-349.670) (-348.092) * (-345.837) [-343.971] (-344.696) (-343.920) -- 0:00:40
343500 -- (-344.673) (-343.647) [-345.676] (-345.846) * [-345.989] (-349.361) (-345.461) (-343.775) -- 0:00:40
344000 -- (-345.579) [-346.100] (-344.480) (-343.967) * (-344.748) (-348.273) (-344.475) [-344.722] -- 0:00:40
344500 -- (-346.438) (-345.451) [-343.854] (-345.121) * [-345.144] (-347.213) (-344.900) (-343.449) -- 0:00:39
345000 -- (-347.531) (-344.023) [-345.500] (-345.914) * (-346.166) [-350.634] (-344.190) (-346.419) -- 0:00:39
Average standard deviation of split frequencies: 0.010182
345500 -- [-347.025] (-345.081) (-346.900) (-347.724) * (-343.479) (-345.040) [-345.072] (-344.832) -- 0:00:41
346000 -- (-346.664) [-343.621] (-345.701) (-347.815) * (-347.861) (-344.481) (-344.358) [-345.496] -- 0:00:41
346500 -- (-346.392) (-345.776) (-345.904) [-350.260] * (-344.057) [-344.544] (-348.735) (-348.622) -- 0:00:41
347000 -- (-345.490) [-345.014] (-347.234) (-346.321) * (-349.448) [-344.683] (-343.711) (-346.091) -- 0:00:41
347500 -- [-346.501] (-348.206) (-346.974) (-346.929) * (-351.891) (-347.897) [-345.556] (-345.293) -- 0:00:41
348000 -- (-346.013) (-351.135) [-348.066] (-345.544) * (-346.701) (-346.866) (-348.643) [-345.823] -- 0:00:41
348500 -- (-344.573) (-345.849) [-344.388] (-347.429) * (-348.255) [-345.389] (-352.082) (-343.952) -- 0:00:41
349000 -- (-345.045) (-345.290) (-346.195) [-343.720] * (-348.387) [-348.286] (-347.408) (-345.976) -- 0:00:41
349500 -- (-345.887) (-351.777) (-348.078) [-344.416] * (-353.657) [-348.334] (-347.648) (-345.221) -- 0:00:40
350000 -- (-344.338) [-347.037] (-343.588) (-344.658) * (-347.772) (-345.461) [-346.629] (-347.013) -- 0:00:40
Average standard deviation of split frequencies: 0.009335
350500 -- (-346.555) [-343.457] (-343.403) (-346.107) * [-346.836] (-345.021) (-347.005) (-346.754) -- 0:00:40
351000 -- [-345.047] (-344.907) (-346.654) (-345.067) * (-347.120) [-344.513] (-344.821) (-343.500) -- 0:00:40
351500 -- [-344.696] (-344.218) (-347.188) (-343.737) * (-346.004) (-349.877) [-345.455] (-343.565) -- 0:00:40
352000 -- (-348.220) (-344.880) (-345.541) [-344.801] * (-348.749) [-347.512] (-348.867) (-344.876) -- 0:00:40
352500 -- [-347.595] (-346.911) (-345.571) (-347.824) * (-346.501) (-345.266) [-345.731] (-346.577) -- 0:00:40
353000 -- (-346.616) (-353.284) [-344.858] (-343.997) * (-343.923) (-346.098) [-347.387] (-343.827) -- 0:00:40
353500 -- [-345.325] (-349.953) (-346.825) (-348.609) * [-345.776] (-346.851) (-346.928) (-344.970) -- 0:00:40
354000 -- (-344.400) (-345.015) (-346.574) [-345.769] * (-349.883) (-347.137) (-345.583) [-343.607] -- 0:00:40
354500 -- [-344.923] (-348.767) (-344.529) (-348.566) * [-345.577] (-346.206) (-345.626) (-345.213) -- 0:00:40
355000 -- (-343.990) (-348.844) [-344.719] (-346.831) * (-344.974) [-344.672] (-350.548) (-346.278) -- 0:00:39
Average standard deviation of split frequencies: 0.009970
355500 -- (-344.849) (-345.237) (-350.130) [-344.780] * [-343.963] (-346.076) (-347.387) (-344.207) -- 0:00:39
356000 -- (-345.104) (-352.338) [-348.265] (-347.217) * (-346.496) (-344.947) [-345.918] (-343.149) -- 0:00:39
356500 -- (-350.989) (-348.160) [-344.248] (-347.054) * [-344.991] (-345.358) (-345.500) (-345.415) -- 0:00:39
357000 -- (-347.441) (-344.082) [-345.342] (-346.615) * (-346.777) (-346.873) [-343.930] (-347.259) -- 0:00:39
357500 -- (-355.715) (-348.233) (-347.563) [-345.790] * (-345.400) (-345.187) (-345.394) [-348.426] -- 0:00:39
358000 -- (-351.880) [-348.637] (-346.713) (-343.858) * [-351.637] (-343.664) (-347.693) (-346.903) -- 0:00:39
358500 -- (-347.947) (-349.132) (-346.365) [-347.216] * [-347.258] (-344.256) (-349.492) (-344.951) -- 0:00:39
359000 -- (-345.166) (-347.852) [-344.122] (-344.078) * (-347.063) (-345.012) (-345.368) [-344.089] -- 0:00:39
359500 -- [-346.361] (-344.880) (-347.161) (-344.911) * (-345.775) [-345.641] (-344.221) (-346.302) -- 0:00:39
360000 -- (-343.272) (-344.113) [-346.355] (-347.355) * (-345.521) (-345.981) (-346.674) [-346.531] -- 0:00:39
Average standard deviation of split frequencies: 0.009226
360500 -- (-344.262) (-347.507) [-346.211] (-344.336) * (-351.807) (-345.053) [-345.961] (-348.308) -- 0:00:39
361000 -- [-344.849] (-345.341) (-349.964) (-346.686) * [-348.116] (-344.123) (-349.715) (-348.722) -- 0:00:38
361500 -- (-345.556) (-344.961) (-344.666) [-349.195] * [-347.062] (-345.218) (-345.511) (-345.021) -- 0:00:38
362000 -- (-344.005) (-343.980) (-348.489) [-344.458] * (-348.208) (-343.848) (-346.363) [-347.930] -- 0:00:38
362500 -- (-344.059) (-346.490) (-344.280) [-351.348] * (-343.251) (-345.034) (-345.524) [-345.455] -- 0:00:40
363000 -- (-343.656) [-344.640] (-345.219) (-349.831) * (-347.557) (-344.825) (-344.700) [-344.311] -- 0:00:40
363500 -- (-346.629) [-344.251] (-345.140) (-354.429) * (-346.907) (-345.530) [-344.693] (-344.544) -- 0:00:40
364000 -- [-344.004] (-345.386) (-346.221) (-344.985) * [-346.839] (-344.920) (-343.205) (-345.536) -- 0:00:40
364500 -- (-344.515) (-344.709) (-346.025) [-345.825] * (-344.447) (-345.236) [-345.489] (-345.703) -- 0:00:40
365000 -- [-344.360] (-346.168) (-345.862) (-344.286) * (-345.662) (-346.970) [-344.238] (-350.328) -- 0:00:40
Average standard deviation of split frequencies: 0.009087
365500 -- [-344.740] (-346.664) (-343.932) (-350.165) * (-344.601) (-345.323) [-346.129] (-347.415) -- 0:00:39
366000 -- (-344.323) (-346.582) (-345.511) [-344.154] * (-345.043) (-343.831) [-345.048] (-344.396) -- 0:00:39
366500 -- (-346.467) (-346.892) [-347.079] (-345.854) * (-348.546) [-344.852] (-344.952) (-349.900) -- 0:00:39
367000 -- (-345.432) (-347.475) [-344.468] (-351.218) * (-346.602) (-345.765) [-344.325] (-348.807) -- 0:00:39
367500 -- [-345.273] (-345.872) (-345.265) (-343.476) * [-343.889] (-347.105) (-348.547) (-345.605) -- 0:00:39
368000 -- (-348.226) (-345.955) [-345.682] (-344.060) * (-343.909) (-344.619) (-344.775) [-346.447] -- 0:00:39
368500 -- (-346.598) (-343.743) [-345.081] (-344.247) * (-344.703) (-345.048) [-343.662] (-347.863) -- 0:00:39
369000 -- (-347.157) [-346.158] (-348.890) (-343.227) * (-343.916) (-343.211) (-344.739) [-346.993] -- 0:00:39
369500 -- (-347.337) (-346.197) (-347.831) [-343.071] * (-344.336) (-344.246) [-344.287] (-343.319) -- 0:00:39
370000 -- (-345.295) [-346.494] (-345.014) (-345.547) * (-348.457) (-350.037) [-345.693] (-344.566) -- 0:00:39
Average standard deviation of split frequencies: 0.009609
370500 -- [-344.391] (-348.479) (-345.917) (-343.222) * [-344.213] (-349.811) (-344.982) (-349.405) -- 0:00:39
371000 -- (-348.099) [-345.242] (-343.655) (-343.644) * (-345.529) [-345.829] (-343.832) (-345.433) -- 0:00:38
371500 -- (-347.509) (-345.671) [-344.950] (-344.715) * (-343.705) [-343.666] (-344.317) (-346.973) -- 0:00:38
372000 -- [-343.563] (-347.033) (-344.351) (-346.297) * (-346.284) (-346.125) (-344.998) [-343.220] -- 0:00:38
372500 -- [-348.180] (-347.533) (-344.150) (-347.812) * (-345.536) [-345.244] (-347.362) (-347.076) -- 0:00:38
373000 -- (-346.563) (-344.585) (-344.007) [-347.653] * (-345.532) [-345.554] (-348.677) (-346.166) -- 0:00:38
373500 -- (-344.043) [-346.394] (-344.163) (-347.665) * [-347.152] (-345.692) (-345.944) (-344.696) -- 0:00:38
374000 -- (-350.349) (-346.204) (-343.577) [-343.841] * [-345.261] (-346.180) (-345.505) (-343.272) -- 0:00:38
374500 -- [-346.133] (-346.171) (-348.552) (-344.700) * (-344.501) (-344.250) [-346.611] (-344.859) -- 0:00:38
375000 -- [-345.177] (-346.913) (-344.193) (-343.851) * (-346.492) (-346.093) [-347.811] (-345.568) -- 0:00:38
Average standard deviation of split frequencies: 0.009055
375500 -- (-344.770) [-345.898] (-343.859) (-343.609) * [-344.793] (-346.183) (-343.681) (-348.189) -- 0:00:38
376000 -- (-345.054) (-345.672) (-344.867) [-345.924] * (-346.363) [-344.272] (-346.590) (-346.947) -- 0:00:38
376500 -- (-344.205) (-345.130) [-344.042] (-345.461) * (-349.467) (-343.240) (-345.735) [-345.103] -- 0:00:38
377000 -- (-348.278) [-345.100] (-351.335) (-344.474) * (-346.236) (-346.769) [-344.691] (-350.152) -- 0:00:38
377500 -- (-345.609) (-345.320) [-348.523] (-349.894) * (-344.203) (-345.096) [-345.939] (-345.886) -- 0:00:37
378000 -- (-347.570) (-346.471) [-344.359] (-345.549) * (-343.963) (-345.827) (-346.682) [-345.825] -- 0:00:37
378500 -- (-347.382) (-345.740) (-344.074) [-346.735] * [-343.993] (-345.216) (-348.129) (-343.866) -- 0:00:37
379000 -- (-344.879) (-346.390) (-343.346) [-344.794] * (-344.642) (-345.535) (-346.936) [-343.447] -- 0:00:37
379500 -- (-345.460) (-343.953) (-346.236) [-343.779] * [-345.457] (-348.356) (-344.889) (-346.150) -- 0:00:39
380000 -- [-344.037] (-345.849) (-346.665) (-343.485) * [-347.487] (-345.850) (-345.023) (-344.660) -- 0:00:39
Average standard deviation of split frequencies: 0.008960
380500 -- (-344.173) (-343.990) [-349.099] (-345.348) * (-344.501) (-346.464) [-349.898] (-347.267) -- 0:00:39
381000 -- (-345.608) [-344.117] (-345.256) (-344.742) * (-346.838) (-347.556) (-347.389) [-344.937] -- 0:00:38
381500 -- (-345.777) [-343.947] (-343.296) (-345.859) * (-351.902) [-348.106] (-345.697) (-345.168) -- 0:00:38
382000 -- [-347.655] (-345.474) (-344.210) (-350.381) * [-346.611] (-347.938) (-346.773) (-345.910) -- 0:00:38
382500 -- (-345.983) (-347.081) [-344.298] (-346.563) * (-351.563) [-344.229] (-346.214) (-346.027) -- 0:00:38
383000 -- (-346.531) (-346.147) [-344.759] (-347.237) * [-345.830] (-344.381) (-344.404) (-347.957) -- 0:00:38
383500 -- [-344.221] (-347.769) (-343.741) (-343.720) * [-344.567] (-344.475) (-344.731) (-350.817) -- 0:00:38
384000 -- (-344.589) [-345.815] (-347.056) (-343.421) * (-343.928) (-346.073) [-346.835] (-348.201) -- 0:00:38
384500 -- (-345.365) (-344.436) (-347.023) [-344.506] * [-346.051] (-346.719) (-343.370) (-351.882) -- 0:00:38
385000 -- (-344.115) [-346.121] (-345.109) (-345.015) * (-348.659) (-346.034) [-347.672] (-347.349) -- 0:00:38
Average standard deviation of split frequencies: 0.008118
385500 -- [-345.347] (-344.687) (-343.984) (-346.117) * [-346.130] (-345.207) (-343.886) (-345.505) -- 0:00:38
386000 -- (-346.002) [-344.401] (-347.106) (-351.750) * (-345.767) [-345.482] (-345.726) (-346.700) -- 0:00:38
386500 -- (-344.156) [-348.079] (-344.700) (-348.247) * (-345.359) [-345.671] (-345.755) (-345.799) -- 0:00:38
387000 -- (-344.132) (-344.184) (-344.059) [-344.755] * (-345.328) (-347.230) (-345.503) [-344.981] -- 0:00:38
387500 -- (-348.478) [-344.218] (-344.115) (-344.621) * (-345.738) [-345.952] (-344.191) (-344.937) -- 0:00:37
388000 -- (-347.630) [-345.521] (-343.313) (-348.812) * (-345.384) (-345.211) (-344.657) [-345.950] -- 0:00:37
388500 -- (-345.882) (-344.283) [-345.111] (-346.130) * [-343.198] (-346.450) (-347.796) (-343.382) -- 0:00:37
389000 -- (-344.710) [-344.547] (-348.966) (-343.968) * [-343.171] (-353.394) (-346.246) (-344.615) -- 0:00:37
389500 -- (-345.565) (-344.967) (-345.614) [-345.195] * (-347.076) (-344.015) [-346.088] (-344.975) -- 0:00:37
390000 -- (-345.257) (-345.672) (-347.470) [-348.331] * (-344.031) [-345.938] (-343.716) (-345.030) -- 0:00:37
Average standard deviation of split frequencies: 0.008731
390500 -- (-344.043) (-344.253) [-344.686] (-347.018) * (-346.774) [-344.992] (-345.973) (-349.522) -- 0:00:37
391000 -- (-349.608) (-346.113) [-343.278] (-345.395) * (-344.863) (-347.015) [-344.688] (-346.018) -- 0:00:37
391500 -- (-345.117) (-345.948) (-343.867) [-345.635] * (-346.982) [-345.550] (-344.771) (-344.674) -- 0:00:37
392000 -- (-347.641) [-345.447] (-344.393) (-346.769) * [-346.340] (-346.479) (-346.819) (-344.349) -- 0:00:37
392500 -- [-348.256] (-343.120) (-344.049) (-345.575) * (-344.638) (-345.713) [-345.377] (-345.381) -- 0:00:37
393000 -- (-347.857) (-347.449) (-345.100) [-347.476] * [-344.210] (-345.281) (-345.815) (-347.860) -- 0:00:37
393500 -- (-348.202) (-344.892) (-345.919) [-349.745] * (-345.520) (-347.682) [-349.949] (-345.258) -- 0:00:36
394000 -- [-346.234] (-350.623) (-345.551) (-347.517) * (-344.901) [-345.744] (-345.664) (-348.708) -- 0:00:36
394500 -- [-343.737] (-345.342) (-345.752) (-347.891) * (-344.293) (-345.027) (-347.965) [-344.039] -- 0:00:36
395000 -- [-345.346] (-343.830) (-347.085) (-346.025) * (-346.851) [-344.140] (-343.750) (-344.327) -- 0:00:38
Average standard deviation of split frequencies: 0.007423
395500 -- (-347.009) (-345.931) [-345.096] (-346.562) * (-345.457) (-346.370) (-349.331) [-345.781] -- 0:00:38
396000 -- (-348.439) (-349.874) [-344.051] (-345.826) * (-343.738) (-345.934) (-350.749) [-347.766] -- 0:00:38
396500 -- (-344.188) (-348.919) (-346.004) [-344.510] * (-344.416) (-347.044) [-345.801] (-345.382) -- 0:00:38
397000 -- [-345.090] (-348.717) (-344.929) (-344.640) * (-345.548) (-347.428) [-346.021] (-347.275) -- 0:00:37
397500 -- (-343.895) [-345.494] (-344.680) (-343.431) * [-348.696] (-345.314) (-344.256) (-347.307) -- 0:00:37
398000 -- (-345.288) (-345.527) [-343.818] (-344.790) * (-346.858) (-346.614) (-348.281) [-343.717] -- 0:00:37
398500 -- (-347.242) (-349.043) (-344.825) [-345.281] * (-344.940) [-345.713] (-348.006) (-343.722) -- 0:00:37
399000 -- (-346.748) (-343.880) (-345.032) [-344.862] * [-346.451] (-345.677) (-346.522) (-346.514) -- 0:00:37
399500 -- (-344.106) [-345.205] (-345.686) (-346.902) * [-347.603] (-345.957) (-347.230) (-344.033) -- 0:00:37
400000 -- (-343.439) (-346.624) (-344.782) [-343.445] * [-348.630] (-344.700) (-343.931) (-345.698) -- 0:00:37
Average standard deviation of split frequencies: 0.007721
400500 -- (-345.803) (-344.745) [-347.068] (-344.137) * (-347.198) (-344.841) (-347.197) [-345.121] -- 0:00:37
401000 -- (-345.959) (-343.971) [-344.341] (-347.663) * (-347.191) (-344.697) [-344.386] (-346.939) -- 0:00:37
401500 -- [-344.461] (-346.392) (-347.999) (-345.765) * (-344.475) (-344.119) [-344.604] (-346.258) -- 0:00:37
402000 -- [-347.650] (-345.202) (-347.833) (-343.336) * (-344.889) [-344.936] (-344.704) (-346.027) -- 0:00:37
402500 -- (-344.664) (-345.248) (-344.047) [-344.289] * (-345.519) (-351.198) (-346.937) [-344.514] -- 0:00:37
403000 -- (-343.269) [-347.530] (-344.295) (-345.902) * (-344.631) (-346.507) [-343.988] (-347.810) -- 0:00:37
403500 -- (-345.159) (-344.845) [-344.792] (-345.854) * (-344.559) (-346.241) [-344.226] (-344.848) -- 0:00:36
404000 -- (-345.759) (-345.197) (-344.603) [-344.412] * (-344.613) (-348.564) [-344.060] (-347.292) -- 0:00:36
404500 -- (-346.121) (-349.690) [-343.338] (-343.573) * (-346.394) [-345.111] (-344.222) (-345.700) -- 0:00:36
405000 -- [-344.997] (-344.015) (-345.375) (-346.325) * (-344.626) [-347.033] (-345.098) (-344.978) -- 0:00:36
Average standard deviation of split frequencies: 0.008055
405500 -- [-344.844] (-343.876) (-347.958) (-347.239) * (-345.840) (-348.702) (-344.720) [-346.638] -- 0:00:36
406000 -- (-344.433) (-345.358) (-344.103) [-346.924] * [-344.801] (-345.170) (-346.855) (-343.971) -- 0:00:36
406500 -- (-345.397) [-346.349] (-343.711) (-345.890) * (-346.543) [-344.677] (-347.070) (-344.878) -- 0:00:36
407000 -- (-344.669) (-345.201) (-343.996) [-347.014] * (-345.534) [-343.690] (-346.679) (-345.595) -- 0:00:36
407500 -- (-346.749) [-346.754] (-344.592) (-351.219) * [-344.045] (-343.971) (-346.264) (-344.786) -- 0:00:36
408000 -- (-348.347) [-345.993] (-344.343) (-356.060) * (-346.363) (-351.289) [-344.334] (-344.154) -- 0:00:36
408500 -- (-346.682) (-344.242) (-345.595) [-345.727] * (-347.958) (-347.369) [-349.787] (-344.413) -- 0:00:36
409000 -- [-348.044] (-343.994) (-346.461) (-347.044) * [-346.335] (-346.123) (-345.171) (-347.140) -- 0:00:36
409500 -- (-346.548) (-350.004) [-343.818] (-347.629) * [-348.310] (-349.026) (-346.552) (-344.218) -- 0:00:36
410000 -- (-344.832) (-344.492) [-343.279] (-345.300) * (-345.043) (-350.547) [-344.494] (-343.930) -- 0:00:35
Average standard deviation of split frequencies: 0.008896
410500 -- (-346.747) (-346.493) (-346.197) [-345.198] * (-346.682) (-345.019) [-348.496] (-346.625) -- 0:00:35
411000 -- (-346.325) (-344.607) (-346.331) [-345.428] * (-344.456) [-344.947] (-347.229) (-346.950) -- 0:00:37
411500 -- (-346.935) [-344.139] (-345.637) (-344.007) * (-344.287) [-345.414] (-345.644) (-343.830) -- 0:00:37
412000 -- (-345.134) (-344.389) [-344.228] (-343.986) * (-347.626) (-348.787) (-343.952) [-343.594] -- 0:00:37
412500 -- (-346.496) (-347.002) [-345.538] (-344.916) * (-344.117) (-345.494) (-345.528) [-344.297] -- 0:00:37
413000 -- [-343.667] (-348.953) (-344.678) (-345.395) * (-345.691) (-345.455) [-344.342] (-345.855) -- 0:00:36
413500 -- (-344.197) (-345.614) (-349.142) [-344.183] * (-344.894) (-346.233) [-348.537] (-344.904) -- 0:00:36
414000 -- (-345.982) [-343.197] (-348.800) (-348.879) * [-345.872] (-345.176) (-347.353) (-346.808) -- 0:00:36
414500 -- (-347.105) [-346.098] (-349.169) (-348.022) * [-344.370] (-346.231) (-349.477) (-343.821) -- 0:00:36
415000 -- (-345.336) (-344.287) (-349.578) [-345.760] * (-344.621) [-343.730] (-344.728) (-346.622) -- 0:00:36
Average standard deviation of split frequencies: 0.009136
415500 -- (-347.561) [-343.592] (-354.602) (-345.852) * (-345.429) (-344.408) (-344.622) [-348.573] -- 0:00:36
416000 -- (-344.593) [-347.906] (-345.668) (-351.923) * (-345.292) [-344.163] (-347.111) (-347.539) -- 0:00:36
416500 -- [-346.012] (-343.575) (-345.214) (-344.599) * (-345.117) [-345.672] (-345.325) (-346.632) -- 0:00:36
417000 -- [-344.339] (-343.524) (-347.863) (-343.743) * (-346.546) (-344.665) [-351.063] (-345.203) -- 0:00:36
417500 -- [-344.605] (-345.471) (-344.708) (-346.112) * (-343.422) [-344.790] (-350.673) (-348.088) -- 0:00:36
418000 -- (-344.246) (-348.270) [-344.024] (-347.229) * (-345.856) [-345.870] (-347.441) (-344.270) -- 0:00:36
418500 -- (-345.236) [-343.924] (-343.687) (-344.708) * (-346.385) (-344.844) (-345.658) [-344.918] -- 0:00:36
419000 -- (-344.287) (-343.974) (-343.835) [-348.537] * (-347.252) [-344.907] (-347.076) (-344.907) -- 0:00:36
419500 -- (-345.416) (-343.984) (-345.178) [-347.918] * [-344.166] (-346.027) (-343.823) (-344.101) -- 0:00:35
420000 -- (-344.027) (-346.268) [-345.499] (-346.553) * (-344.388) (-346.126) [-343.709] (-347.069) -- 0:00:35
Average standard deviation of split frequencies: 0.009945
420500 -- (-345.340) [-346.377] (-344.798) (-344.512) * (-344.800) (-343.573) [-343.366] (-343.561) -- 0:00:35
421000 -- (-343.752) (-344.456) (-346.130) [-347.528] * (-347.297) [-345.210] (-345.054) (-346.003) -- 0:00:35
421500 -- (-343.976) [-347.955] (-347.561) (-346.489) * (-344.843) (-345.706) (-347.953) [-347.873] -- 0:00:35
422000 -- [-343.058] (-346.827) (-350.333) (-344.668) * (-345.397) (-345.473) (-351.279) [-347.472] -- 0:00:35
422500 -- (-345.118) (-347.520) [-345.380] (-345.410) * (-346.011) (-343.942) (-343.721) [-348.102] -- 0:00:35
423000 -- [-343.874] (-347.343) (-345.314) (-346.406) * (-347.567) (-346.267) (-343.858) [-348.960] -- 0:00:35
423500 -- (-343.893) [-343.800] (-345.625) (-349.758) * (-345.827) [-346.312] (-344.094) (-344.318) -- 0:00:35
424000 -- (-343.886) (-344.043) [-345.079] (-349.163) * [-344.124] (-350.099) (-347.359) (-345.551) -- 0:00:35
424500 -- [-346.329] (-349.377) (-344.830) (-348.448) * (-347.316) (-345.102) (-346.627) [-346.219] -- 0:00:35
425000 -- (-343.374) (-344.770) (-345.078) [-345.753] * (-344.147) (-344.840) [-348.927] (-344.238) -- 0:00:35
Average standard deviation of split frequencies: 0.009713
425500 -- (-344.913) (-344.372) [-346.115] (-343.997) * (-344.293) (-344.019) (-347.484) [-345.380] -- 0:00:35
426000 -- (-345.839) (-343.764) [-345.590] (-343.674) * (-344.102) (-343.834) [-346.193] (-352.399) -- 0:00:35
426500 -- (-344.787) [-345.209] (-346.255) (-344.252) * (-344.123) (-346.408) (-345.700) [-347.893] -- 0:00:34
427000 -- [-343.315] (-346.774) (-344.562) (-346.123) * (-349.823) (-344.758) [-345.884] (-346.803) -- 0:00:34
427500 -- (-343.182) [-344.355] (-344.922) (-349.932) * [-345.497] (-344.792) (-346.075) (-346.511) -- 0:00:34
428000 -- [-344.224] (-344.592) (-344.464) (-349.591) * [-343.661] (-346.006) (-344.130) (-347.289) -- 0:00:36
428500 -- (-346.630) (-347.580) [-345.252] (-348.892) * [-345.218] (-343.383) (-346.571) (-343.732) -- 0:00:36
429000 -- (-344.456) [-345.075] (-344.379) (-347.537) * (-344.443) (-345.627) (-345.791) [-346.344] -- 0:00:35
429500 -- (-344.193) (-347.820) (-347.754) [-344.651] * [-345.649] (-351.136) (-345.725) (-344.326) -- 0:00:35
430000 -- [-344.895] (-348.246) (-344.389) (-343.508) * (-344.701) [-349.624] (-343.276) (-349.747) -- 0:00:35
Average standard deviation of split frequencies: 0.010431
430500 -- (-343.960) (-345.708) (-343.995) [-348.316] * (-345.182) (-346.019) [-345.019] (-346.678) -- 0:00:35
431000 -- (-343.708) (-344.243) [-343.648] (-344.244) * (-349.020) (-344.805) [-346.694] (-348.284) -- 0:00:35
431500 -- (-344.403) (-346.389) (-346.915) [-345.277] * (-345.960) (-344.789) (-348.427) [-347.069] -- 0:00:35
432000 -- (-345.018) [-348.566] (-349.463) (-344.398) * [-345.525] (-344.496) (-351.030) (-346.044) -- 0:00:35
432500 -- [-351.226] (-348.158) (-345.711) (-343.500) * (-349.754) (-349.195) [-346.361] (-343.444) -- 0:00:35
433000 -- [-348.072] (-344.100) (-345.519) (-343.655) * (-344.986) (-348.113) [-343.901] (-343.992) -- 0:00:35
433500 -- (-348.637) [-345.867] (-344.685) (-344.365) * (-350.077) [-344.865] (-343.735) (-348.647) -- 0:00:35
434000 -- (-346.903) [-349.462] (-343.395) (-344.876) * (-344.444) [-343.648] (-346.511) (-348.209) -- 0:00:35
434500 -- (-345.519) (-343.315) (-344.719) [-345.472] * [-345.518] (-345.787) (-347.354) (-349.581) -- 0:00:35
435000 -- (-348.379) (-343.723) (-350.878) [-344.988] * (-347.766) (-344.303) (-344.173) [-344.406] -- 0:00:35
Average standard deviation of split frequencies: 0.009922
435500 -- [-343.481] (-345.713) (-348.768) (-346.485) * (-349.181) (-348.452) [-348.173] (-347.577) -- 0:00:34
436000 -- (-345.968) (-344.880) [-346.819] (-349.349) * (-344.802) (-343.395) [-345.404] (-346.893) -- 0:00:34
436500 -- [-345.287] (-347.108) (-344.890) (-343.601) * [-345.354] (-344.652) (-344.848) (-346.299) -- 0:00:34
437000 -- (-343.785) [-345.146] (-343.100) (-344.502) * [-343.703] (-343.898) (-344.377) (-345.232) -- 0:00:34
437500 -- (-344.244) (-344.692) (-345.713) [-344.659] * [-345.616] (-344.719) (-346.335) (-347.497) -- 0:00:34
438000 -- (-349.149) (-346.511) (-349.301) [-344.992] * [-345.650] (-344.021) (-344.122) (-351.285) -- 0:00:34
438500 -- (-351.892) (-346.630) (-346.543) [-345.556] * [-343.842] (-344.588) (-347.650) (-352.510) -- 0:00:34
439000 -- [-343.863] (-344.213) (-344.637) (-345.750) * (-344.389) [-343.843] (-343.474) (-348.477) -- 0:00:34
439500 -- (-346.539) [-346.924] (-345.185) (-344.725) * (-347.830) (-347.348) (-345.290) [-344.246] -- 0:00:34
440000 -- (-348.789) (-345.154) [-346.924] (-344.839) * (-348.355) (-348.345) [-344.486] (-345.311) -- 0:00:34
Average standard deviation of split frequencies: 0.010572
440500 -- (-347.976) [-345.802] (-343.919) (-343.197) * (-347.086) (-344.845) [-347.011] (-347.795) -- 0:00:34
441000 -- (-345.580) (-344.045) [-343.110] (-347.350) * [-346.436] (-345.996) (-343.514) (-349.704) -- 0:00:34
441500 -- (-344.789) (-344.315) [-344.306] (-348.230) * [-345.818] (-344.459) (-343.693) (-345.493) -- 0:00:34
442000 -- (-345.929) (-349.353) (-346.421) [-343.702] * (-344.257) (-349.156) [-344.124] (-346.413) -- 0:00:34
442500 -- (-344.409) (-345.907) (-346.788) [-345.468] * [-344.484] (-351.883) (-344.831) (-346.971) -- 0:00:34
443000 -- (-348.052) [-344.377] (-346.588) (-344.609) * [-344.292] (-348.903) (-345.351) (-351.084) -- 0:00:33
443500 -- (-345.553) [-344.647] (-348.014) (-345.255) * [-344.512] (-345.045) (-344.064) (-345.715) -- 0:00:33
444000 -- (-344.093) (-346.269) [-346.518] (-345.300) * (-344.934) (-346.443) (-345.222) [-345.813] -- 0:00:33
444500 -- (-348.017) (-345.210) (-343.394) [-344.564] * [-344.597] (-348.473) (-347.224) (-345.551) -- 0:00:33
445000 -- [-347.701] (-344.008) (-344.413) (-346.333) * [-349.843] (-347.528) (-348.513) (-346.176) -- 0:00:34
Average standard deviation of split frequencies: 0.010321
445500 -- (-347.561) (-347.508) (-349.487) [-346.719] * (-345.659) (-346.501) [-345.879] (-351.213) -- 0:00:34
446000 -- [-343.532] (-345.865) (-348.549) (-344.034) * (-344.014) [-345.304] (-345.421) (-349.671) -- 0:00:34
446500 -- (-349.428) [-347.975] (-347.645) (-344.700) * (-344.244) (-345.121) [-344.331] (-344.051) -- 0:00:34
447000 -- (-346.951) [-344.982] (-348.091) (-344.903) * (-347.274) (-344.913) (-343.943) [-345.509] -- 0:00:34
447500 -- (-345.931) (-348.238) [-345.990] (-345.719) * (-343.496) [-343.494] (-345.641) (-344.502) -- 0:00:34
448000 -- (-345.626) (-343.569) (-348.187) [-345.322] * [-346.164] (-345.840) (-344.256) (-344.906) -- 0:00:34
448500 -- [-344.364] (-347.221) (-345.280) (-344.908) * (-348.827) (-345.445) [-345.783] (-345.347) -- 0:00:34
449000 -- (-345.673) (-349.050) (-343.153) [-345.443] * [-345.836] (-344.979) (-344.290) (-346.038) -- 0:00:34
449500 -- (-344.142) [-343.564] (-348.385) (-346.488) * (-348.904) (-343.602) (-343.674) [-350.491] -- 0:00:34
450000 -- [-344.164] (-345.252) (-347.539) (-348.004) * [-345.182] (-347.809) (-348.306) (-343.715) -- 0:00:34
Average standard deviation of split frequencies: 0.008983
450500 -- [-345.463] (-345.069) (-346.702) (-345.507) * (-344.444) (-349.068) (-346.747) [-345.246] -- 0:00:34
451000 -- [-347.183] (-345.218) (-345.448) (-345.849) * (-344.227) (-345.778) (-344.070) [-344.304] -- 0:00:34
451500 -- (-347.790) [-345.771] (-343.697) (-344.040) * (-344.018) [-345.068] (-348.938) (-346.246) -- 0:00:34
452000 -- (-344.329) (-346.204) [-343.851] (-346.902) * (-345.390) (-344.620) [-344.947] (-347.973) -- 0:00:33
452500 -- (-344.789) (-344.563) (-343.560) [-345.119] * (-346.030) (-345.574) (-344.877) [-347.031] -- 0:00:33
453000 -- (-348.800) (-346.530) (-346.273) [-344.336] * (-345.862) (-347.316) (-346.950) [-343.796] -- 0:00:33
453500 -- (-350.317) (-345.821) (-343.997) [-345.432] * [-345.753] (-344.551) (-350.717) (-348.238) -- 0:00:33
454000 -- (-347.210) (-345.397) (-345.928) [-344.273] * (-343.647) (-345.288) [-348.203] (-345.817) -- 0:00:33
454500 -- (-344.873) (-346.973) [-344.971] (-345.970) * (-344.025) [-345.508] (-343.637) (-344.429) -- 0:00:33
455000 -- (-348.719) (-345.645) (-344.111) [-347.157] * (-345.567) (-345.184) (-343.994) [-344.586] -- 0:00:33
Average standard deviation of split frequencies: 0.008574
455500 -- [-345.367] (-349.043) (-345.751) (-346.875) * [-345.532] (-345.706) (-347.221) (-346.659) -- 0:00:33
456000 -- (-343.504) (-348.543) [-344.710] (-343.663) * [-344.802] (-345.151) (-345.318) (-344.643) -- 0:00:33
456500 -- (-344.321) (-346.332) [-346.064] (-343.300) * [-344.136] (-345.061) (-347.035) (-349.521) -- 0:00:33
457000 -- (-349.760) [-346.499] (-346.090) (-348.016) * (-345.862) [-349.490] (-344.823) (-345.849) -- 0:00:33
457500 -- [-343.692] (-345.310) (-345.998) (-343.788) * (-343.886) (-343.500) (-346.091) [-344.694] -- 0:00:33
458000 -- (-347.960) (-348.239) [-344.088] (-344.053) * (-343.872) (-344.534) (-345.250) [-344.957] -- 0:00:33
458500 -- (-345.412) (-344.842) [-345.888] (-345.667) * (-345.952) [-345.145] (-343.753) (-344.087) -- 0:00:33
459000 -- (-347.138) [-346.156] (-346.475) (-345.512) * [-347.154] (-343.721) (-346.965) (-344.320) -- 0:00:33
459500 -- (-344.120) [-347.297] (-345.275) (-346.855) * (-347.403) (-344.828) (-343.720) [-345.738] -- 0:00:32
460000 -- [-345.351] (-354.080) (-347.302) (-345.038) * (-348.581) [-344.819] (-346.914) (-344.528) -- 0:00:32
Average standard deviation of split frequencies: 0.007825
460500 -- (-344.888) [-344.371] (-345.952) (-345.551) * (-346.247) (-344.489) [-349.954] (-345.237) -- 0:00:32
461000 -- [-345.606] (-346.683) (-343.503) (-344.642) * (-349.849) (-346.105) (-347.583) [-344.332] -- 0:00:32
461500 -- (-346.276) (-346.914) [-343.444] (-343.894) * (-347.371) (-345.977) (-345.481) [-343.430] -- 0:00:32
462000 -- [-345.939] (-345.465) (-346.083) (-348.118) * [-343.678] (-344.104) (-344.579) (-347.396) -- 0:00:33
462500 -- (-344.852) (-344.435) [-345.305] (-348.844) * (-344.648) (-346.266) (-345.899) [-344.440] -- 0:00:33
463000 -- (-344.370) (-344.629) [-345.342] (-344.771) * (-346.216) (-346.110) (-346.433) [-346.155] -- 0:00:33
463500 -- (-344.266) (-344.173) [-345.989] (-344.571) * [-345.539] (-345.107) (-345.521) (-345.297) -- 0:00:33
464000 -- (-343.799) [-346.500] (-344.520) (-345.992) * (-345.936) (-346.848) (-345.103) [-345.112] -- 0:00:33
464500 -- [-343.610] (-344.920) (-345.885) (-345.033) * (-345.965) [-345.623] (-346.587) (-344.270) -- 0:00:33
465000 -- [-346.212] (-349.022) (-345.294) (-345.378) * [-346.739] (-347.210) (-344.638) (-344.199) -- 0:00:33
Average standard deviation of split frequencies: 0.007676
465500 -- (-345.927) (-347.079) [-345.461] (-346.173) * (-345.201) (-345.394) [-344.086] (-343.356) -- 0:00:33
466000 -- (-345.008) (-346.310) (-347.624) [-349.354] * (-348.842) [-345.221] (-343.621) (-348.802) -- 0:00:33
466500 -- (-348.358) (-345.958) (-345.052) [-345.984] * [-346.009] (-345.461) (-343.596) (-345.494) -- 0:00:33
467000 -- (-347.543) (-346.414) [-344.711] (-344.359) * (-345.372) (-345.242) [-344.708] (-345.818) -- 0:00:33
467500 -- [-345.863] (-351.622) (-345.208) (-343.761) * (-343.997) (-347.408) (-344.856) [-347.887] -- 0:00:33
468000 -- (-345.690) (-347.782) [-345.900] (-346.327) * (-346.954) (-345.376) [-346.629] (-347.485) -- 0:00:32
468500 -- (-346.495) (-347.100) (-347.810) [-345.981] * (-343.426) (-348.617) [-345.906] (-346.285) -- 0:00:32
469000 -- [-347.728] (-344.943) (-344.987) (-346.539) * (-345.865) [-345.049] (-344.788) (-350.628) -- 0:00:32
469500 -- [-346.017] (-349.341) (-343.817) (-344.285) * (-348.125) [-345.666] (-346.105) (-344.355) -- 0:00:32
470000 -- [-344.666] (-346.914) (-344.042) (-348.360) * (-344.381) [-344.705] (-346.736) (-344.144) -- 0:00:32
Average standard deviation of split frequencies: 0.007600
470500 -- (-346.085) (-349.136) [-344.977] (-347.085) * (-347.215) [-346.712] (-344.158) (-345.015) -- 0:00:32
471000 -- [-347.137] (-345.974) (-346.008) (-346.876) * [-345.086] (-346.654) (-344.217) (-344.811) -- 0:00:32
471500 -- (-350.144) (-346.176) [-347.966] (-343.833) * [-344.026] (-344.609) (-343.755) (-345.504) -- 0:00:32
472000 -- (-345.489) (-345.715) [-344.917] (-344.273) * [-343.952] (-345.412) (-343.847) (-343.798) -- 0:00:32
472500 -- (-345.189) (-343.537) (-345.313) [-346.957] * [-344.451] (-345.416) (-346.152) (-347.892) -- 0:00:32
473000 -- (-347.483) [-348.636] (-346.076) (-346.886) * (-349.230) (-346.349) (-343.855) [-345.429] -- 0:00:32
473500 -- [-343.591] (-346.059) (-346.275) (-344.358) * (-344.098) [-343.797] (-349.449) (-343.502) -- 0:00:32
474000 -- [-343.626] (-347.092) (-343.647) (-346.138) * (-346.457) (-346.946) (-349.294) [-344.642] -- 0:00:32
474500 -- (-344.394) [-346.011] (-351.590) (-343.453) * (-350.783) (-348.911) (-343.614) [-348.627] -- 0:00:32
475000 -- [-345.492] (-345.239) (-348.125) (-344.644) * (-350.747) [-347.593] (-343.890) (-347.662) -- 0:00:32
Average standard deviation of split frequencies: 0.008738
475500 -- (-344.222) (-344.112) (-349.617) [-343.089] * [-347.010] (-345.133) (-346.821) (-346.445) -- 0:00:31
476000 -- (-347.930) [-344.246] (-346.072) (-343.621) * (-346.117) [-346.037] (-346.811) (-344.315) -- 0:00:31
476500 -- (-343.657) (-344.228) [-346.130] (-345.194) * (-347.968) (-344.470) [-345.068] (-345.208) -- 0:00:31
477000 -- [-344.331] (-346.578) (-345.055) (-345.606) * [-346.190] (-345.173) (-345.204) (-347.651) -- 0:00:31
477500 -- [-344.158] (-346.256) (-344.533) (-345.990) * [-346.401] (-346.413) (-343.474) (-348.022) -- 0:00:31
478000 -- (-346.369) (-343.767) (-344.382) [-345.357] * [-346.816] (-349.667) (-345.033) (-351.648) -- 0:00:31
478500 -- (-344.078) (-347.759) (-348.988) [-343.442] * [-345.051] (-352.299) (-347.169) (-346.323) -- 0:00:31
479000 -- (-349.011) (-344.645) [-348.077] (-343.652) * (-343.884) (-350.479) (-346.898) [-343.773] -- 0:00:32
479500 -- [-348.866] (-346.013) (-349.245) (-351.082) * [-344.015] (-346.591) (-345.385) (-347.855) -- 0:00:32
480000 -- (-350.037) [-345.184] (-348.780) (-349.867) * (-344.427) (-345.311) (-346.928) [-344.659] -- 0:00:32
Average standard deviation of split frequencies: 0.008019
480500 -- (-344.984) (-345.293) [-344.394] (-347.115) * (-343.796) [-346.759] (-347.077) (-348.551) -- 0:00:32
481000 -- (-347.009) [-345.563] (-347.810) (-346.790) * [-346.932] (-349.567) (-344.801) (-346.013) -- 0:00:32
481500 -- (-346.693) [-346.641] (-349.734) (-348.703) * [-349.213] (-347.808) (-345.408) (-345.030) -- 0:00:32
482000 -- (-345.115) (-344.181) (-344.890) [-343.277] * (-347.428) (-346.272) [-344.933] (-346.320) -- 0:00:32
482500 -- (-345.987) [-343.997] (-346.614) (-344.281) * (-347.164) (-346.757) (-344.971) [-346.832] -- 0:00:32
483000 -- (-348.229) (-346.851) [-348.149] (-344.402) * (-348.860) (-345.384) (-344.996) [-343.846] -- 0:00:32
483500 -- [-346.362] (-346.455) (-344.720) (-351.748) * (-345.286) (-349.557) [-344.962] (-344.756) -- 0:00:32
484000 -- [-349.921] (-349.299) (-343.997) (-346.007) * (-346.857) (-349.187) (-347.537) [-344.169] -- 0:00:31
484500 -- (-345.795) (-343.892) (-344.665) [-344.647] * (-346.721) (-345.153) (-345.350) [-343.587] -- 0:00:31
485000 -- (-344.002) [-344.961] (-347.669) (-347.340) * (-346.031) [-345.851] (-345.351) (-343.537) -- 0:00:31
Average standard deviation of split frequencies: 0.008045
485500 -- (-344.920) (-344.893) [-343.802] (-345.464) * (-346.203) (-344.803) (-348.391) [-344.606] -- 0:00:31
486000 -- (-345.831) (-344.610) (-344.628) [-345.573] * (-346.155) (-343.562) [-347.063] (-344.061) -- 0:00:31
486500 -- (-345.846) [-344.241] (-344.627) (-343.867) * (-345.508) (-346.500) (-345.364) [-346.418] -- 0:00:31
487000 -- (-349.610) (-345.706) [-343.844] (-345.031) * (-347.511) (-344.359) [-345.904] (-348.057) -- 0:00:31
487500 -- (-347.927) (-343.463) [-344.533] (-344.317) * (-346.467) (-343.179) (-344.908) [-346.559] -- 0:00:31
488000 -- (-345.376) [-345.175] (-343.670) (-349.128) * (-344.890) (-343.827) (-346.429) [-347.002] -- 0:00:31
488500 -- (-348.422) (-344.028) [-345.500] (-345.933) * (-348.016) (-346.285) (-346.720) [-343.793] -- 0:00:31
489000 -- (-346.311) [-344.613] (-343.660) (-345.631) * (-346.597) [-344.923] (-347.901) (-344.746) -- 0:00:31
489500 -- (-344.685) [-346.655] (-345.030) (-346.737) * (-346.864) (-344.605) [-345.799] (-352.607) -- 0:00:31
490000 -- (-345.715) [-344.623] (-345.720) (-343.971) * (-348.338) (-345.474) (-346.261) [-346.684] -- 0:00:31
Average standard deviation of split frequencies: 0.008590
490500 -- [-345.896] (-345.070) (-344.705) (-344.294) * [-346.492] (-344.153) (-345.638) (-350.530) -- 0:00:31
491000 -- [-343.755] (-349.225) (-344.406) (-343.679) * (-346.661) (-346.302) [-344.450] (-344.356) -- 0:00:31
491500 -- (-345.446) (-344.690) (-346.647) [-345.561] * (-344.952) [-345.951] (-345.497) (-347.151) -- 0:00:31
492000 -- (-345.502) [-344.909] (-346.665) (-345.573) * (-345.880) (-347.995) [-346.738] (-344.342) -- 0:00:30
492500 -- (-350.730) (-347.385) [-344.787] (-347.450) * (-346.063) (-344.945) (-344.235) [-346.585] -- 0:00:30
493000 -- (-345.236) (-348.201) [-345.322] (-345.370) * (-344.490) [-345.966] (-347.579) (-343.841) -- 0:00:30
493500 -- (-345.298) [-346.125] (-345.407) (-346.162) * (-348.967) [-344.226] (-348.080) (-345.841) -- 0:00:30
494000 -- (-346.270) (-345.801) (-344.397) [-347.458] * (-347.427) [-345.229] (-345.967) (-344.934) -- 0:00:30
494500 -- (-346.729) (-350.286) (-343.690) [-345.219] * (-348.228) (-343.973) (-345.565) [-344.253] -- 0:00:30
495000 -- [-345.729] (-344.094) (-344.325) (-344.604) * (-349.133) (-346.001) [-344.851] (-344.997) -- 0:00:30
Average standard deviation of split frequencies: 0.009448
495500 -- (-347.070) [-345.198] (-343.492) (-346.605) * (-344.675) [-344.243] (-344.819) (-345.518) -- 0:00:30
496000 -- [-348.551] (-345.902) (-345.828) (-347.204) * [-344.343] (-343.750) (-344.547) (-348.515) -- 0:00:31
496500 -- (-346.251) (-345.859) (-344.326) [-349.100] * (-343.770) [-345.434] (-347.328) (-348.748) -- 0:00:31
497000 -- [-345.267] (-344.920) (-352.170) (-346.713) * (-346.387) (-344.460) (-345.030) [-344.453] -- 0:00:31
497500 -- (-344.215) (-343.547) (-345.526) [-344.921] * (-345.964) (-349.263) (-345.678) [-344.221] -- 0:00:31
498000 -- (-345.395) [-344.450] (-347.312) (-343.397) * [-346.773] (-346.402) (-346.912) (-346.377) -- 0:00:31
498500 -- (-344.488) (-347.829) (-343.735) [-343.256] * [-343.770] (-346.578) (-344.224) (-346.432) -- 0:00:31
499000 -- [-345.636] (-344.525) (-346.546) (-344.489) * [-344.823] (-344.959) (-344.404) (-343.265) -- 0:00:31
499500 -- (-344.837) [-343.449] (-345.482) (-344.737) * [-346.590] (-346.330) (-346.236) (-343.482) -- 0:00:31
500000 -- (-343.841) (-344.410) [-344.798] (-344.282) * (-348.524) (-348.156) [-346.532] (-343.743) -- 0:00:31
Average standard deviation of split frequencies: 0.009416
500500 -- [-344.992] (-347.005) (-346.391) (-348.647) * (-345.585) [-344.003] (-345.954) (-344.200) -- 0:00:30
501000 -- [-346.301] (-350.593) (-345.647) (-345.899) * (-346.402) (-346.226) [-343.853] (-343.632) -- 0:00:30
501500 -- (-346.439) [-344.689] (-344.745) (-344.544) * (-345.279) (-346.435) [-344.661] (-346.471) -- 0:00:30
502000 -- [-343.608] (-345.682) (-349.937) (-346.096) * (-346.847) [-349.866] (-345.123) (-346.634) -- 0:00:30
502500 -- (-348.408) [-347.700] (-345.391) (-345.582) * (-343.711) [-344.658] (-344.454) (-344.008) -- 0:00:30
503000 -- (-343.849) (-348.032) [-343.240] (-344.196) * (-349.840) (-344.394) [-343.624] (-347.077) -- 0:00:30
503500 -- (-345.785) [-345.465] (-344.700) (-346.445) * (-343.951) [-348.386] (-344.910) (-351.471) -- 0:00:30
504000 -- (-346.876) (-350.308) (-346.486) [-343.451] * (-345.561) (-344.137) (-347.309) [-345.789] -- 0:00:30
504500 -- (-347.525) [-346.837] (-344.442) (-343.678) * (-344.546) [-345.153] (-345.414) (-345.730) -- 0:00:30
505000 -- (-346.778) [-346.254] (-347.060) (-345.711) * (-344.499) (-346.963) (-348.430) [-344.554] -- 0:00:30
Average standard deviation of split frequencies: 0.009937
505500 -- (-348.524) [-344.290] (-344.928) (-345.611) * [-346.484] (-344.994) (-352.447) (-350.282) -- 0:00:30
506000 -- [-346.167] (-346.086) (-346.935) (-347.850) * (-345.451) (-345.354) (-344.677) [-346.382] -- 0:00:30
506500 -- [-346.427] (-346.928) (-344.571) (-346.273) * (-347.499) [-344.973] (-345.805) (-345.614) -- 0:00:30
507000 -- (-347.303) (-344.090) (-345.116) [-348.155] * (-345.390) (-344.327) [-346.620] (-346.967) -- 0:00:30
507500 -- (-343.731) (-345.380) (-344.694) [-346.650] * [-344.429] (-346.352) (-343.416) (-344.479) -- 0:00:30
508000 -- (-344.192) [-343.429] (-346.485) (-344.914) * (-344.429) (-348.570) (-347.758) [-345.077] -- 0:00:30
508500 -- (-346.778) (-344.178) (-344.889) [-345.339] * (-344.309) (-345.322) [-345.046] (-347.327) -- 0:00:29
509000 -- (-345.809) [-344.200] (-345.360) (-346.779) * [-345.273] (-344.671) (-346.335) (-346.443) -- 0:00:29
509500 -- (-347.436) [-345.173] (-348.390) (-346.700) * [-344.537] (-345.536) (-345.471) (-346.640) -- 0:00:29
510000 -- (-348.190) [-343.530] (-344.308) (-347.601) * [-343.531] (-344.796) (-347.599) (-345.879) -- 0:00:29
Average standard deviation of split frequencies: 0.009795
510500 -- (-344.949) [-344.018] (-346.200) (-349.914) * [-343.860] (-345.219) (-344.812) (-348.452) -- 0:00:29
511000 -- (-344.791) (-349.720) [-344.056] (-344.307) * (-344.605) (-344.967) [-343.906] (-345.832) -- 0:00:29
511500 -- [-347.226] (-345.272) (-344.848) (-344.735) * (-345.914) [-344.544] (-345.131) (-346.638) -- 0:00:29
512000 -- [-349.369] (-344.345) (-344.794) (-343.223) * (-345.577) [-346.258] (-344.051) (-349.995) -- 0:00:29
512500 -- (-345.925) (-343.934) [-344.891] (-343.989) * (-345.799) [-344.749] (-343.544) (-346.014) -- 0:00:29
513000 -- (-345.854) (-345.327) (-344.570) [-343.895] * (-346.550) [-346.375] (-346.610) (-345.085) -- 0:00:30
513500 -- (-348.490) (-346.082) [-345.508] (-343.727) * (-345.797) (-344.698) (-347.099) [-344.503] -- 0:00:30
514000 -- (-346.090) (-343.997) (-344.000) [-344.230] * [-344.341] (-345.953) (-344.221) (-344.321) -- 0:00:30
514500 -- [-345.180] (-345.798) (-345.872) (-344.904) * [-346.520] (-345.074) (-352.014) (-346.392) -- 0:00:30
515000 -- [-345.771] (-347.836) (-346.784) (-344.725) * (-345.991) (-349.577) [-343.949] (-345.869) -- 0:00:30
Average standard deviation of split frequencies: 0.009491
515500 -- (-347.645) [-346.350] (-345.311) (-345.300) * (-345.946) [-345.979] (-347.170) (-345.506) -- 0:00:30
516000 -- (-344.914) [-349.270] (-345.291) (-347.079) * (-349.488) (-345.160) [-343.114] (-347.220) -- 0:00:30
516500 -- (-344.379) (-345.169) [-345.616] (-345.109) * (-344.446) (-345.021) [-344.301] (-344.850) -- 0:00:29
517000 -- (-345.140) [-349.878] (-349.323) (-349.602) * (-344.393) [-351.473] (-344.379) (-343.386) -- 0:00:29
517500 -- [-343.858] (-346.452) (-347.845) (-345.257) * (-345.816) (-349.513) [-346.124] (-345.591) -- 0:00:29
518000 -- [-344.191] (-346.455) (-345.508) (-345.631) * (-344.183) [-346.288] (-345.906) (-344.204) -- 0:00:29
518500 -- (-349.526) (-345.529) (-344.282) [-345.083] * (-343.714) (-349.571) (-346.271) [-344.296] -- 0:00:29
519000 -- (-351.331) (-345.134) (-344.015) [-345.063] * (-346.057) (-347.856) (-346.538) [-344.365] -- 0:00:29
519500 -- (-348.827) (-349.416) [-347.195] (-345.156) * (-347.961) [-345.194] (-345.700) (-343.965) -- 0:00:29
520000 -- (-356.707) (-346.611) [-346.533] (-348.291) * [-350.163] (-345.102) (-347.197) (-344.754) -- 0:00:29
Average standard deviation of split frequencies: 0.010066
520500 -- (-345.494) [-347.267] (-346.463) (-344.827) * (-347.616) (-348.239) [-344.871] (-344.077) -- 0:00:29
521000 -- (-346.240) (-344.513) [-344.803] (-343.906) * [-343.554] (-347.591) (-345.102) (-348.136) -- 0:00:29
521500 -- [-346.878] (-347.522) (-346.447) (-346.195) * (-347.816) [-344.994] (-346.443) (-347.065) -- 0:00:29
522000 -- [-346.116] (-348.510) (-344.530) (-344.585) * (-343.583) (-347.622) (-345.991) [-347.670] -- 0:00:29
522500 -- (-345.847) (-349.221) [-345.693] (-344.070) * (-345.531) (-348.894) (-346.031) [-344.832] -- 0:00:29
523000 -- [-344.691] (-347.365) (-345.889) (-344.424) * (-346.610) [-343.516] (-344.617) (-345.064) -- 0:00:29
523500 -- [-346.635] (-345.179) (-349.964) (-343.185) * (-349.363) (-344.504) [-344.647] (-349.101) -- 0:00:29
524000 -- [-343.431] (-344.255) (-344.654) (-346.576) * (-347.828) (-345.832) (-346.934) [-345.945] -- 0:00:29
524500 -- (-345.812) [-347.081] (-347.574) (-346.552) * [-346.888] (-344.547) (-345.169) (-345.582) -- 0:00:29
525000 -- (-349.941) (-344.343) (-348.000) [-345.006] * [-346.814] (-344.335) (-347.717) (-346.232) -- 0:00:28
Average standard deviation of split frequencies: 0.009595
525500 -- (-346.466) (-350.286) [-346.070] (-348.328) * (-346.084) [-344.887] (-347.903) (-346.551) -- 0:00:28
526000 -- (-347.638) [-343.660] (-351.017) (-348.424) * [-346.677] (-345.603) (-344.786) (-346.296) -- 0:00:28
526500 -- (-347.281) (-345.571) (-345.659) [-347.186] * (-345.136) [-344.286] (-345.235) (-347.524) -- 0:00:28
527000 -- (-345.234) (-344.599) (-344.593) [-343.918] * (-347.599) [-345.935] (-346.623) (-344.494) -- 0:00:28
527500 -- (-345.950) (-345.067) [-345.211] (-345.437) * (-346.584) (-345.962) (-343.782) [-346.110] -- 0:00:28
528000 -- [-345.094] (-345.440) (-349.563) (-345.494) * [-344.492] (-344.734) (-348.876) (-346.262) -- 0:00:28
528500 -- (-350.024) (-344.717) (-344.056) [-349.714] * (-346.210) (-344.424) (-348.688) [-345.329] -- 0:00:28
529000 -- (-346.016) [-344.337] (-345.103) (-343.533) * (-344.162) (-344.340) (-346.456) [-345.800] -- 0:00:28
529500 -- (-345.543) (-345.277) [-346.034] (-344.044) * [-343.519] (-345.787) (-344.288) (-345.079) -- 0:00:29
530000 -- [-344.800] (-345.510) (-344.935) (-346.557) * (-348.155) (-345.442) [-345.657] (-345.276) -- 0:00:29
Average standard deviation of split frequencies: 0.008779
530500 -- [-346.679] (-345.171) (-345.253) (-345.994) * (-344.259) (-347.964) (-347.012) [-347.873] -- 0:00:29
531000 -- (-345.210) (-343.970) (-344.706) [-345.218] * (-348.664) (-346.245) (-345.141) [-345.932] -- 0:00:29
531500 -- (-346.342) (-344.197) [-343.722] (-344.771) * (-347.380) (-343.815) (-344.994) [-345.758] -- 0:00:29
532000 -- (-349.781) (-344.388) (-345.087) [-343.516] * (-344.211) (-347.137) [-345.783] (-343.978) -- 0:00:29
532500 -- (-347.058) (-344.423) (-345.044) [-343.199] * [-347.359] (-345.150) (-344.690) (-345.601) -- 0:00:28
533000 -- (-344.900) (-343.997) [-348.729] (-345.171) * (-344.868) [-344.231] (-343.595) (-345.324) -- 0:00:28
533500 -- [-345.412] (-344.818) (-345.785) (-344.920) * (-347.442) [-347.478] (-345.540) (-345.644) -- 0:00:28
534000 -- (-348.504) [-345.771] (-347.959) (-345.607) * [-345.482] (-349.743) (-345.733) (-345.130) -- 0:00:28
534500 -- [-347.242] (-348.215) (-343.755) (-345.374) * [-347.675] (-345.513) (-344.370) (-346.005) -- 0:00:28
535000 -- (-347.376) (-349.694) [-346.962] (-344.112) * (-346.366) (-345.927) [-348.728] (-344.411) -- 0:00:28
Average standard deviation of split frequencies: 0.008300
535500 -- (-347.945) (-352.180) (-350.899) [-343.888] * (-346.923) (-345.030) [-343.058] (-344.980) -- 0:00:28
536000 -- (-344.458) (-344.839) [-350.754] (-344.969) * (-345.301) [-343.876] (-345.616) (-344.445) -- 0:00:28
536500 -- [-345.612] (-345.454) (-344.771) (-345.765) * (-344.167) [-345.764] (-343.770) (-346.391) -- 0:00:28
537000 -- (-348.175) (-345.273) (-346.971) [-344.592] * (-344.039) (-346.052) [-348.364] (-345.384) -- 0:00:28
537500 -- [-344.483] (-345.248) (-348.201) (-345.093) * [-347.305] (-349.878) (-348.418) (-350.470) -- 0:00:28
538000 -- (-345.672) (-347.447) (-345.539) [-344.496] * [-345.472] (-348.222) (-349.437) (-346.524) -- 0:00:28
538500 -- (-347.560) (-344.822) [-343.832] (-344.845) * (-344.931) (-345.625) [-345.327] (-344.861) -- 0:00:28
539000 -- (-346.097) (-347.965) [-344.352] (-348.519) * (-344.991) (-347.214) [-346.972] (-344.021) -- 0:00:28
539500 -- (-345.402) [-347.296] (-344.677) (-348.579) * [-344.645] (-345.301) (-346.392) (-345.636) -- 0:00:28
540000 -- (-345.280) [-344.997] (-344.111) (-347.473) * (-344.066) [-344.468] (-348.864) (-346.451) -- 0:00:28
Average standard deviation of split frequencies: 0.008011
540500 -- [-344.233] (-345.401) (-343.507) (-347.797) * (-345.383) [-343.962] (-346.192) (-346.575) -- 0:00:28
541000 -- (-344.334) (-345.485) (-345.451) [-343.455] * (-344.644) (-347.389) (-345.631) [-347.062] -- 0:00:27
541500 -- (-345.286) (-344.975) [-344.433] (-345.237) * (-343.291) [-343.781] (-345.085) (-345.690) -- 0:00:27
542000 -- (-343.296) (-344.005) [-345.372] (-344.126) * (-347.123) [-345.379] (-349.444) (-349.803) -- 0:00:27
542500 -- (-344.598) (-344.685) (-347.264) [-345.660] * (-347.025) (-347.310) [-347.148] (-349.951) -- 0:00:27
543000 -- (-348.837) (-345.013) [-343.767] (-346.671) * (-349.104) (-345.520) (-345.342) [-346.464] -- 0:00:27
543500 -- [-348.069] (-349.810) (-350.653) (-347.850) * (-346.289) (-349.252) [-345.386] (-345.324) -- 0:00:27
544000 -- [-345.869] (-345.986) (-347.167) (-346.106) * (-344.505) (-354.676) [-348.012] (-344.415) -- 0:00:27
544500 -- (-348.727) (-344.131) [-345.663] (-345.763) * (-346.025) (-344.955) (-349.421) [-345.361] -- 0:00:27
545000 -- (-351.587) (-345.968) (-343.716) [-345.699] * (-345.528) (-346.435) [-344.606] (-345.661) -- 0:00:27
Average standard deviation of split frequencies: 0.008256
545500 -- (-350.191) [-345.531] (-345.205) (-344.594) * (-344.808) (-345.253) [-343.336] (-343.588) -- 0:00:27
546000 -- [-348.350] (-345.077) (-345.701) (-343.557) * [-345.776] (-344.293) (-345.330) (-343.206) -- 0:00:27
546500 -- (-346.347) [-345.240] (-344.044) (-345.778) * (-352.835) (-343.458) [-344.724] (-344.148) -- 0:00:28
547000 -- (-345.359) [-344.490] (-345.304) (-345.451) * (-343.930) [-344.846] (-345.082) (-343.801) -- 0:00:28
547500 -- [-343.750] (-345.933) (-344.081) (-348.279) * (-343.454) (-343.218) (-346.458) [-344.547] -- 0:00:28
548000 -- [-343.685] (-347.658) (-343.739) (-343.589) * (-345.745) (-344.369) [-345.499] (-346.480) -- 0:00:28
548500 -- [-343.373] (-345.734) (-345.654) (-344.384) * (-345.546) [-344.977] (-346.191) (-347.383) -- 0:00:27
549000 -- (-346.063) (-346.763) (-346.101) [-347.165] * [-343.855] (-345.139) (-344.991) (-346.484) -- 0:00:27
549500 -- (-346.418) (-344.895) (-345.274) [-345.029] * [-343.573] (-345.508) (-344.631) (-346.345) -- 0:00:27
550000 -- (-345.177) (-346.238) (-343.998) [-344.601] * (-346.619) (-345.917) (-345.649) [-349.307] -- 0:00:27
Average standard deviation of split frequencies: 0.008347
550500 -- (-347.498) (-343.924) (-346.241) [-344.075] * [-344.654] (-345.607) (-345.105) (-347.132) -- 0:00:27
551000 -- (-351.118) (-347.409) [-345.683] (-344.454) * (-344.083) (-345.211) (-344.541) [-347.124] -- 0:00:27
551500 -- (-347.261) [-345.047] (-348.627) (-346.298) * (-346.626) [-344.910] (-349.736) (-347.585) -- 0:00:27
552000 -- [-343.926] (-348.409) (-344.026) (-349.267) * [-345.756] (-345.275) (-346.424) (-345.621) -- 0:00:27
552500 -- (-347.796) (-346.352) [-344.220] (-347.514) * (-343.885) (-344.823) [-346.247] (-345.018) -- 0:00:27
553000 -- (-346.459) [-346.633] (-344.461) (-347.149) * (-347.156) [-345.164] (-346.038) (-347.008) -- 0:00:27
553500 -- [-343.996] (-346.231) (-344.121) (-344.118) * (-349.750) (-349.214) [-344.798] (-348.710) -- 0:00:27
554000 -- (-349.948) (-345.118) (-345.354) [-344.009] * (-346.642) (-345.026) [-344.429] (-345.568) -- 0:00:27
554500 -- (-347.975) [-345.460] (-344.727) (-345.948) * (-343.414) [-348.823] (-347.601) (-347.197) -- 0:00:27
555000 -- (-348.488) (-344.610) [-347.745] (-347.389) * (-345.305) (-345.179) (-345.265) [-345.920] -- 0:00:27
Average standard deviation of split frequencies: 0.008478
555500 -- [-345.673] (-345.030) (-344.750) (-348.157) * (-347.498) [-344.124] (-344.594) (-347.307) -- 0:00:27
556000 -- (-343.659) (-350.710) [-345.426] (-344.628) * (-345.617) (-345.687) [-346.601] (-345.637) -- 0:00:27
556500 -- (-344.742) [-343.757] (-344.844) (-349.993) * (-345.569) (-346.625) (-348.376) [-345.804] -- 0:00:27
557000 -- [-344.647] (-344.824) (-348.205) (-349.411) * (-345.773) (-348.739) (-344.518) [-345.469] -- 0:00:27
557500 -- (-345.131) [-345.826] (-346.129) (-345.121) * (-343.981) [-346.246] (-347.617) (-345.299) -- 0:00:26
558000 -- (-350.828) (-345.776) (-348.060) [-344.213] * [-347.551] (-345.369) (-345.979) (-346.096) -- 0:00:26
558500 -- (-344.433) [-346.709] (-344.530) (-345.243) * (-344.726) (-345.016) (-345.265) [-344.276] -- 0:00:26
559000 -- (-344.535) [-343.608] (-347.125) (-346.458) * [-343.686] (-347.497) (-343.727) (-346.769) -- 0:00:26
559500 -- (-345.597) (-345.022) (-348.352) [-347.439] * (-344.062) (-347.411) (-345.478) [-344.863] -- 0:00:26
560000 -- (-345.868) (-346.133) [-348.269] (-343.743) * [-343.767] (-346.520) (-347.932) (-343.988) -- 0:00:26
Average standard deviation of split frequencies: 0.008250
560500 -- (-344.181) (-344.462) [-346.104] (-343.959) * (-346.079) [-344.399] (-344.530) (-344.614) -- 0:00:26
561000 -- [-344.412] (-344.020) (-344.644) (-345.992) * (-346.986) (-346.066) (-349.615) [-344.886] -- 0:00:26
561500 -- (-344.862) (-343.396) (-345.209) [-348.327] * (-346.077) (-345.113) [-344.489] (-345.475) -- 0:00:26
562000 -- (-343.821) (-343.710) (-345.676) [-344.761] * (-343.737) [-344.849] (-344.521) (-344.976) -- 0:00:26
562500 -- [-343.956] (-344.066) (-350.077) (-347.361) * (-343.718) [-343.554] (-346.026) (-343.307) -- 0:00:26
563000 -- (-346.013) [-344.361] (-348.275) (-344.671) * [-343.827] (-344.296) (-344.736) (-344.118) -- 0:00:26
563500 -- (-347.205) (-344.847) (-346.092) [-345.566] * (-345.562) [-344.859] (-344.390) (-344.168) -- 0:00:27
564000 -- (-348.401) (-345.426) [-345.247] (-345.713) * (-344.284) (-346.012) [-345.275] (-345.685) -- 0:00:27
564500 -- (-346.500) (-344.891) (-344.884) [-345.061] * [-346.716] (-345.255) (-344.117) (-345.642) -- 0:00:27
565000 -- [-349.332] (-343.889) (-344.355) (-343.180) * [-346.235] (-344.838) (-344.067) (-345.299) -- 0:00:26
Average standard deviation of split frequencies: 0.008016
565500 -- (-344.580) (-346.741) [-344.491] (-343.283) * (-349.336) (-344.513) (-345.477) [-345.309] -- 0:00:26
566000 -- (-344.228) (-344.659) (-346.434) [-344.749] * (-345.692) (-343.814) (-347.568) [-346.493] -- 0:00:26
566500 -- [-344.967] (-344.536) (-350.504) (-344.037) * (-343.790) (-352.420) [-343.546] (-349.814) -- 0:00:26
567000 -- [-343.570] (-344.694) (-346.284) (-343.901) * (-344.077) (-356.573) [-343.726] (-345.214) -- 0:00:26
567500 -- (-343.385) (-345.329) [-343.423] (-346.296) * (-348.976) (-351.714) [-343.389] (-347.113) -- 0:00:26
568000 -- [-345.144] (-345.837) (-343.734) (-345.768) * (-348.987) (-350.115) (-345.105) [-344.332] -- 0:00:26
568500 -- [-345.831] (-345.504) (-345.473) (-345.174) * (-345.795) (-343.535) [-343.426] (-344.102) -- 0:00:26
569000 -- (-344.930) (-344.795) [-343.079] (-347.960) * (-349.906) (-346.960) [-343.150] (-348.874) -- 0:00:26
569500 -- [-345.543] (-346.011) (-344.044) (-350.520) * (-350.010) (-344.334) [-344.758] (-343.651) -- 0:00:26
570000 -- [-344.928] (-345.969) (-346.122) (-349.968) * [-345.121] (-344.859) (-345.471) (-346.593) -- 0:00:26
Average standard deviation of split frequencies: 0.008054
570500 -- (-343.316) (-347.103) [-346.314] (-348.847) * [-345.398] (-346.683) (-346.041) (-345.655) -- 0:00:26
571000 -- (-344.010) (-344.749) [-346.022] (-350.379) * (-344.505) [-346.002] (-343.465) (-350.058) -- 0:00:26
571500 -- (-344.546) [-344.274] (-346.633) (-351.349) * [-343.932] (-346.975) (-343.482) (-344.142) -- 0:00:26
572000 -- [-349.462] (-344.368) (-344.960) (-344.268) * [-343.782] (-346.349) (-345.374) (-346.328) -- 0:00:26
572500 -- [-347.453] (-343.802) (-345.275) (-344.189) * [-345.357] (-343.917) (-344.711) (-346.411) -- 0:00:26
573000 -- (-344.149) (-343.825) [-346.615] (-345.857) * (-345.381) [-345.005] (-344.806) (-344.233) -- 0:00:26
573500 -- [-344.292] (-348.619) (-348.081) (-344.182) * (-348.170) (-344.777) (-345.096) [-345.314] -- 0:00:26
574000 -- [-344.657] (-346.327) (-344.970) (-348.995) * (-345.348) [-345.798] (-345.827) (-345.870) -- 0:00:25
574500 -- (-344.817) [-345.486] (-345.431) (-345.238) * (-349.481) (-344.491) (-344.166) [-346.835] -- 0:00:25
575000 -- [-344.192] (-343.928) (-346.649) (-344.232) * [-347.630] (-344.524) (-345.925) (-344.751) -- 0:00:25
Average standard deviation of split frequencies: 0.008031
575500 -- [-345.691] (-349.352) (-343.952) (-344.300) * (-348.389) (-344.528) [-346.332] (-345.271) -- 0:00:25
576000 -- (-343.216) [-346.488] (-344.081) (-344.311) * [-344.324] (-345.760) (-345.511) (-348.507) -- 0:00:25
576500 -- [-346.193] (-343.650) (-345.452) (-346.483) * (-347.530) (-345.915) (-345.012) [-344.679] -- 0:00:25
577000 -- (-346.193) [-346.461] (-345.252) (-345.686) * (-344.954) [-344.949] (-345.816) (-347.667) -- 0:00:25
577500 -- (-346.410) (-345.451) [-348.410] (-344.507) * [-346.665] (-344.883) (-345.080) (-344.538) -- 0:00:25
578000 -- (-345.476) [-346.295] (-345.370) (-345.733) * (-345.172) (-344.634) [-345.125] (-346.069) -- 0:00:25
578500 -- (-349.806) [-352.436] (-347.125) (-346.130) * (-345.992) (-343.608) [-346.135] (-345.751) -- 0:00:25
579000 -- (-344.662) (-348.921) [-343.869] (-345.895) * (-344.172) (-344.756) [-343.766] (-343.869) -- 0:00:25
579500 -- (-346.249) (-345.525) [-345.955] (-347.030) * (-345.335) (-344.260) (-347.014) [-344.857] -- 0:00:25
580000 -- (-344.076) (-349.953) [-345.557] (-347.628) * [-347.748] (-347.188) (-346.107) (-343.421) -- 0:00:25
Average standard deviation of split frequencies: 0.007865
580500 -- (-344.822) (-344.807) [-348.339] (-347.570) * (-346.058) (-346.717) [-345.103] (-344.618) -- 0:00:26
581000 -- (-344.026) (-345.033) (-346.228) [-346.922] * (-346.327) (-344.875) (-344.287) [-344.543] -- 0:00:25
581500 -- (-346.154) [-345.430] (-344.036) (-346.213) * (-346.935) (-345.798) (-348.849) [-343.734] -- 0:00:25
582000 -- [-345.645] (-349.086) (-344.400) (-348.450) * [-344.413] (-348.040) (-348.912) (-345.455) -- 0:00:25
582500 -- (-345.130) [-346.047] (-344.587) (-345.205) * (-345.575) [-345.958] (-351.593) (-344.835) -- 0:00:25
583000 -- (-345.286) (-345.212) (-345.563) [-344.926] * [-351.970] (-343.701) (-344.572) (-347.652) -- 0:00:25
583500 -- (-343.536) [-345.499] (-345.017) (-347.612) * (-344.338) (-347.992) [-344.198] (-348.925) -- 0:00:25
584000 -- (-345.129) [-346.235] (-345.316) (-349.798) * (-344.547) [-344.829] (-345.593) (-348.202) -- 0:00:25
584500 -- [-343.883] (-344.066) (-349.183) (-344.587) * [-343.502] (-345.352) (-343.795) (-345.625) -- 0:00:25
585000 -- [-344.566] (-344.031) (-344.085) (-344.924) * (-347.286) (-346.134) (-347.014) [-344.242] -- 0:00:25
Average standard deviation of split frequencies: 0.008346
585500 -- (-345.486) (-343.826) [-343.963] (-348.036) * (-344.778) (-344.858) [-346.224] (-345.521) -- 0:00:25
586000 -- [-343.677] (-344.716) (-344.381) (-344.236) * [-345.693] (-346.075) (-344.577) (-345.334) -- 0:00:25
586500 -- [-343.684] (-344.595) (-347.759) (-344.398) * (-347.210) (-344.173) [-343.247] (-343.335) -- 0:00:25
587000 -- [-343.998] (-344.421) (-345.731) (-344.332) * (-345.467) (-345.734) (-343.793) [-345.597] -- 0:00:25
587500 -- (-344.493) (-344.363) (-348.003) [-345.520] * (-343.340) [-345.108] (-344.011) (-343.574) -- 0:00:25
588000 -- (-345.532) [-345.938] (-346.712) (-349.906) * (-348.562) [-343.857] (-346.223) (-347.797) -- 0:00:25
588500 -- [-345.339] (-346.908) (-354.693) (-348.340) * (-344.481) (-345.126) (-343.405) [-344.492] -- 0:00:25
589000 -- (-350.477) (-349.134) (-344.031) [-345.258] * (-344.925) (-351.950) [-345.723] (-346.736) -- 0:00:25
589500 -- (-349.570) (-343.882) (-345.182) [-346.763] * (-346.851) (-345.712) [-345.358] (-346.126) -- 0:00:25
590000 -- (-349.546) (-343.477) (-343.993) [-345.352] * [-345.332] (-345.018) (-345.462) (-345.056) -- 0:00:25
Average standard deviation of split frequencies: 0.008280
590500 -- (-345.851) [-344.984] (-347.403) (-346.440) * (-344.987) (-347.238) (-343.568) [-344.201] -- 0:00:24
591000 -- (-348.004) (-344.012) (-348.436) [-347.058] * [-345.777] (-345.252) (-344.214) (-343.945) -- 0:00:24
591500 -- (-345.945) (-343.635) (-344.610) [-345.411] * [-346.686] (-345.589) (-346.238) (-345.579) -- 0:00:24
592000 -- (-343.931) [-344.650] (-343.883) (-344.330) * (-347.366) (-346.841) [-345.668] (-345.488) -- 0:00:24
592500 -- (-350.219) (-346.183) (-346.256) [-343.597] * (-343.673) (-344.514) [-343.360] (-345.401) -- 0:00:24
593000 -- (-347.645) (-344.767) [-343.812] (-344.799) * (-347.844) (-345.048) (-348.190) [-347.534] -- 0:00:24
593500 -- (-349.358) (-344.281) (-344.115) [-345.810] * (-345.144) [-345.238] (-344.756) (-343.620) -- 0:00:24
594000 -- (-346.364) (-344.953) [-344.109] (-346.882) * [-345.991] (-345.565) (-345.767) (-346.313) -- 0:00:24
594500 -- (-346.371) (-344.045) [-343.510] (-344.641) * (-345.158) (-344.235) [-345.847] (-344.797) -- 0:00:24
595000 -- (-344.425) (-345.034) (-343.416) [-346.556] * [-345.242] (-344.956) (-345.902) (-344.320) -- 0:00:24
Average standard deviation of split frequencies: 0.007415
595500 -- [-347.791] (-349.002) (-344.352) (-345.929) * (-344.570) (-344.779) [-347.216] (-345.697) -- 0:00:24
596000 -- [-345.061] (-349.096) (-343.278) (-348.384) * (-345.637) [-347.328] (-343.743) (-345.938) -- 0:00:24
596500 -- (-346.271) (-345.106) (-345.753) [-345.712] * (-349.789) (-344.553) [-344.834] (-345.928) -- 0:00:24
597000 -- (-346.491) (-344.619) [-345.808] (-344.467) * (-345.482) (-343.861) [-346.294] (-347.849) -- 0:00:24
597500 -- (-345.461) (-345.038) [-346.347] (-344.698) * (-344.324) [-344.954] (-344.999) (-348.276) -- 0:00:24
598000 -- [-343.903] (-344.997) (-345.347) (-345.441) * [-348.583] (-344.840) (-345.021) (-347.524) -- 0:00:24
598500 -- (-347.729) (-346.158) (-345.613) [-349.271] * (-343.904) (-344.623) [-344.050] (-344.148) -- 0:00:24
599000 -- [-345.808] (-347.199) (-344.084) (-349.480) * (-347.474) [-344.547] (-345.707) (-345.979) -- 0:00:24
599500 -- (-349.669) (-347.694) [-344.904] (-351.342) * (-345.358) (-343.587) (-345.162) [-344.081] -- 0:00:24
600000 -- (-347.358) [-345.300] (-345.477) (-350.297) * (-344.815) (-348.043) (-346.741) [-345.445] -- 0:00:24
Average standard deviation of split frequencies: 0.007210
600500 -- (-346.216) [-343.618] (-347.626) (-344.069) * (-349.972) (-348.364) (-344.068) [-347.837] -- 0:00:24
601000 -- (-344.815) (-346.799) (-343.725) [-345.199] * (-348.284) (-345.842) [-343.830] (-350.026) -- 0:00:24
601500 -- (-343.569) (-346.742) [-343.854] (-343.584) * (-344.249) (-346.386) (-344.774) [-345.610] -- 0:00:24
602000 -- (-343.647) [-344.924] (-343.912) (-344.565) * (-343.866) (-345.647) (-344.840) [-346.036] -- 0:00:24
602500 -- (-344.886) (-343.407) [-343.344] (-343.470) * (-345.539) (-345.352) [-345.894] (-346.308) -- 0:00:24
603000 -- (-344.330) (-347.390) [-343.388] (-346.943) * [-344.787] (-346.824) (-345.193) (-345.051) -- 0:00:24
603500 -- [-344.140] (-346.084) (-346.328) (-344.446) * [-345.676] (-345.534) (-350.783) (-344.606) -- 0:00:24
604000 -- (-344.743) (-344.447) [-344.547] (-343.434) * [-347.454] (-349.931) (-347.473) (-344.611) -- 0:00:24
604500 -- (-344.163) [-343.926] (-344.617) (-346.284) * [-345.030] (-349.470) (-346.915) (-344.881) -- 0:00:24
605000 -- (-347.339) (-344.874) [-350.114] (-345.686) * [-345.347] (-345.846) (-346.764) (-344.724) -- 0:00:24
Average standard deviation of split frequencies: 0.007105
605500 -- (-345.104) [-346.242] (-344.982) (-346.730) * (-344.806) (-348.050) [-345.392] (-349.844) -- 0:00:24
606000 -- [-345.888] (-344.670) (-345.655) (-346.211) * [-344.120] (-345.602) (-345.948) (-347.198) -- 0:00:24
606500 -- (-348.910) (-345.979) [-347.086] (-344.674) * (-347.218) (-345.665) (-344.559) [-344.591] -- 0:00:24
607000 -- (-344.238) [-344.137] (-345.658) (-346.823) * (-346.321) (-346.592) [-343.621] (-345.682) -- 0:00:23
607500 -- (-344.325) [-349.980] (-344.390) (-343.621) * [-348.578] (-347.176) (-347.931) (-346.335) -- 0:00:23
608000 -- (-345.857) (-344.932) (-348.139) [-346.127] * (-347.250) [-345.756] (-347.371) (-346.572) -- 0:00:23
608500 -- (-344.343) (-352.052) (-346.897) [-346.016] * (-344.815) [-343.308] (-346.378) (-348.486) -- 0:00:23
609000 -- (-345.446) (-344.328) (-347.782) [-353.584] * [-344.847] (-345.328) (-344.519) (-353.112) -- 0:00:23
609500 -- [-345.901] (-344.819) (-345.473) (-346.588) * [-346.757] (-344.161) (-345.757) (-345.261) -- 0:00:23
610000 -- (-347.807) (-345.255) (-347.915) [-344.445] * [-347.199] (-347.687) (-344.236) (-346.238) -- 0:00:23
Average standard deviation of split frequencies: 0.006948
610500 -- [-346.851] (-345.148) (-348.313) (-345.038) * (-344.694) [-347.573] (-344.270) (-345.622) -- 0:00:23
611000 -- (-345.718) (-344.663) [-344.985] (-345.300) * (-345.751) (-344.893) (-344.035) [-350.039] -- 0:00:23
611500 -- [-345.605] (-345.244) (-345.479) (-346.055) * [-344.305] (-345.318) (-343.522) (-344.483) -- 0:00:23
612000 -- [-345.252] (-345.771) (-344.248) (-345.535) * (-345.960) [-344.255] (-344.231) (-345.835) -- 0:00:23
612500 -- (-346.842) (-346.121) (-345.862) [-347.958] * (-343.832) [-347.018] (-345.914) (-348.825) -- 0:00:23
613000 -- (-345.181) (-346.504) [-344.489] (-345.439) * (-344.058) (-343.915) (-345.709) [-349.078] -- 0:00:23
613500 -- (-343.831) (-347.460) (-345.984) [-347.029] * [-344.853] (-344.370) (-344.510) (-344.280) -- 0:00:23
614000 -- [-344.986] (-346.702) (-347.459) (-345.054) * (-345.323) [-347.249] (-345.072) (-344.324) -- 0:00:23
614500 -- [-348.051] (-344.696) (-345.987) (-346.298) * (-344.039) (-348.883) (-346.238) [-344.677] -- 0:00:23
615000 -- (-344.295) (-346.223) [-346.453] (-344.213) * [-343.901] (-346.381) (-344.001) (-343.889) -- 0:00:23
Average standard deviation of split frequencies: 0.006938
615500 -- (-346.254) (-344.762) [-343.407] (-344.934) * (-345.177) [-345.620] (-347.375) (-345.311) -- 0:00:23
616000 -- (-344.667) (-349.957) [-344.127] (-343.775) * (-346.422) (-345.432) (-346.020) [-344.736] -- 0:00:23
616500 -- (-347.445) (-344.541) (-345.028) [-344.952] * (-346.536) (-345.279) [-346.648] (-346.612) -- 0:00:23
617000 -- [-344.775] (-345.517) (-346.259) (-345.029) * (-348.270) [-344.421] (-347.996) (-344.902) -- 0:00:23
617500 -- [-345.430] (-344.625) (-345.929) (-345.821) * [-343.352] (-344.442) (-345.879) (-346.351) -- 0:00:23
618000 -- [-344.241] (-343.628) (-346.326) (-345.339) * (-345.839) (-350.295) [-346.286] (-344.525) -- 0:00:23
618500 -- (-346.042) (-344.868) [-346.171] (-346.022) * [-343.997] (-345.212) (-344.700) (-343.684) -- 0:00:23
619000 -- (-344.756) [-348.594] (-346.616) (-346.405) * [-344.385] (-346.425) (-344.362) (-344.281) -- 0:00:23
619500 -- (-343.505) (-344.722) [-344.884] (-344.492) * (-346.561) [-344.819] (-343.514) (-349.997) -- 0:00:23
620000 -- (-344.951) [-347.283] (-348.988) (-345.535) * (-344.942) [-346.773] (-343.642) (-344.906) -- 0:00:23
Average standard deviation of split frequencies: 0.007342
620500 -- (-346.361) (-348.800) [-346.075] (-345.498) * [-343.457] (-344.430) (-344.827) (-344.160) -- 0:00:23
621000 -- (-344.062) (-344.029) [-345.199] (-347.085) * (-347.815) (-344.396) (-347.667) [-343.853] -- 0:00:23
621500 -- [-344.343] (-344.494) (-346.192) (-345.427) * (-348.477) [-344.759] (-348.064) (-343.703) -- 0:00:23
622000 -- (-345.059) (-345.947) [-345.822] (-344.935) * (-345.938) [-347.257] (-344.312) (-343.325) -- 0:00:23
622500 -- (-345.926) [-346.363] (-348.844) (-346.240) * (-346.750) (-345.636) (-344.376) [-343.480] -- 0:00:23
623000 -- (-353.590) (-343.922) [-346.290] (-344.039) * (-346.902) [-349.062] (-352.155) (-344.744) -- 0:00:22
623500 -- (-345.008) [-348.193] (-343.647) (-345.020) * (-352.012) [-345.756] (-346.923) (-346.911) -- 0:00:22
624000 -- (-343.352) (-344.233) [-344.099] (-345.749) * [-345.884] (-344.202) (-348.855) (-343.922) -- 0:00:22
624500 -- (-349.695) (-343.417) [-344.009] (-344.462) * (-345.231) (-347.099) [-347.446] (-344.788) -- 0:00:22
625000 -- (-344.259) [-344.158] (-345.423) (-344.076) * (-346.933) (-347.622) [-347.360] (-346.736) -- 0:00:22
Average standard deviation of split frequencies: 0.007480
625500 -- (-346.000) (-343.756) (-345.475) [-345.834] * (-345.193) (-347.720) (-346.579) [-346.107] -- 0:00:22
626000 -- (-348.720) (-343.887) [-345.881] (-345.373) * [-343.795] (-347.608) (-347.612) (-345.993) -- 0:00:22
626500 -- (-349.091) (-346.096) (-344.167) [-346.236] * (-347.706) (-345.935) (-348.002) [-343.777] -- 0:00:22
627000 -- [-344.931] (-346.509) (-344.405) (-349.090) * (-349.728) (-344.361) (-346.736) [-345.555] -- 0:00:22
627500 -- [-345.299] (-345.155) (-343.613) (-346.480) * (-346.760) [-345.047] (-343.508) (-344.004) -- 0:00:22
628000 -- (-349.841) (-344.896) (-343.639) [-346.296] * (-344.285) (-349.343) (-344.194) [-344.274] -- 0:00:22
628500 -- (-348.362) [-345.812] (-344.987) (-347.559) * (-347.997) (-343.798) (-344.356) [-344.679] -- 0:00:22
629000 -- [-344.872] (-346.409) (-344.980) (-348.285) * (-350.415) (-343.921) (-345.187) [-347.140] -- 0:00:22
629500 -- (-345.185) [-345.588] (-343.462) (-343.556) * [-349.605] (-344.748) (-345.458) (-347.349) -- 0:00:22
630000 -- (-343.499) (-344.059) [-344.052] (-347.660) * (-346.596) (-347.604) (-346.136) [-344.746] -- 0:00:22
Average standard deviation of split frequencies: 0.007873
630500 -- [-343.523] (-345.425) (-343.656) (-345.887) * (-344.854) (-346.231) (-345.145) [-343.653] -- 0:00:22
631000 -- [-343.613] (-346.568) (-345.757) (-345.251) * (-346.939) (-344.548) (-347.340) [-347.230] -- 0:00:22
631500 -- (-344.282) (-343.813) (-345.850) [-344.760] * (-346.433) (-343.918) (-348.613) [-344.920] -- 0:00:22
632000 -- [-345.962] (-344.175) (-346.879) (-344.139) * [-346.510] (-349.660) (-344.546) (-344.729) -- 0:00:22
632500 -- (-348.981) (-345.152) (-346.611) [-343.516] * [-344.891] (-343.651) (-346.270) (-345.218) -- 0:00:22
633000 -- (-345.572) [-344.286] (-345.767) (-345.083) * (-346.721) [-347.145] (-346.357) (-344.627) -- 0:00:22
633500 -- (-346.188) (-344.066) [-345.604] (-345.146) * (-344.737) (-344.085) [-344.508] (-348.776) -- 0:00:22
634000 -- (-346.036) [-345.370] (-345.534) (-345.174) * [-343.668] (-345.734) (-345.337) (-349.109) -- 0:00:22
634500 -- [-348.127] (-343.826) (-346.057) (-345.530) * (-344.495) [-348.597] (-343.964) (-343.308) -- 0:00:22
635000 -- (-347.442) (-344.351) (-350.944) [-346.738] * [-344.877] (-345.372) (-347.897) (-343.870) -- 0:00:22
Average standard deviation of split frequencies: 0.008153
635500 -- (-344.613) (-347.700) [-345.080] (-348.204) * (-344.477) (-346.014) (-344.119) [-344.482] -- 0:00:22
636000 -- [-346.249] (-347.826) (-343.393) (-343.961) * (-343.459) (-346.361) [-343.995] (-343.060) -- 0:00:22
636500 -- (-343.395) (-346.357) (-345.430) [-345.541] * (-351.551) (-345.987) (-345.717) [-345.055] -- 0:00:22
637000 -- (-345.212) [-347.954] (-345.239) (-344.358) * (-348.968) (-346.349) (-345.179) [-344.788] -- 0:00:22
637500 -- [-345.582] (-347.844) (-344.722) (-345.937) * (-346.908) [-344.488] (-344.928) (-346.816) -- 0:00:22
638000 -- [-343.523] (-343.720) (-343.508) (-347.010) * (-346.642) [-346.288] (-346.791) (-344.708) -- 0:00:22
638500 -- (-343.918) (-347.128) (-346.392) [-346.459] * [-343.491] (-346.208) (-345.255) (-344.632) -- 0:00:22
639000 -- [-347.414] (-345.203) (-347.820) (-346.112) * (-345.478) [-346.624] (-344.831) (-344.037) -- 0:00:22
639500 -- [-347.508] (-345.743) (-347.875) (-344.922) * [-343.724] (-345.178) (-345.916) (-350.696) -- 0:00:21
640000 -- (-347.344) [-349.256] (-345.635) (-343.514) * (-344.352) [-343.825] (-346.454) (-346.312) -- 0:00:21
Average standard deviation of split frequencies: 0.007849
640500 -- (-343.481) (-347.286) (-346.267) [-345.066] * [-343.596] (-344.852) (-345.200) (-345.763) -- 0:00:21
641000 -- (-345.332) (-345.499) (-345.416) [-348.808] * [-345.569] (-345.998) (-346.612) (-343.787) -- 0:00:21
641500 -- [-345.773] (-345.419) (-343.957) (-348.145) * [-345.150] (-345.941) (-344.223) (-343.460) -- 0:00:21
642000 -- [-346.256] (-349.444) (-345.458) (-349.445) * (-345.347) (-345.068) [-345.104] (-344.523) -- 0:00:21
642500 -- (-344.783) [-345.606] (-346.900) (-344.761) * [-344.908] (-344.074) (-347.293) (-347.044) -- 0:00:21
643000 -- (-343.940) [-343.725] (-346.329) (-344.658) * (-344.964) [-345.014] (-348.429) (-345.846) -- 0:00:21
643500 -- (-343.489) [-347.159] (-344.155) (-343.883) * [-343.910] (-344.318) (-344.900) (-344.438) -- 0:00:21
644000 -- [-344.503] (-345.278) (-345.098) (-343.713) * (-343.853) (-343.923) (-344.300) [-346.594] -- 0:00:22
644500 -- [-344.700] (-348.672) (-345.008) (-346.239) * (-345.055) [-344.308] (-344.867) (-347.434) -- 0:00:22
645000 -- (-346.844) (-348.537) [-344.608] (-344.392) * (-346.142) (-344.423) (-346.074) [-345.697] -- 0:00:22
Average standard deviation of split frequencies: 0.007832
645500 -- (-344.648) (-343.523) [-344.058] (-345.545) * (-344.670) (-345.355) [-345.417] (-344.316) -- 0:00:21
646000 -- [-348.031] (-344.437) (-343.951) (-347.508) * (-343.850) (-345.589) [-343.497] (-347.906) -- 0:00:21
646500 -- [-345.329] (-349.821) (-345.639) (-345.489) * (-345.879) (-344.079) [-344.969] (-348.436) -- 0:00:21
647000 -- (-344.957) (-344.151) (-345.607) [-346.303] * (-347.451) [-344.321] (-343.780) (-345.187) -- 0:00:21
647500 -- (-345.820) (-345.313) [-345.313] (-347.754) * [-346.326] (-346.194) (-348.331) (-345.872) -- 0:00:21
648000 -- (-349.250) (-347.660) [-344.029] (-346.313) * (-345.062) (-349.168) (-351.829) [-345.147] -- 0:00:21
648500 -- (-347.905) (-348.808) [-352.535] (-348.760) * (-345.425) (-345.264) [-346.395] (-345.717) -- 0:00:21
649000 -- (-347.675) (-345.396) [-344.949] (-344.851) * (-343.424) [-348.385] (-343.826) (-345.410) -- 0:00:21
649500 -- (-346.679) (-344.559) (-350.184) [-344.907] * (-346.891) (-349.015) (-344.124) [-344.843] -- 0:00:21
650000 -- (-346.483) (-344.813) (-346.047) [-344.898] * (-348.675) (-347.035) (-344.374) [-344.214] -- 0:00:21
Average standard deviation of split frequencies: 0.007535
650500 -- (-348.526) (-345.216) (-344.733) [-346.304] * (-346.008) (-347.261) (-344.695) [-345.178] -- 0:00:21
651000 -- [-349.863] (-345.910) (-344.810) (-345.206) * (-347.276) (-344.358) [-344.833] (-351.836) -- 0:00:21
651500 -- (-345.311) (-347.172) (-344.379) [-343.946] * [-345.920] (-343.117) (-345.988) (-347.441) -- 0:00:21
652000 -- (-346.581) (-345.877) [-344.666] (-345.933) * [-346.809] (-353.167) (-345.608) (-345.588) -- 0:00:21
652500 -- (-345.778) [-345.081] (-349.077) (-345.725) * [-344.781] (-346.015) (-345.307) (-345.854) -- 0:00:21
653000 -- (-348.436) (-345.479) (-348.142) [-344.835] * (-345.653) (-348.113) [-343.245] (-346.876) -- 0:00:21
653500 -- (-345.921) (-345.386) (-345.880) [-344.963] * (-345.809) (-345.023) [-346.483] (-343.784) -- 0:00:21
654000 -- (-349.221) [-346.289] (-343.381) (-344.248) * (-344.137) (-346.040) [-345.074] (-347.677) -- 0:00:21
654500 -- (-351.102) (-343.713) [-344.674] (-343.793) * (-345.963) [-346.067] (-344.665) (-344.174) -- 0:00:21
655000 -- (-352.261) [-343.795] (-344.505) (-345.044) * [-345.695] (-343.691) (-343.279) (-345.218) -- 0:00:21
Average standard deviation of split frequencies: 0.007761
655500 -- (-348.305) [-343.142] (-344.321) (-344.135) * [-345.447] (-345.397) (-343.398) (-345.707) -- 0:00:21
656000 -- (-346.808) (-343.154) [-345.842] (-344.135) * (-349.445) (-348.801) [-344.612] (-349.372) -- 0:00:20
656500 -- (-346.907) [-345.658] (-349.024) (-348.314) * (-346.763) [-347.288] (-343.933) (-346.824) -- 0:00:20
657000 -- (-344.836) [-344.356] (-345.102) (-345.073) * (-348.663) [-344.884] (-345.069) (-348.133) -- 0:00:20
657500 -- (-345.482) [-344.349] (-344.728) (-343.206) * (-343.881) (-345.009) (-344.225) [-345.197] -- 0:00:20
658000 -- [-343.885] (-347.434) (-346.272) (-345.985) * (-346.255) (-345.626) (-345.935) [-345.084] -- 0:00:20
658500 -- (-345.089) [-344.426] (-343.903) (-346.267) * (-347.790) (-345.592) (-346.373) [-344.929] -- 0:00:20
659000 -- [-344.932] (-344.361) (-348.665) (-343.821) * [-344.122] (-345.746) (-346.051) (-343.674) -- 0:00:20
659500 -- (-346.652) (-345.892) [-344.940] (-344.233) * [-344.255] (-346.349) (-345.310) (-347.306) -- 0:00:20
660000 -- [-345.343] (-345.454) (-343.888) (-343.728) * (-344.701) (-346.699) [-348.452] (-346.714) -- 0:00:21
Average standard deviation of split frequencies: 0.007326
660500 -- (-345.698) [-347.472] (-344.203) (-343.145) * [-344.316] (-344.991) (-344.386) (-345.008) -- 0:00:21
661000 -- (-349.896) [-344.095] (-343.881) (-344.848) * (-345.761) (-346.696) [-345.543] (-345.282) -- 0:00:21
661500 -- (-344.139) [-343.890] (-345.496) (-347.298) * (-343.688) (-344.480) (-345.201) [-347.887] -- 0:00:20
662000 -- (-349.695) (-346.167) [-344.549] (-345.904) * (-345.801) (-344.488) (-345.639) [-348.170] -- 0:00:20
662500 -- (-344.598) (-346.058) (-345.449) [-344.341] * (-347.056) [-343.768] (-348.528) (-356.555) -- 0:00:20
663000 -- [-345.733] (-345.217) (-345.262) (-344.053) * [-344.629] (-343.776) (-346.684) (-345.228) -- 0:00:20
663500 -- (-344.005) (-346.625) [-345.037] (-343.220) * (-344.468) [-345.540] (-345.717) (-348.302) -- 0:00:20
664000 -- (-346.452) [-345.242] (-346.009) (-345.118) * (-343.933) [-344.869] (-347.340) (-344.070) -- 0:00:20
664500 -- (-345.854) [-346.015] (-348.209) (-346.163) * (-343.897) (-346.560) (-347.362) [-346.125] -- 0:00:20
665000 -- (-343.726) [-343.425] (-347.254) (-344.370) * [-345.258] (-345.631) (-345.601) (-344.879) -- 0:00:20
Average standard deviation of split frequencies: 0.007125
665500 -- (-345.789) (-345.125) [-344.811] (-343.272) * (-345.695) [-346.308] (-344.023) (-347.283) -- 0:00:20
666000 -- (-346.248) (-350.123) [-344.653] (-347.313) * [-344.794] (-346.458) (-344.160) (-345.752) -- 0:00:20
666500 -- (-345.199) (-344.005) [-344.142] (-345.479) * (-348.885) (-352.597) [-343.752] (-344.441) -- 0:00:20
667000 -- (-345.339) (-344.997) (-344.522) [-345.534] * [-346.876] (-348.264) (-343.403) (-346.454) -- 0:00:20
667500 -- (-343.897) [-346.135] (-346.072) (-346.756) * (-346.820) (-347.175) [-344.985] (-344.833) -- 0:00:20
668000 -- (-344.987) [-346.492] (-347.646) (-343.174) * (-345.975) [-348.206] (-344.595) (-346.688) -- 0:00:20
668500 -- (-344.419) [-343.582] (-344.621) (-346.340) * [-344.924] (-345.820) (-344.318) (-345.133) -- 0:00:20
669000 -- (-344.936) [-344.675] (-345.857) (-343.141) * (-343.593) [-346.697] (-343.742) (-349.444) -- 0:00:20
669500 -- (-344.624) [-344.236] (-344.016) (-345.548) * (-345.941) (-344.503) (-344.662) [-345.189] -- 0:00:20
670000 -- (-343.812) [-345.546] (-348.071) (-345.372) * (-343.739) (-346.647) (-344.244) [-344.713] -- 0:00:20
Average standard deviation of split frequencies: 0.007497
670500 -- (-346.437) (-345.175) [-347.748] (-347.518) * (-347.515) (-347.266) [-343.901] (-348.347) -- 0:00:20
671000 -- (-348.223) [-343.494] (-346.526) (-344.682) * (-347.173) (-344.675) [-343.523] (-345.875) -- 0:00:20
671500 -- (-344.266) [-345.918] (-349.312) (-351.032) * [-346.135] (-347.472) (-350.042) (-346.565) -- 0:00:20
672000 -- [-343.833] (-349.062) (-343.286) (-347.361) * [-343.733] (-347.700) (-348.356) (-345.251) -- 0:00:20
672500 -- (-345.191) [-344.637] (-346.950) (-345.621) * [-343.587] (-343.569) (-348.485) (-345.790) -- 0:00:19
673000 -- (-349.175) [-345.281] (-343.856) (-347.097) * [-343.173] (-343.631) (-344.882) (-343.841) -- 0:00:19
673500 -- (-348.439) (-347.268) (-345.483) [-345.376] * (-345.124) (-343.963) [-343.943] (-348.276) -- 0:00:19
674000 -- (-343.624) (-345.121) [-343.754] (-349.008) * (-346.813) (-346.339) [-345.400] (-343.648) -- 0:00:19
674500 -- (-344.044) (-344.505) [-343.957] (-346.608) * (-347.766) [-350.742] (-349.927) (-344.816) -- 0:00:19
675000 -- [-343.644] (-343.603) (-344.856) (-345.747) * (-348.777) (-349.874) (-351.681) [-345.042] -- 0:00:19
Average standard deviation of split frequencies: 0.006880
675500 -- (-344.013) [-343.642] (-344.298) (-343.928) * [-346.221] (-346.103) (-347.847) (-345.425) -- 0:00:19
676000 -- (-344.278) (-343.642) [-347.487] (-343.775) * (-345.467) (-343.637) (-345.039) [-346.107] -- 0:00:20
676500 -- [-344.019] (-344.033) (-344.092) (-345.827) * (-347.131) (-343.919) (-347.746) [-346.436] -- 0:00:20
677000 -- [-344.373] (-344.261) (-346.710) (-344.477) * (-346.093) (-344.935) (-346.438) [-344.908] -- 0:00:20
677500 -- (-349.578) [-344.156] (-348.716) (-347.231) * (-347.763) (-347.297) (-345.180) [-344.633] -- 0:00:19
678000 -- [-349.034] (-345.564) (-346.845) (-344.947) * (-345.373) (-346.949) [-344.574] (-346.975) -- 0:00:19
678500 -- (-346.950) (-350.557) (-345.697) [-344.835] * [-345.471] (-345.071) (-345.687) (-345.839) -- 0:00:19
679000 -- (-344.988) (-343.584) (-346.245) [-344.322] * [-344.516] (-345.272) (-346.679) (-344.252) -- 0:00:19
679500 -- (-347.460) (-345.441) [-344.074] (-345.501) * [-346.326] (-348.512) (-345.213) (-348.743) -- 0:00:19
680000 -- (-346.614) (-344.457) [-344.589] (-347.531) * (-348.000) (-344.979) (-344.741) [-344.374] -- 0:00:19
Average standard deviation of split frequencies: 0.006556
680500 -- (-344.198) [-344.669] (-348.468) (-348.280) * (-347.865) (-345.057) [-344.996] (-344.584) -- 0:00:19
681000 -- (-345.782) (-345.911) (-344.645) [-346.973] * (-346.040) [-345.501] (-347.688) (-343.945) -- 0:00:19
681500 -- (-343.340) (-346.124) (-343.252) [-345.968] * (-347.823) (-343.563) [-346.225] (-347.184) -- 0:00:19
682000 -- (-344.638) [-346.094] (-345.023) (-343.630) * (-345.282) [-349.278] (-343.942) (-346.437) -- 0:00:19
682500 -- (-348.888) [-344.702] (-344.436) (-344.086) * (-346.164) (-348.777) (-345.525) [-343.762] -- 0:00:19
683000 -- (-345.486) (-345.231) (-343.662) [-346.199] * [-346.421] (-346.349) (-345.275) (-344.545) -- 0:00:19
683500 -- (-348.305) (-344.981) [-350.009] (-343.596) * (-346.940) (-345.734) [-346.664] (-344.200) -- 0:00:19
684000 -- (-348.816) (-347.743) [-349.531] (-344.527) * (-348.183) (-345.258) [-343.933] (-344.033) -- 0:00:19
684500 -- (-345.382) [-344.715] (-345.089) (-343.745) * (-346.290) [-345.809] (-347.197) (-346.066) -- 0:00:19
685000 -- (-346.900) [-345.190] (-343.672) (-343.944) * [-345.649] (-346.717) (-343.540) (-344.493) -- 0:00:19
Average standard deviation of split frequencies: 0.006826
685500 -- (-345.859) (-345.487) (-343.966) [-348.038] * [-345.134] (-344.912) (-346.479) (-344.695) -- 0:00:19
686000 -- [-344.955] (-349.264) (-345.417) (-345.203) * (-348.910) [-346.033] (-344.626) (-343.356) -- 0:00:19
686500 -- [-343.050] (-344.284) (-344.873) (-345.915) * [-344.108] (-344.070) (-344.355) (-343.952) -- 0:00:19
687000 -- (-345.982) (-343.507) (-344.618) [-344.541] * (-345.256) [-343.899] (-348.628) (-345.753) -- 0:00:19
687500 -- (-347.051) (-345.193) [-346.717] (-345.420) * [-345.391] (-346.979) (-345.004) (-347.590) -- 0:00:19
688000 -- (-344.493) [-348.120] (-344.294) (-344.613) * [-344.117] (-347.915) (-344.886) (-347.189) -- 0:00:19
688500 -- (-344.800) (-350.646) [-344.774] (-344.091) * (-345.191) (-349.498) (-348.853) [-345.081] -- 0:00:19
689000 -- (-345.349) (-346.581) [-345.740] (-345.442) * (-346.532) [-347.981] (-345.105) (-346.151) -- 0:00:18
689500 -- (-345.470) (-346.845) (-346.548) [-344.388] * (-344.225) (-349.109) [-344.656] (-345.287) -- 0:00:18
690000 -- (-344.657) [-344.251] (-345.136) (-345.016) * (-343.333) (-349.048) (-344.139) [-344.361] -- 0:00:18
Average standard deviation of split frequencies: 0.006825
690500 -- (-343.558) (-344.295) [-344.596] (-347.252) * [-343.559] (-346.185) (-345.615) (-346.646) -- 0:00:18
691000 -- (-343.789) (-345.434) [-345.396] (-343.800) * (-345.033) (-344.917) (-344.233) [-344.711] -- 0:00:18
691500 -- (-346.102) (-343.519) [-344.342] (-344.037) * [-345.586] (-347.185) (-349.684) (-345.591) -- 0:00:18
692000 -- [-346.507] (-343.995) (-345.218) (-344.356) * [-344.578] (-343.971) (-348.973) (-345.239) -- 0:00:18
692500 -- (-345.636) (-344.914) [-343.413] (-349.520) * (-343.174) [-347.350] (-346.033) (-346.944) -- 0:00:19
693000 -- (-348.131) [-345.683] (-344.127) (-347.316) * (-343.408) (-346.422) [-346.481] (-347.167) -- 0:00:19
693500 -- (-347.182) (-343.741) [-344.962] (-344.312) * (-344.479) (-346.801) [-347.321] (-347.030) -- 0:00:19
694000 -- (-347.633) (-344.338) [-344.557] (-344.053) * (-346.443) [-343.748] (-343.766) (-346.036) -- 0:00:18
694500 -- [-347.368] (-344.169) (-343.268) (-345.576) * (-344.753) [-345.613] (-348.369) (-344.342) -- 0:00:18
695000 -- (-349.074) [-345.706] (-344.330) (-344.533) * (-345.442) (-347.409) [-344.000] (-343.254) -- 0:00:18
Average standard deviation of split frequencies: 0.006773
695500 -- (-350.601) (-346.410) (-345.146) [-346.050] * (-346.654) (-344.865) (-343.701) [-344.771] -- 0:00:18
696000 -- (-348.001) [-345.426] (-345.154) (-343.947) * (-344.888) (-345.139) (-344.262) [-344.176] -- 0:00:18
696500 -- (-345.785) [-346.957] (-346.363) (-346.437) * (-343.529) [-344.949] (-347.356) (-344.252) -- 0:00:18
697000 -- [-343.658] (-344.445) (-346.447) (-344.598) * (-350.665) (-345.696) (-347.088) [-344.627] -- 0:00:18
697500 -- (-344.140) (-345.642) [-345.645] (-347.004) * (-345.815) [-343.975] (-346.930) (-345.068) -- 0:00:18
698000 -- (-344.412) (-345.877) (-344.601) [-345.214] * (-347.936) [-345.815] (-345.918) (-345.441) -- 0:00:18
698500 -- (-343.230) (-346.948) [-349.250] (-347.224) * (-346.602) [-346.291] (-343.554) (-349.308) -- 0:00:18
699000 -- [-344.465] (-344.553) (-345.334) (-347.132) * (-348.520) [-344.867] (-348.119) (-343.826) -- 0:00:18
699500 -- (-344.267) (-345.678) [-344.595] (-345.231) * (-344.727) (-347.872) [-348.980] (-344.852) -- 0:00:18
700000 -- (-344.020) (-348.731) (-343.416) [-344.487] * (-347.398) (-343.382) (-347.281) [-344.422] -- 0:00:18
Average standard deviation of split frequencies: 0.006728
700500 -- (-343.541) [-345.776] (-343.847) (-345.171) * (-346.662) [-343.538] (-343.717) (-344.535) -- 0:00:18
701000 -- (-344.980) (-348.664) [-344.242] (-344.738) * [-345.300] (-343.822) (-344.284) (-345.058) -- 0:00:18
701500 -- [-344.452] (-349.128) (-343.964) (-345.158) * (-344.491) (-343.928) (-350.871) [-348.703] -- 0:00:18
702000 -- (-344.802) (-343.895) (-343.530) [-346.986] * [-344.071] (-343.500) (-348.275) (-349.034) -- 0:00:18
702500 -- [-345.627] (-344.839) (-343.409) (-347.044) * (-349.376) (-345.127) (-347.115) [-346.065] -- 0:00:18
703000 -- [-349.501] (-343.330) (-346.464) (-345.502) * (-345.729) [-345.137] (-346.302) (-349.105) -- 0:00:18
703500 -- (-346.556) (-346.368) (-344.273) [-346.632] * (-348.264) (-345.940) [-346.385] (-345.807) -- 0:00:18
704000 -- (-346.270) (-346.624) (-345.327) [-344.825] * (-345.659) (-347.107) (-347.332) [-347.814] -- 0:00:18
704500 -- (-348.106) (-344.749) [-344.188] (-344.872) * (-347.420) (-349.440) (-345.563) [-344.069] -- 0:00:18
705000 -- [-344.391] (-346.505) (-344.578) (-343.530) * [-346.209] (-346.146) (-346.796) (-346.043) -- 0:00:17
Average standard deviation of split frequencies: 0.006766
705500 -- [-350.653] (-347.397) (-347.881) (-344.495) * [-345.276] (-344.825) (-345.087) (-343.930) -- 0:00:17
706000 -- (-343.894) (-344.431) [-345.600] (-344.337) * (-350.856) (-345.155) [-344.239] (-347.066) -- 0:00:17
706500 -- [-343.739] (-346.587) (-343.960) (-345.211) * (-347.684) [-344.457] (-344.718) (-343.635) -- 0:00:18
707000 -- [-344.451] (-347.294) (-347.872) (-346.195) * (-345.167) (-344.138) [-344.788] (-347.930) -- 0:00:18
707500 -- [-343.638] (-346.504) (-347.406) (-345.443) * (-351.447) (-344.483) (-346.922) [-346.085] -- 0:00:18
708000 -- [-343.700] (-347.911) (-344.520) (-349.999) * (-345.872) [-346.710] (-345.445) (-344.826) -- 0:00:18
708500 -- (-347.213) (-349.186) (-345.908) [-348.158] * (-345.611) (-345.889) (-344.139) [-344.253] -- 0:00:18
709000 -- [-346.579] (-345.047) (-345.676) (-346.548) * (-345.712) (-344.579) [-343.741] (-343.831) -- 0:00:18
709500 -- (-345.655) (-345.133) (-344.235) [-345.705] * [-352.088] (-346.574) (-345.227) (-345.120) -- 0:00:18
710000 -- (-345.747) [-345.825] (-345.982) (-346.092) * (-350.407) (-346.155) (-347.905) [-345.407] -- 0:00:17
Average standard deviation of split frequencies: 0.006766
710500 -- [-344.586] (-349.710) (-344.884) (-346.581) * (-351.090) (-348.229) (-354.723) [-345.089] -- 0:00:17
711000 -- (-346.742) [-343.911] (-345.957) (-345.714) * (-351.172) (-346.891) [-345.649] (-345.963) -- 0:00:17
711500 -- (-346.240) (-347.610) [-346.886] (-354.406) * (-346.750) [-344.625] (-345.809) (-349.192) -- 0:00:17
712000 -- (-344.117) (-344.247) (-348.405) [-343.292] * [-345.414] (-344.039) (-347.075) (-348.503) -- 0:00:17
712500 -- (-354.020) (-345.321) (-345.761) [-343.370] * [-344.871] (-344.223) (-348.434) (-346.929) -- 0:00:17
713000 -- (-354.273) (-344.673) [-346.247] (-347.861) * (-349.034) (-344.074) [-346.224] (-345.858) -- 0:00:17
713500 -- (-349.830) [-347.813] (-345.349) (-346.379) * (-346.678) (-349.239) (-344.850) [-345.266] -- 0:00:17
714000 -- (-345.926) [-347.362] (-345.979) (-345.827) * (-345.212) [-344.556] (-346.169) (-348.383) -- 0:00:17
714500 -- (-345.988) (-343.851) [-345.844] (-345.271) * (-344.962) (-349.721) (-345.452) [-348.726] -- 0:00:17
715000 -- (-350.003) (-349.248) (-346.538) [-345.063] * (-346.243) [-344.755] (-346.453) (-347.881) -- 0:00:17
Average standard deviation of split frequencies: 0.006584
715500 -- [-344.697] (-347.457) (-347.918) (-344.725) * (-344.483) [-345.500] (-346.090) (-344.145) -- 0:00:17
716000 -- (-346.926) (-345.089) (-344.749) [-347.779] * (-343.663) (-346.187) (-345.115) [-346.802] -- 0:00:17
716500 -- [-343.981] (-346.710) (-345.588) (-349.653) * (-344.157) (-343.656) (-345.218) [-344.550] -- 0:00:17
717000 -- [-345.999] (-345.402) (-345.077) (-346.885) * (-345.903) [-343.458] (-344.285) (-348.678) -- 0:00:17
717500 -- [-349.646] (-347.754) (-346.031) (-344.023) * [-351.027] (-347.338) (-344.590) (-346.068) -- 0:00:17
718000 -- (-348.869) [-345.522] (-349.873) (-344.941) * [-343.617] (-346.492) (-344.019) (-346.524) -- 0:00:17
718500 -- (-346.407) (-343.840) (-351.273) [-345.316] * [-347.374] (-345.733) (-344.361) (-345.612) -- 0:00:17
719000 -- [-347.432] (-343.988) (-349.372) (-343.791) * [-345.716] (-349.050) (-344.102) (-348.474) -- 0:00:17
719500 -- (-347.686) (-344.216) [-346.237] (-346.712) * (-343.968) (-346.279) [-345.412] (-348.594) -- 0:00:17
720000 -- (-343.807) (-345.847) [-345.329] (-345.955) * [-343.765] (-345.240) (-344.027) (-346.717) -- 0:00:17
Average standard deviation of split frequencies: 0.006934
720500 -- (-343.690) (-344.394) (-343.802) [-345.834] * (-348.269) (-345.832) [-346.118] (-345.314) -- 0:00:17
721000 -- (-344.631) (-345.217) [-344.786] (-344.666) * [-347.755] (-345.680) (-345.394) (-348.295) -- 0:00:17
721500 -- (-344.533) (-344.707) [-348.013] (-344.409) * [-345.478] (-347.019) (-346.390) (-344.672) -- 0:00:17
722000 -- [-344.269] (-347.433) (-344.317) (-343.679) * (-344.251) (-346.849) [-345.263] (-345.475) -- 0:00:17
722500 -- [-343.537] (-348.249) (-347.359) (-344.957) * (-344.126) [-347.729] (-352.632) (-343.588) -- 0:00:17
723000 -- (-344.726) (-344.493) (-343.569) [-346.073] * (-347.094) [-346.548] (-347.858) (-345.950) -- 0:00:17
723500 -- (-344.612) [-347.206] (-344.238) (-346.589) * [-344.104] (-344.868) (-344.823) (-346.592) -- 0:00:17
724000 -- [-343.535] (-345.832) (-346.382) (-347.512) * (-345.207) (-344.033) (-345.960) [-345.739] -- 0:00:17
724500 -- [-343.995] (-343.795) (-345.440) (-349.756) * (-344.551) [-343.586] (-346.523) (-344.216) -- 0:00:17
725000 -- [-348.264] (-345.644) (-347.714) (-346.937) * [-344.119] (-345.695) (-346.095) (-344.866) -- 0:00:17
Average standard deviation of split frequencies: 0.006623
725500 -- [-345.496] (-346.049) (-349.896) (-346.689) * (-343.673) (-349.440) [-344.151] (-344.628) -- 0:00:17
726000 -- (-345.665) (-345.312) (-346.855) [-345.236] * (-344.679) (-351.801) [-345.105] (-345.811) -- 0:00:16
726500 -- (-350.274) (-346.901) [-344.526] (-344.548) * (-344.753) (-345.978) [-346.562] (-347.815) -- 0:00:16
727000 -- (-348.996) (-344.760) (-343.476) [-344.345] * (-345.095) (-345.328) [-344.217] (-347.517) -- 0:00:16
727500 -- (-346.714) (-344.165) (-344.434) [-345.923] * (-348.517) (-344.999) [-345.811] (-346.139) -- 0:00:16
728000 -- (-346.065) [-344.715] (-345.080) (-344.047) * (-346.401) (-344.410) (-344.170) [-348.515] -- 0:00:16
728500 -- (-347.487) (-345.394) [-345.647] (-346.491) * (-345.164) (-343.875) (-345.824) [-347.214] -- 0:00:16
729000 -- [-346.999] (-344.598) (-346.257) (-350.207) * (-348.131) (-346.677) [-347.305] (-343.376) -- 0:00:16
729500 -- [-348.376] (-345.915) (-346.263) (-347.986) * (-345.808) (-345.740) (-346.648) [-349.508] -- 0:00:16
730000 -- (-343.817) [-345.872] (-343.581) (-346.862) * [-345.697] (-346.057) (-346.363) (-346.096) -- 0:00:16
Average standard deviation of split frequencies: 0.006495
730500 -- [-344.687] (-344.649) (-346.379) (-347.276) * (-348.375) (-344.920) (-343.856) [-344.770] -- 0:00:16
731000 -- [-345.536] (-346.277) (-347.034) (-344.806) * (-344.115) [-344.278] (-343.632) (-344.250) -- 0:00:16
731500 -- (-357.174) (-346.519) (-346.688) [-344.544] * (-346.528) (-345.042) [-343.764] (-346.910) -- 0:00:16
732000 -- (-347.511) [-350.994] (-352.825) (-346.164) * [-343.753] (-346.130) (-345.005) (-345.872) -- 0:00:16
732500 -- (-346.046) (-345.159) (-347.992) [-348.965] * (-344.046) (-348.120) (-345.452) [-344.306] -- 0:00:16
733000 -- [-345.000] (-343.960) (-345.745) (-346.591) * [-345.218] (-343.671) (-344.435) (-344.896) -- 0:00:16
733500 -- (-346.415) (-345.770) [-346.794] (-343.602) * (-347.228) (-345.287) [-343.625] (-347.830) -- 0:00:16
734000 -- (-346.417) (-345.282) [-346.215] (-347.220) * (-347.463) [-347.191] (-344.555) (-349.182) -- 0:00:16
734500 -- (-345.995) [-345.363] (-343.211) (-350.220) * (-345.966) (-349.480) [-346.141] (-350.025) -- 0:00:16
735000 -- (-346.828) (-349.234) (-347.436) [-347.266] * (-344.329) (-344.422) (-351.389) [-344.255] -- 0:00:16
Average standard deviation of split frequencies: 0.006277
735500 -- (-345.969) (-348.389) [-344.049] (-345.458) * (-344.482) (-346.713) [-349.719] (-345.153) -- 0:00:16
736000 -- (-348.807) [-344.863] (-345.395) (-345.347) * (-344.291) [-345.095] (-347.363) (-345.763) -- 0:00:16
736500 -- (-344.634) (-345.800) [-344.593] (-348.800) * [-346.187] (-348.362) (-349.328) (-345.209) -- 0:00:16
737000 -- (-344.232) [-345.899] (-348.711) (-347.985) * [-347.749] (-346.517) (-346.591) (-345.584) -- 0:00:16
737500 -- (-345.082) [-344.800] (-347.267) (-346.125) * (-344.650) (-343.815) (-345.682) [-344.485] -- 0:00:16
738000 -- (-346.416) [-347.733] (-349.565) (-345.485) * (-344.722) (-344.594) [-347.503] (-343.546) -- 0:00:16
738500 -- (-345.784) (-344.383) (-345.793) [-346.152] * (-344.230) (-346.232) [-346.599] (-344.764) -- 0:00:16
739000 -- (-347.524) (-345.571) [-344.200] (-344.395) * (-347.033) (-347.792) [-344.162] (-343.996) -- 0:00:16
739500 -- [-347.304] (-346.047) (-343.795) (-344.106) * (-350.480) [-350.555] (-345.264) (-345.557) -- 0:00:16
740000 -- (-344.247) (-344.472) (-344.698) [-344.355] * (-347.044) (-343.954) (-344.723) [-347.403] -- 0:00:16
Average standard deviation of split frequencies: 0.006322
740500 -- (-344.144) [-344.646] (-350.019) (-346.904) * (-345.776) [-345.789] (-345.794) (-346.894) -- 0:00:16
741000 -- (-345.799) [-346.092] (-347.238) (-343.897) * (-346.437) [-343.681] (-345.670) (-346.447) -- 0:00:16
741500 -- [-344.313] (-345.725) (-346.232) (-343.602) * [-343.779] (-344.628) (-343.515) (-343.660) -- 0:00:16
742000 -- (-345.070) [-345.858] (-343.416) (-345.841) * [-344.021] (-347.782) (-344.060) (-344.625) -- 0:00:15
742500 -- [-343.486] (-346.338) (-346.477) (-344.644) * [-346.425] (-347.026) (-346.296) (-344.342) -- 0:00:15
743000 -- (-349.383) (-345.249) [-345.933] (-344.967) * [-349.250] (-344.843) (-345.551) (-345.367) -- 0:00:15
743500 -- (-344.654) (-344.639) [-346.186] (-344.876) * (-352.393) [-343.677] (-344.496) (-345.153) -- 0:00:15
744000 -- (-344.909) [-345.303] (-345.003) (-346.584) * (-345.969) [-346.160] (-343.575) (-345.068) -- 0:00:15
744500 -- (-343.814) (-343.455) [-345.452] (-345.786) * (-346.459) (-344.575) [-343.912] (-345.976) -- 0:00:15
745000 -- (-344.212) (-344.130) (-346.070) [-347.451] * (-346.659) [-344.833] (-345.421) (-346.565) -- 0:00:15
Average standard deviation of split frequencies: 0.006319
745500 -- (-348.281) [-343.798] (-345.466) (-345.820) * (-346.238) (-345.692) [-344.508] (-343.571) -- 0:00:16
746000 -- (-346.782) [-345.118] (-344.387) (-345.907) * (-345.497) (-345.147) (-343.490) [-344.693] -- 0:00:16
746500 -- (-345.795) (-348.252) [-347.115] (-346.165) * [-344.710] (-344.195) (-350.708) (-347.406) -- 0:00:15
747000 -- [-347.292] (-345.501) (-352.072) (-345.855) * (-346.859) (-348.102) (-344.063) [-346.447] -- 0:00:15
747500 -- (-345.147) (-344.595) [-344.937] (-345.359) * (-345.469) (-344.728) [-344.149] (-344.920) -- 0:00:15
748000 -- [-343.772] (-345.014) (-345.163) (-344.919) * (-344.859) (-345.448) [-346.588] (-348.017) -- 0:00:15
748500 -- (-343.649) [-344.996] (-346.970) (-343.762) * (-348.630) (-346.711) (-345.432) [-345.362] -- 0:00:15
749000 -- [-344.009] (-345.585) (-344.801) (-344.071) * (-351.429) (-349.859) (-344.967) [-344.747] -- 0:00:15
749500 -- (-346.589) [-347.165] (-344.832) (-344.080) * (-347.463) (-348.737) (-347.346) [-345.339] -- 0:00:15
750000 -- [-344.869] (-347.304) (-347.266) (-343.843) * (-345.351) (-345.139) (-349.277) [-347.744] -- 0:00:15
Average standard deviation of split frequencies: 0.005903
750500 -- [-343.612] (-346.450) (-345.461) (-344.367) * (-344.700) (-348.380) (-345.911) [-346.362] -- 0:00:15
751000 -- [-343.976] (-349.612) (-343.636) (-344.993) * (-347.525) (-344.404) (-352.682) [-345.282] -- 0:00:15
751500 -- (-346.621) (-347.677) [-347.240] (-344.359) * (-349.829) (-345.423) [-345.616] (-345.024) -- 0:00:15
752000 -- (-348.642) (-347.791) (-347.995) [-346.128] * [-347.389] (-343.983) (-346.350) (-346.073) -- 0:00:15
752500 -- (-347.709) (-344.979) (-347.814) [-348.408] * (-344.968) (-344.830) (-344.282) [-347.189] -- 0:00:15
753000 -- (-349.818) [-344.116] (-343.597) (-346.915) * [-346.744] (-346.947) (-345.356) (-351.377) -- 0:00:15
753500 -- (-344.670) (-343.864) [-344.525] (-343.800) * (-347.278) (-346.990) [-345.529] (-349.556) -- 0:00:15
754000 -- (-344.938) (-344.350) [-346.966] (-345.453) * (-346.661) (-345.721) [-345.831] (-347.826) -- 0:00:15
754500 -- (-344.617) [-346.553] (-344.984) (-343.714) * [-348.737] (-344.488) (-345.960) (-346.992) -- 0:00:15
755000 -- (-345.218) [-343.987] (-346.558) (-343.719) * (-345.105) [-344.333] (-343.874) (-346.431) -- 0:00:15
Average standard deviation of split frequencies: 0.006069
755500 -- [-349.025] (-346.347) (-345.451) (-344.444) * [-347.369] (-343.985) (-343.313) (-344.536) -- 0:00:15
756000 -- (-347.293) (-349.546) [-345.904] (-344.805) * [-345.703] (-344.150) (-348.638) (-346.494) -- 0:00:15
756500 -- (-343.545) [-345.616] (-345.019) (-347.440) * (-349.256) [-344.390] (-347.468) (-344.258) -- 0:00:15
757000 -- [-343.909] (-345.701) (-346.482) (-346.111) * [-347.765] (-344.444) (-344.594) (-346.064) -- 0:00:15
757500 -- [-343.923] (-350.570) (-345.112) (-346.007) * (-348.789) (-344.900) (-346.478) [-345.428] -- 0:00:15
758000 -- (-348.552) [-347.832] (-345.083) (-346.673) * [-346.870] (-344.424) (-344.146) (-345.167) -- 0:00:15
758500 -- (-347.774) [-347.476] (-343.988) (-343.824) * (-347.306) (-344.457) (-347.960) [-347.640] -- 0:00:15
759000 -- [-346.087] (-343.599) (-345.528) (-343.809) * (-344.098) [-344.170] (-348.645) (-345.264) -- 0:00:15
759500 -- (-345.291) (-346.281) [-344.789] (-343.654) * (-345.063) (-348.667) [-344.394] (-347.694) -- 0:00:15
760000 -- (-347.872) (-346.230) [-344.100] (-344.825) * (-346.990) (-344.854) (-344.648) [-344.447] -- 0:00:15
Average standard deviation of split frequencies: 0.006032
760500 -- [-345.120] (-344.687) (-347.944) (-344.310) * [-348.997] (-344.605) (-347.476) (-348.958) -- 0:00:15
761000 -- [-346.879] (-346.203) (-344.233) (-343.631) * (-346.182) (-344.163) (-344.233) [-347.666] -- 0:00:15
761500 -- (-344.680) (-344.044) [-347.081] (-343.621) * (-345.158) (-345.935) [-345.457] (-346.462) -- 0:00:15
762000 -- (-346.900) (-345.124) [-345.083] (-343.346) * (-344.017) [-345.481] (-345.953) (-346.360) -- 0:00:14
762500 -- (-346.490) [-343.845] (-346.070) (-343.630) * (-347.536) [-343.817] (-345.311) (-343.732) -- 0:00:14
763000 -- (-345.586) (-345.723) (-345.900) [-346.705] * (-346.320) (-344.474) (-344.973) [-343.304] -- 0:00:14
763500 -- (-345.654) [-345.867] (-348.550) (-350.940) * (-345.456) (-345.616) (-344.300) [-345.135] -- 0:00:14
764000 -- (-347.018) (-345.675) [-346.718] (-346.955) * (-346.356) (-345.774) [-346.860] (-343.598) -- 0:00:14
764500 -- [-349.781] (-346.621) (-344.968) (-347.583) * (-344.148) (-344.799) (-344.524) [-346.658] -- 0:00:14
765000 -- (-347.435) [-344.608] (-349.280) (-346.922) * (-345.167) [-344.434] (-345.051) (-345.451) -- 0:00:14
Average standard deviation of split frequencies: 0.005990
765500 -- (-344.620) (-343.595) [-350.380] (-347.136) * (-344.537) [-345.510] (-347.559) (-344.805) -- 0:00:14
766000 -- (-344.047) (-346.047) (-348.994) [-345.761] * (-346.013) (-345.814) [-345.943] (-345.464) -- 0:00:14
766500 -- [-344.056] (-343.684) (-347.058) (-344.585) * (-350.421) (-344.213) [-346.159] (-346.629) -- 0:00:14
767000 -- (-343.853) [-343.718] (-345.674) (-346.316) * (-343.574) (-348.584) [-347.627] (-348.147) -- 0:00:14
767500 -- (-344.206) [-344.989] (-350.982) (-343.487) * (-346.828) (-346.138) [-347.961] (-345.470) -- 0:00:14
768000 -- [-345.461] (-344.619) (-349.489) (-344.389) * (-348.239) (-344.607) (-343.630) [-345.725] -- 0:00:14
768500 -- (-345.845) (-345.832) (-346.179) [-344.443] * (-344.071) (-348.335) (-343.725) [-347.008] -- 0:00:14
769000 -- (-343.562) [-345.749] (-345.218) (-346.385) * (-346.155) (-346.479) (-343.633) [-344.708] -- 0:00:14
769500 -- (-345.145) (-345.037) [-350.069] (-350.256) * (-348.204) [-346.163] (-345.038) (-347.219) -- 0:00:14
770000 -- [-346.899] (-346.276) (-344.955) (-345.297) * (-347.137) (-344.878) [-344.370] (-346.583) -- 0:00:14
Average standard deviation of split frequencies: 0.006035
770500 -- [-345.142] (-346.839) (-347.791) (-345.899) * (-349.327) (-345.325) (-346.797) [-344.580] -- 0:00:14
771000 -- (-344.932) (-347.121) (-349.048) [-345.541] * [-343.563] (-344.296) (-349.447) (-350.395) -- 0:00:14
771500 -- (-343.932) (-343.855) [-345.887] (-348.302) * (-346.812) (-349.687) [-346.230] (-345.991) -- 0:00:14
772000 -- (-345.761) [-347.431] (-345.250) (-346.363) * (-348.655) (-345.357) (-344.622) [-344.951] -- 0:00:14
772500 -- [-344.373] (-343.987) (-348.283) (-344.819) * (-346.594) [-344.026] (-345.287) (-343.449) -- 0:00:14
773000 -- (-347.654) [-343.459] (-350.580) (-347.387) * [-346.695] (-345.089) (-345.435) (-348.978) -- 0:00:14
773500 -- [-347.539] (-345.393) (-346.547) (-346.473) * (-349.137) (-345.761) [-347.687] (-344.905) -- 0:00:14
774000 -- (-346.289) (-348.890) [-343.637] (-344.826) * (-345.891) [-344.905] (-348.165) (-348.827) -- 0:00:14
774500 -- (-346.196) (-345.860) (-344.395) [-344.003] * (-343.485) [-348.092] (-343.583) (-344.968) -- 0:00:14
775000 -- (-344.466) (-347.918) (-343.563) [-345.207] * [-346.265] (-346.007) (-347.042) (-343.763) -- 0:00:14
Average standard deviation of split frequencies: 0.006196
775500 -- (-343.109) [-348.375] (-350.168) (-343.801) * (-345.100) (-347.827) [-343.589] (-346.178) -- 0:00:14
776000 -- (-345.354) (-344.805) [-345.277] (-346.141) * (-344.549) (-345.609) [-343.555] (-346.108) -- 0:00:14
776500 -- [-343.780] (-343.482) (-345.497) (-346.926) * (-347.746) (-345.672) (-343.377) [-348.645] -- 0:00:14
777000 -- [-343.777] (-343.538) (-347.621) (-344.509) * (-345.160) (-348.032) [-345.442] (-345.694) -- 0:00:14
777500 -- (-344.748) [-343.387] (-350.295) (-347.234) * [-346.885] (-345.105) (-344.899) (-346.001) -- 0:00:14
778000 -- (-344.437) (-344.572) [-346.574] (-344.281) * [-344.727] (-345.010) (-346.775) (-349.913) -- 0:00:13
778500 -- (-345.438) [-344.023] (-348.095) (-345.363) * (-344.659) (-344.366) (-345.337) [-349.634] -- 0:00:13
779000 -- [-348.509] (-343.191) (-346.157) (-347.257) * [-345.435] (-344.027) (-343.976) (-346.143) -- 0:00:13
779500 -- (-343.957) [-348.813] (-345.746) (-353.001) * (-348.695) (-348.175) [-344.047] (-349.574) -- 0:00:13
780000 -- [-345.536] (-349.997) (-344.346) (-354.792) * (-345.751) (-343.579) [-345.358] (-344.360) -- 0:00:13
Average standard deviation of split frequencies: 0.006844
780500 -- [-345.761] (-346.037) (-345.684) (-345.297) * (-343.811) (-343.400) (-346.367) [-343.878] -- 0:00:13
781000 -- (-349.159) [-344.143] (-350.614) (-347.045) * (-345.725) (-346.789) (-348.732) [-346.187] -- 0:00:13
781500 -- [-349.347] (-346.413) (-344.459) (-347.307) * (-348.165) (-345.965) [-346.294] (-343.982) -- 0:00:13
782000 -- (-346.896) (-347.375) (-348.146) [-344.129] * (-350.124) (-345.042) [-346.825] (-344.721) -- 0:00:13
782500 -- (-346.790) (-346.386) [-344.564] (-346.098) * (-345.898) [-346.539] (-346.214) (-346.414) -- 0:00:13
783000 -- [-345.518] (-346.381) (-352.072) (-345.967) * [-344.931] (-343.922) (-344.316) (-347.053) -- 0:00:13
783500 -- (-348.206) (-347.330) [-346.339] (-346.717) * [-346.838] (-345.359) (-343.727) (-350.646) -- 0:00:13
784000 -- [-343.569] (-349.303) (-344.719) (-347.333) * (-348.791) [-344.652] (-347.090) (-347.739) -- 0:00:13
784500 -- (-345.191) (-346.062) [-344.329] (-347.343) * (-347.068) (-345.179) (-344.472) [-346.974] -- 0:00:13
785000 -- (-349.155) (-347.064) (-345.963) [-344.723] * (-344.466) [-345.347] (-345.225) (-345.708) -- 0:00:13
Average standard deviation of split frequencies: 0.006637
785500 -- (-355.872) (-345.352) (-346.042) [-346.714] * [-346.491] (-349.579) (-346.516) (-346.057) -- 0:00:13
786000 -- (-350.861) (-344.445) (-343.797) [-346.024] * (-349.255) [-343.926] (-346.993) (-349.118) -- 0:00:13
786500 -- (-349.753) (-345.286) (-343.388) [-344.725] * (-347.600) (-350.127) (-344.484) [-343.865] -- 0:00:13
787000 -- [-346.903] (-345.966) (-344.798) (-345.028) * (-343.839) (-349.072) [-344.711] (-344.301) -- 0:00:13
787500 -- (-344.806) [-347.321] (-343.612) (-346.453) * (-344.635) (-345.048) [-348.053] (-348.637) -- 0:00:13
788000 -- [-344.813] (-347.384) (-344.055) (-347.463) * [-344.700] (-346.347) (-344.516) (-344.680) -- 0:00:13
788500 -- (-345.199) (-344.253) [-345.163] (-344.305) * (-344.842) [-343.848] (-346.088) (-344.360) -- 0:00:13
789000 -- (-344.878) (-343.655) (-345.065) [-343.799] * [-350.245] (-344.346) (-346.695) (-345.441) -- 0:00:13
789500 -- (-346.762) (-343.521) [-345.769] (-345.204) * (-346.719) (-346.469) (-345.856) [-344.456] -- 0:00:13
790000 -- (-344.593) (-344.602) (-345.646) [-346.818] * (-347.000) (-347.085) [-346.075] (-343.883) -- 0:00:13
Average standard deviation of split frequencies: 0.007035
790500 -- (-344.011) (-344.646) (-347.597) [-345.111] * (-347.729) (-345.518) (-348.970) [-345.009] -- 0:00:13
791000 -- (-345.318) [-343.944] (-348.910) (-347.015) * (-346.090) (-345.048) [-344.818] (-346.616) -- 0:00:13
791500 -- (-344.842) [-346.401] (-349.038) (-345.166) * (-344.250) (-345.754) [-344.376] (-345.219) -- 0:00:13
792000 -- [-344.633] (-343.775) (-346.398) (-348.449) * (-345.369) (-346.021) (-345.214) [-346.546] -- 0:00:13
792500 -- (-346.043) [-344.704] (-349.531) (-348.389) * [-348.244] (-344.776) (-346.544) (-344.759) -- 0:00:13
793000 -- (-343.473) [-344.290] (-348.944) (-348.564) * [-348.672] (-344.790) (-349.448) (-344.929) -- 0:00:13
793500 -- (-347.299) [-345.113] (-344.825) (-346.053) * [-346.326] (-347.002) (-343.666) (-343.536) -- 0:00:13
794000 -- (-347.229) [-344.901] (-344.364) (-345.128) * (-346.388) [-345.881] (-345.275) (-345.982) -- 0:00:12
794500 -- (-345.720) (-350.168) (-346.026) [-345.627] * [-344.920] (-345.504) (-344.956) (-344.139) -- 0:00:12
795000 -- (-344.357) (-345.280) (-346.309) [-344.120] * (-345.229) (-343.609) (-346.508) [-343.613] -- 0:00:12
Average standard deviation of split frequencies: 0.007225
795500 -- (-345.157) [-348.414] (-346.475) (-346.951) * (-348.280) [-343.442] (-348.883) (-344.298) -- 0:00:12
796000 -- (-346.020) (-347.649) [-347.227] (-346.881) * (-346.380) [-344.576] (-347.159) (-345.821) -- 0:00:12
796500 -- (-344.955) [-344.469] (-349.059) (-344.818) * [-343.635] (-346.162) (-345.969) (-344.786) -- 0:00:12
797000 -- (-344.925) (-346.020) [-343.355] (-343.591) * [-343.428] (-346.896) (-343.997) (-345.535) -- 0:00:12
797500 -- [-344.688] (-343.622) (-343.322) (-345.543) * (-344.020) (-346.293) (-343.916) [-345.491] -- 0:00:12
798000 -- [-344.565] (-348.344) (-346.712) (-344.617) * [-344.096] (-349.440) (-344.192) (-347.077) -- 0:00:12
798500 -- (-344.172) (-345.024) [-343.122] (-347.742) * [-344.941] (-348.808) (-345.639) (-347.415) -- 0:00:12
799000 -- [-348.232] (-346.343) (-344.024) (-344.574) * [-346.825] (-349.449) (-351.701) (-345.806) -- 0:00:12
799500 -- (-344.694) (-345.480) (-346.190) [-346.387] * (-345.885) (-349.458) (-346.983) [-344.897] -- 0:00:12
800000 -- (-344.560) (-344.886) (-344.900) [-347.402] * (-348.172) (-343.954) [-345.580] (-346.068) -- 0:00:12
Average standard deviation of split frequencies: 0.006947
800500 -- (-347.912) (-344.541) [-345.735] (-343.748) * (-344.714) (-343.714) (-346.619) [-345.432] -- 0:00:12
801000 -- (-345.484) (-346.901) (-345.531) [-345.459] * (-344.786) (-346.314) [-345.209] (-345.359) -- 0:00:12
801500 -- (-344.274) (-348.440) [-345.768] (-345.266) * (-348.085) (-353.141) [-344.075] (-345.257) -- 0:00:12
802000 -- (-349.564) (-345.527) (-346.434) [-346.785] * [-344.170] (-350.094) (-345.339) (-346.225) -- 0:00:12
802500 -- [-343.630] (-345.669) (-344.254) (-344.495) * (-346.030) [-345.623] (-344.334) (-345.988) -- 0:00:12
803000 -- (-344.167) (-347.119) (-345.321) [-347.467] * (-346.652) [-344.638] (-343.788) (-343.740) -- 0:00:12
803500 -- (-346.389) (-344.878) (-343.873) [-344.372] * [-345.913] (-348.026) (-348.255) (-344.116) -- 0:00:12
804000 -- (-347.546) (-345.179) (-345.594) [-345.233] * (-344.316) (-348.280) [-345.653] (-345.568) -- 0:00:12
804500 -- (-348.451) (-345.160) (-350.187) [-345.686] * (-344.124) (-348.470) (-348.504) [-344.691] -- 0:00:12
805000 -- (-344.911) [-346.155] (-347.698) (-344.519) * (-345.474) [-344.968] (-345.856) (-343.925) -- 0:00:12
Average standard deviation of split frequencies: 0.007447
805500 -- (-346.126) [-345.105] (-344.449) (-352.532) * [-343.463] (-345.225) (-345.893) (-344.938) -- 0:00:12
806000 -- (-348.044) [-346.312] (-346.715) (-344.146) * (-344.363) (-346.828) (-344.307) [-343.778] -- 0:00:12
806500 -- (-345.181) [-344.346] (-345.675) (-344.482) * [-343.668] (-344.252) (-344.955) (-343.630) -- 0:00:12
807000 -- (-345.216) [-345.438] (-344.115) (-348.907) * (-346.924) (-344.414) (-345.860) [-344.892] -- 0:00:12
807500 -- (-343.803) (-343.418) [-346.244] (-346.062) * (-347.043) [-346.669] (-344.028) (-346.286) -- 0:00:12
808000 -- [-347.350] (-344.429) (-346.896) (-344.037) * (-343.691) [-344.432] (-343.808) (-345.310) -- 0:00:12
808500 -- (-346.811) (-345.080) [-345.126] (-344.638) * (-343.353) (-345.026) [-344.704] (-344.112) -- 0:00:12
809000 -- [-346.696] (-344.815) (-344.077) (-345.977) * (-343.567) (-344.164) [-346.565] (-345.364) -- 0:00:12
809500 -- (-345.628) (-343.675) [-344.562] (-345.144) * (-344.358) [-345.655] (-344.269) (-344.515) -- 0:00:12
810000 -- (-348.266) [-344.499] (-345.575) (-345.799) * [-344.632] (-345.255) (-344.713) (-344.931) -- 0:00:11
Average standard deviation of split frequencies: 0.007094
810500 -- (-346.743) (-347.522) [-345.592] (-346.243) * [-344.147] (-345.949) (-344.684) (-345.625) -- 0:00:11
811000 -- (-343.926) (-344.704) (-344.748) [-344.440] * (-345.354) (-347.262) (-347.409) [-346.577] -- 0:00:11
811500 -- (-344.230) [-344.754] (-345.293) (-348.017) * [-345.841] (-348.827) (-345.803) (-344.317) -- 0:00:11
812000 -- (-344.731) [-343.357] (-348.967) (-345.366) * (-346.962) [-347.641] (-347.392) (-345.523) -- 0:00:11
812500 -- (-345.008) (-346.975) [-346.889] (-349.025) * (-347.169) (-344.081) (-346.349) [-344.998] -- 0:00:11
813000 -- (-345.419) (-347.578) [-346.362] (-346.092) * (-344.576) (-345.866) (-344.723) [-345.207] -- 0:00:11
813500 -- (-343.563) (-344.231) (-346.049) [-343.757] * [-345.122] (-349.842) (-344.790) (-348.668) -- 0:00:11
814000 -- (-343.698) (-350.558) [-347.056] (-343.555) * (-348.651) (-344.408) [-346.440] (-344.772) -- 0:00:11
814500 -- (-345.470) (-346.694) [-346.874] (-345.292) * [-346.985] (-344.048) (-344.545) (-345.052) -- 0:00:11
815000 -- (-345.888) [-343.852] (-346.913) (-345.965) * (-347.047) (-347.437) [-343.565] (-344.021) -- 0:00:11
Average standard deviation of split frequencies: 0.006547
815500 -- (-346.413) [-344.176] (-348.251) (-345.484) * (-344.250) [-345.838] (-343.704) (-343.548) -- 0:00:11
816000 -- [-346.404] (-346.613) (-344.988) (-346.884) * (-346.555) [-345.258] (-344.687) (-344.378) -- 0:00:11
816500 -- [-346.389] (-343.972) (-345.309) (-347.754) * [-346.802] (-346.009) (-345.269) (-345.868) -- 0:00:11
817000 -- (-344.191) (-345.601) [-343.389] (-343.720) * (-346.928) [-345.049] (-346.260) (-346.857) -- 0:00:11
817500 -- (-344.573) (-346.655) (-346.937) [-345.391] * [-346.969] (-345.638) (-345.106) (-356.304) -- 0:00:11
818000 -- (-346.172) (-346.062) [-346.554] (-346.085) * (-347.197) [-345.317] (-343.569) (-345.790) -- 0:00:11
818500 -- (-346.555) (-347.572) [-347.772] (-344.541) * [-345.424] (-346.240) (-344.774) (-345.067) -- 0:00:11
819000 -- (-345.367) [-345.350] (-349.990) (-345.565) * (-345.197) (-345.769) (-344.987) [-345.046] -- 0:00:11
819500 -- (-345.857) (-348.159) [-346.030] (-344.952) * (-343.992) [-346.385] (-346.225) (-344.737) -- 0:00:11
820000 -- (-343.735) (-344.639) (-349.592) [-345.033] * (-345.269) (-347.041) [-346.481] (-344.625) -- 0:00:11
Average standard deviation of split frequencies: 0.006625
820500 -- [-343.468] (-345.205) (-348.742) (-345.263) * (-347.511) (-345.770) (-347.311) [-343.235] -- 0:00:11
821000 -- (-350.088) (-344.425) [-345.926] (-345.884) * (-345.460) (-345.432) (-351.534) [-345.203] -- 0:00:11
821500 -- (-343.953) (-347.441) [-344.692] (-345.568) * [-344.661] (-344.594) (-345.407) (-345.495) -- 0:00:11
822000 -- (-344.863) (-345.319) (-345.621) [-344.887] * (-344.661) (-344.247) [-347.124] (-345.120) -- 0:00:11
822500 -- (-345.137) [-345.368] (-344.156) (-345.056) * (-343.694) (-345.411) (-345.924) [-344.553] -- 0:00:11
823000 -- (-346.159) [-349.732] (-345.497) (-346.885) * [-348.255] (-345.385) (-345.216) (-345.270) -- 0:00:11
823500 -- (-349.040) [-345.983] (-344.854) (-344.242) * (-345.669) [-345.092] (-343.843) (-353.716) -- 0:00:11
824000 -- (-344.602) (-343.943) (-343.505) [-346.820] * (-343.966) (-343.427) (-346.928) [-348.000] -- 0:00:11
824500 -- (-348.739) [-344.755] (-347.804) (-344.088) * (-343.686) (-344.206) [-344.025] (-346.752) -- 0:00:11
825000 -- [-345.735] (-345.510) (-344.999) (-343.971) * (-345.433) (-344.672) [-344.481] (-347.853) -- 0:00:11
Average standard deviation of split frequencies: 0.006430
825500 -- (-344.874) (-346.550) [-352.252] (-343.808) * (-350.508) [-346.639] (-344.575) (-345.666) -- 0:00:10
826000 -- (-344.483) (-345.526) (-346.093) [-344.031] * (-344.066) (-348.635) [-348.404] (-344.180) -- 0:00:10
826500 -- (-344.309) (-344.115) (-344.974) [-343.693] * (-346.852) (-345.479) (-349.502) [-343.373] -- 0:00:10
827000 -- (-349.473) (-347.033) (-346.093) [-345.341] * (-345.887) [-343.928] (-344.267) (-343.313) -- 0:00:10
827500 -- [-343.880] (-350.042) (-345.966) (-346.526) * (-343.831) (-344.096) [-345.804] (-344.322) -- 0:00:10
828000 -- (-344.255) [-344.024] (-344.611) (-346.046) * (-345.361) (-348.280) [-344.388] (-345.057) -- 0:00:10
828500 -- (-345.033) (-344.978) [-343.600] (-345.668) * [-345.364] (-345.862) (-345.297) (-344.388) -- 0:00:10
829000 -- (-348.896) (-347.652) (-343.853) [-345.093] * [-344.852] (-345.770) (-343.728) (-346.457) -- 0:00:10
829500 -- (-348.678) (-348.434) [-343.468] (-344.233) * (-344.307) (-345.231) [-344.756] (-347.360) -- 0:00:10
830000 -- (-350.791) (-346.779) [-343.438] (-348.761) * (-346.750) [-343.239] (-343.741) (-345.551) -- 0:00:10
Average standard deviation of split frequencies: 0.005789
830500 -- (-345.323) (-347.045) [-347.287] (-346.634) * (-345.287) (-344.499) [-343.896] (-344.712) -- 0:00:10
831000 -- [-344.072] (-344.291) (-347.998) (-346.378) * (-345.262) [-346.673] (-345.590) (-343.101) -- 0:00:10
831500 -- (-345.816) [-344.285] (-344.934) (-347.078) * (-349.029) (-344.036) [-345.794] (-343.106) -- 0:00:10
832000 -- (-346.470) (-349.002) [-344.754] (-344.882) * [-344.728] (-346.437) (-346.632) (-344.291) -- 0:00:10
832500 -- (-347.378) (-344.517) [-345.239] (-344.937) * (-343.671) (-348.562) (-347.592) [-345.494] -- 0:00:10
833000 -- [-343.899] (-345.429) (-348.119) (-344.332) * [-343.286] (-350.949) (-347.303) (-346.724) -- 0:00:10
833500 -- (-346.195) (-347.850) (-347.479) [-345.745] * [-345.888] (-346.340) (-352.249) (-344.912) -- 0:00:10
834000 -- (-344.027) (-344.862) [-344.272] (-347.841) * (-344.454) (-343.847) (-347.654) [-344.482] -- 0:00:10
834500 -- (-347.879) (-345.922) [-343.626] (-345.201) * (-344.641) (-344.988) [-345.891] (-345.609) -- 0:00:10
835000 -- (-346.643) (-345.208) [-347.047] (-344.093) * (-344.124) (-343.987) [-343.564] (-346.124) -- 0:00:10
Average standard deviation of split frequencies: 0.006165
835500 -- (-345.637) (-345.286) (-345.088) [-344.037] * (-346.937) (-344.629) (-351.511) [-344.076] -- 0:00:10
836000 -- (-343.335) [-343.732] (-349.238) (-344.285) * (-344.761) (-345.434) [-344.858] (-344.534) -- 0:00:10
836500 -- (-344.825) (-346.819) (-348.022) [-344.353] * (-344.627) (-346.288) [-344.008] (-344.524) -- 0:00:10
837000 -- (-345.611) (-345.098) [-345.600] (-344.898) * (-343.562) (-344.657) [-344.312] (-345.360) -- 0:00:10
837500 -- (-349.346) (-343.254) [-345.571] (-347.047) * (-348.234) (-344.186) (-345.656) [-345.281] -- 0:00:10
838000 -- (-347.950) (-345.873) (-345.461) [-345.059] * (-343.355) [-343.927] (-345.863) (-350.092) -- 0:00:10
838500 -- (-347.168) (-346.420) [-346.947] (-344.646) * (-345.927) (-345.285) (-346.974) [-343.543] -- 0:00:10
839000 -- (-346.493) [-345.088] (-344.277) (-347.014) * (-343.774) (-346.585) [-345.366] (-344.046) -- 0:00:10
839500 -- (-345.092) (-347.599) (-345.675) [-343.572] * (-347.857) (-349.639) (-345.405) [-344.585] -- 0:00:10
840000 -- (-348.527) [-346.971] (-346.284) (-347.716) * (-345.748) (-345.490) (-349.529) [-347.459] -- 0:00:10
Average standard deviation of split frequencies: 0.006019
840500 -- (-346.003) (-345.374) (-349.581) [-343.847] * (-345.355) [-345.858] (-344.017) (-343.571) -- 0:00:10
841000 -- (-348.382) (-344.312) (-347.117) [-345.926] * (-344.357) (-344.212) [-343.444] (-343.379) -- 0:00:10
841500 -- (-346.438) (-345.603) [-343.478] (-346.583) * [-344.452] (-346.798) (-345.865) (-344.571) -- 0:00:09
842000 -- (-345.114) [-344.802] (-347.522) (-346.536) * (-346.577) [-345.871] (-345.465) (-346.306) -- 0:00:09
842500 -- (-346.817) (-344.975) (-344.427) [-344.582] * (-348.786) (-346.852) [-343.902] (-346.227) -- 0:00:09
843000 -- (-343.665) (-344.630) [-345.834] (-343.816) * (-345.765) (-344.287) (-344.997) [-344.457] -- 0:00:09
843500 -- [-343.531] (-347.827) (-344.891) (-345.453) * (-346.011) [-345.682] (-345.973) (-345.041) -- 0:00:10
844000 -- (-347.868) [-349.412] (-348.097) (-344.865) * (-348.262) (-346.617) [-343.217] (-347.619) -- 0:00:09
844500 -- (-349.936) (-348.543) (-343.306) [-344.213] * (-347.560) [-345.636] (-345.086) (-345.535) -- 0:00:09
845000 -- (-345.526) (-344.217) (-344.589) [-344.242] * (-345.265) (-344.105) [-345.032] (-347.999) -- 0:00:09
Average standard deviation of split frequencies: 0.005944
845500 -- (-345.032) [-344.220] (-345.031) (-344.685) * (-344.626) (-346.512) [-345.793] (-346.217) -- 0:00:09
846000 -- (-344.408) (-343.964) [-345.620] (-344.717) * (-345.887) [-344.184] (-343.947) (-344.618) -- 0:00:09
846500 -- [-343.851] (-345.347) (-346.046) (-345.435) * (-345.014) (-344.132) [-345.779] (-346.656) -- 0:00:09
847000 -- (-346.043) [-345.316] (-345.014) (-348.436) * [-344.541] (-347.913) (-347.324) (-345.888) -- 0:00:09
847500 -- (-344.192) (-344.261) (-343.811) [-345.484] * (-344.567) [-345.142] (-345.068) (-345.976) -- 0:00:09
848000 -- (-346.316) (-345.094) (-350.243) [-344.839] * (-344.382) (-344.497) [-344.430] (-344.843) -- 0:00:09
848500 -- (-346.185) (-345.276) (-352.459) [-345.586] * [-343.827] (-344.531) (-347.665) (-343.630) -- 0:00:09
849000 -- (-343.749) (-347.305) [-347.286] (-343.494) * (-345.041) (-344.650) (-347.919) [-343.740] -- 0:00:09
849500 -- (-347.791) (-345.553) [-346.807] (-344.612) * (-346.859) (-345.195) [-347.089] (-344.128) -- 0:00:09
850000 -- [-345.528] (-345.660) (-353.147) (-343.319) * (-344.521) (-344.411) [-343.734] (-346.701) -- 0:00:09
Average standard deviation of split frequencies: 0.006428
850500 -- (-349.470) [-346.013] (-345.966) (-343.830) * [-344.369] (-344.729) (-344.707) (-345.551) -- 0:00:09
851000 -- (-345.679) (-346.498) [-345.729] (-344.544) * (-346.065) [-343.197] (-347.089) (-344.484) -- 0:00:09
851500 -- (-345.523) (-350.720) [-346.719] (-346.957) * (-345.476) (-343.617) (-345.019) [-344.319] -- 0:00:09
852000 -- (-345.548) (-353.196) [-349.343] (-346.328) * [-345.096] (-345.055) (-345.390) (-344.558) -- 0:00:09
852500 -- (-344.867) (-344.211) [-344.358] (-348.209) * [-344.320] (-347.255) (-345.669) (-345.873) -- 0:00:09
853000 -- [-347.209] (-344.368) (-343.326) (-343.238) * (-346.152) (-344.315) (-346.661) [-344.204] -- 0:00:09
853500 -- [-350.399] (-346.900) (-344.202) (-345.908) * (-345.214) [-344.761] (-346.911) (-345.426) -- 0:00:09
854000 -- (-345.515) (-346.630) (-346.918) [-345.155] * (-346.195) (-344.353) (-346.318) [-344.890] -- 0:00:09
854500 -- (-344.213) (-345.550) [-346.019] (-346.688) * [-348.470] (-343.847) (-349.669) (-348.646) -- 0:00:09
855000 -- [-345.222] (-352.518) (-344.238) (-347.773) * (-344.751) (-345.865) [-345.854] (-346.328) -- 0:00:09
Average standard deviation of split frequencies: 0.006462
855500 -- [-345.842] (-345.517) (-347.055) (-349.683) * [-344.883] (-344.812) (-346.423) (-346.028) -- 0:00:09
856000 -- (-345.096) [-345.316] (-345.358) (-345.786) * (-343.736) (-351.645) (-345.209) [-344.255] -- 0:00:09
856500 -- (-345.284) [-346.065] (-347.594) (-344.047) * (-345.200) [-346.783] (-345.378) (-346.206) -- 0:00:09
857000 -- (-343.208) [-344.194] (-344.002) (-344.690) * [-345.058] (-346.610) (-344.417) (-349.200) -- 0:00:09
857500 -- (-349.152) [-344.525] (-346.710) (-349.244) * (-345.560) [-349.646] (-348.063) (-345.699) -- 0:00:09
858000 -- (-344.576) (-345.921) [-345.181] (-346.553) * [-346.788] (-344.124) (-344.126) (-344.529) -- 0:00:09
858500 -- (-345.976) (-347.576) [-344.257] (-343.905) * [-344.441] (-343.901) (-345.617) (-344.292) -- 0:00:09
859000 -- [-344.212] (-347.143) (-347.096) (-346.680) * (-343.965) [-344.608] (-343.534) (-344.374) -- 0:00:09
859500 -- [-344.101] (-347.732) (-345.535) (-346.314) * [-345.554] (-343.910) (-344.759) (-345.043) -- 0:00:08
860000 -- [-344.344] (-344.987) (-345.069) (-345.620) * (-345.963) [-344.671] (-344.375) (-346.498) -- 0:00:08
Average standard deviation of split frequencies: 0.006317
860500 -- [-346.432] (-348.398) (-346.399) (-344.168) * (-343.396) (-345.862) [-344.134] (-344.530) -- 0:00:08
861000 -- (-349.388) (-344.234) [-345.633] (-344.687) * (-344.241) (-344.240) [-347.136] (-350.825) -- 0:00:08
861500 -- (-349.045) [-345.976] (-344.020) (-344.323) * (-347.492) [-344.205] (-344.055) (-344.289) -- 0:00:08
862000 -- [-344.925] (-345.229) (-344.992) (-344.681) * (-344.668) [-346.434] (-344.485) (-345.490) -- 0:00:08
862500 -- [-345.432] (-345.759) (-346.645) (-347.695) * (-347.936) [-344.990] (-344.494) (-346.335) -- 0:00:08
863000 -- (-347.190) (-346.670) [-348.442] (-347.012) * (-346.995) [-344.773] (-346.754) (-344.325) -- 0:00:08
863500 -- (-346.280) (-345.763) (-347.009) [-345.029] * (-345.625) (-348.465) (-347.204) [-345.949] -- 0:00:08
864000 -- (-344.099) [-344.069] (-345.552) (-344.835) * (-343.550) [-344.423] (-347.841) (-350.693) -- 0:00:08
864500 -- (-346.766) (-343.805) (-343.853) [-343.949] * (-347.784) [-345.472] (-345.367) (-347.720) -- 0:00:08
865000 -- [-343.760] (-345.426) (-344.658) (-345.414) * (-352.536) [-346.381] (-348.328) (-347.552) -- 0:00:08
Average standard deviation of split frequencies: 0.006714
865500 -- (-344.480) (-346.585) (-346.456) [-344.073] * [-343.554] (-345.660) (-344.219) (-349.567) -- 0:00:08
866000 -- [-346.201] (-345.881) (-344.128) (-344.278) * (-348.989) (-345.980) [-345.144] (-347.210) -- 0:00:08
866500 -- (-348.214) [-345.657] (-344.511) (-345.026) * (-347.520) (-345.178) [-345.776] (-343.181) -- 0:00:08
867000 -- [-344.605] (-345.229) (-345.404) (-346.087) * (-347.071) (-344.239) [-347.404] (-345.051) -- 0:00:08
867500 -- (-344.107) [-346.373] (-346.885) (-344.374) * [-345.011] (-347.576) (-348.187) (-348.220) -- 0:00:08
868000 -- (-343.264) [-345.439] (-345.625) (-345.739) * (-346.424) (-346.911) (-343.812) [-346.397] -- 0:00:08
868500 -- (-346.103) [-345.960] (-344.601) (-345.566) * (-344.095) [-347.716] (-350.032) (-346.939) -- 0:00:08
869000 -- [-345.276] (-346.223) (-345.268) (-344.180) * [-351.785] (-346.235) (-346.392) (-347.764) -- 0:00:08
869500 -- (-350.434) (-344.481) (-344.005) [-344.512] * (-344.704) (-344.022) [-343.962] (-346.942) -- 0:00:08
870000 -- (-348.563) [-346.636] (-343.666) (-345.155) * (-346.091) (-346.084) (-346.311) [-346.624] -- 0:00:08
Average standard deviation of split frequencies: 0.006966
870500 -- [-345.242] (-349.695) (-346.999) (-346.114) * (-343.427) (-344.185) (-347.165) [-344.187] -- 0:00:08
871000 -- (-347.950) (-349.491) [-350.552] (-343.840) * (-349.648) [-344.021] (-348.168) (-346.010) -- 0:00:08
871500 -- (-345.516) (-347.887) [-344.531] (-343.728) * (-344.202) [-347.109] (-345.657) (-345.710) -- 0:00:08
872000 -- (-355.031) (-350.389) (-346.318) [-345.500] * [-346.261] (-348.015) (-348.122) (-347.848) -- 0:00:08
872500 -- (-346.483) (-346.916) (-346.142) [-345.914] * [-347.901] (-347.452) (-346.240) (-344.826) -- 0:00:08
873000 -- (-345.100) (-346.916) (-344.099) [-346.133] * (-345.110) (-347.543) [-348.313] (-347.204) -- 0:00:08
873500 -- (-343.902) [-346.511] (-343.757) (-344.914) * (-344.488) (-347.542) (-347.383) [-345.756] -- 0:00:08
874000 -- (-343.512) (-347.109) [-347.397] (-349.360) * (-347.719) (-345.522) (-347.933) [-347.217] -- 0:00:08
874500 -- (-344.912) (-345.383) [-344.496] (-347.234) * (-346.936) (-344.999) (-344.619) [-343.930] -- 0:00:08
875000 -- (-344.793) (-345.354) (-344.313) [-346.718] * (-343.720) (-345.790) [-345.894] (-345.504) -- 0:00:08
Average standard deviation of split frequencies: 0.006780
875500 -- [-347.144] (-343.749) (-344.222) (-346.316) * (-344.844) (-346.746) [-344.572] (-344.163) -- 0:00:07
876000 -- (-346.557) [-344.211] (-344.024) (-344.770) * (-343.788) (-346.108) (-343.404) [-343.891] -- 0:00:07
876500 -- (-344.315) (-344.250) (-343.663) [-346.686] * [-344.899] (-345.313) (-343.201) (-345.790) -- 0:00:07
877000 -- (-344.494) [-347.727] (-343.922) (-346.599) * (-346.673) (-345.141) (-345.561) [-347.104] -- 0:00:07
877500 -- (-352.186) (-343.686) (-343.951) [-346.410] * (-345.612) (-345.151) (-347.205) [-344.942] -- 0:00:07
878000 -- (-344.593) (-343.043) (-347.682) [-346.563] * (-345.573) (-344.983) (-344.904) [-347.475] -- 0:00:07
878500 -- (-351.615) (-344.056) [-349.285] (-344.191) * (-347.365) (-348.333) [-345.712] (-345.509) -- 0:00:07
879000 -- (-343.490) (-345.167) [-345.171] (-343.664) * [-346.588] (-346.364) (-345.700) (-347.352) -- 0:00:07
879500 -- (-343.842) (-347.628) (-347.768) [-343.772] * (-345.809) (-344.803) [-354.895] (-344.791) -- 0:00:07
880000 -- (-345.012) (-346.154) (-344.792) [-346.324] * (-345.853) [-344.846] (-346.664) (-344.794) -- 0:00:07
Average standard deviation of split frequencies: 0.006887
880500 -- (-346.596) (-346.993) [-343.872] (-345.762) * [-343.972] (-345.330) (-343.975) (-344.311) -- 0:00:07
881000 -- [-345.617] (-346.298) (-353.584) (-344.978) * (-344.058) (-345.562) [-344.230] (-344.538) -- 0:00:07
881500 -- (-344.579) [-347.204] (-345.498) (-346.847) * [-344.234] (-345.461) (-343.753) (-348.766) -- 0:00:07
882000 -- (-345.181) (-346.560) [-346.770] (-344.419) * [-344.736] (-345.968) (-346.160) (-347.286) -- 0:00:07
882500 -- [-343.661] (-346.491) (-347.417) (-346.533) * [-344.109] (-346.979) (-345.398) (-343.940) -- 0:00:07
883000 -- [-343.320] (-343.704) (-345.130) (-345.320) * [-344.481] (-347.921) (-344.133) (-346.021) -- 0:00:07
883500 -- (-346.075) (-351.933) [-346.065] (-344.733) * [-344.103] (-344.774) (-344.380) (-345.018) -- 0:00:07
884000 -- (-345.840) (-347.344) [-344.113] (-345.054) * [-345.760] (-346.199) (-343.894) (-345.032) -- 0:00:07
884500 -- (-344.977) (-343.998) [-344.451] (-343.394) * (-344.572) [-346.532] (-345.664) (-344.001) -- 0:00:07
885000 -- (-345.066) (-344.447) [-344.384] (-344.538) * (-347.182) [-345.257] (-345.273) (-345.269) -- 0:00:07
Average standard deviation of split frequencies: 0.006881
885500 -- (-345.314) (-346.101) [-346.118] (-343.209) * (-347.055) [-346.387] (-349.288) (-347.453) -- 0:00:07
886000 -- (-348.176) [-345.131] (-345.455) (-346.074) * [-348.006] (-349.659) (-346.123) (-346.420) -- 0:00:07
886500 -- [-346.839] (-344.625) (-346.060) (-345.324) * [-346.330] (-346.248) (-344.007) (-343.595) -- 0:00:07
887000 -- (-349.391) (-344.207) (-345.318) [-347.257] * (-346.463) (-348.562) [-343.704] (-344.757) -- 0:00:07
887500 -- [-346.028] (-343.356) (-348.609) (-347.361) * (-347.266) (-344.259) [-343.470] (-348.412) -- 0:00:07
888000 -- (-343.714) [-344.612] (-345.869) (-347.112) * (-346.225) (-344.212) [-344.621] (-345.566) -- 0:00:07
888500 -- (-343.968) (-349.391) (-349.103) [-344.226] * (-344.499) (-348.055) (-344.858) [-349.183] -- 0:00:07
889000 -- [-344.782] (-345.777) (-347.035) (-345.217) * (-343.426) [-345.675] (-348.025) (-349.499) -- 0:00:07
889500 -- [-346.998] (-345.306) (-345.411) (-348.676) * (-345.789) [-343.907] (-350.779) (-345.062) -- 0:00:07
890000 -- [-343.922] (-345.405) (-345.053) (-348.660) * (-345.460) (-345.768) [-345.175] (-344.814) -- 0:00:07
Average standard deviation of split frequencies: 0.007022
890500 -- [-343.507] (-343.989) (-343.827) (-343.934) * (-344.331) (-344.641) (-345.701) [-347.712] -- 0:00:07
891000 -- (-343.540) (-343.694) [-344.039] (-346.113) * (-345.146) (-345.612) (-346.473) [-345.455] -- 0:00:06
891500 -- [-343.859] (-350.052) (-344.624) (-347.476) * [-345.507] (-344.610) (-348.215) (-346.396) -- 0:00:06
892000 -- (-344.852) (-352.211) (-346.721) [-345.054] * (-349.254) [-346.143] (-345.284) (-346.177) -- 0:00:06
892500 -- (-346.472) (-346.991) (-348.334) [-344.632] * (-344.726) (-347.197) [-345.999] (-344.562) -- 0:00:06
893000 -- (-349.528) [-345.366] (-344.906) (-346.762) * (-348.042) (-346.332) [-346.065] (-347.318) -- 0:00:06
893500 -- (-346.012) (-346.139) (-346.808) [-346.756] * (-344.575) (-347.706) [-345.476] (-344.902) -- 0:00:06
894000 -- (-349.643) [-343.199] (-347.783) (-346.008) * (-345.694) (-347.033) [-344.450] (-345.917) -- 0:00:06
894500 -- (-351.914) [-344.543] (-348.470) (-347.477) * [-345.241] (-344.705) (-344.767) (-349.343) -- 0:00:06
895000 -- [-344.906] (-345.209) (-352.515) (-345.739) * (-346.104) [-343.673] (-345.368) (-347.167) -- 0:00:06
Average standard deviation of split frequencies: 0.006840
895500 -- [-346.626] (-344.082) (-345.809) (-346.329) * [-348.032] (-346.002) (-343.881) (-344.239) -- 0:00:06
896000 -- (-343.763) (-347.782) [-344.737] (-346.231) * [-346.865] (-344.321) (-348.313) (-345.741) -- 0:00:06
896500 -- [-344.446] (-346.536) (-346.549) (-345.397) * (-344.600) (-350.457) [-344.066] (-347.936) -- 0:00:06
897000 -- [-343.555] (-345.606) (-346.838) (-347.979) * (-347.047) (-354.437) [-345.727] (-346.265) -- 0:00:06
897500 -- [-344.015] (-346.872) (-343.781) (-347.514) * (-346.717) (-344.491) [-343.914] (-345.577) -- 0:00:06
898000 -- (-346.207) (-344.930) (-343.836) [-345.404] * (-346.363) (-344.745) [-346.205] (-344.235) -- 0:00:06
898500 -- (-344.685) (-346.097) (-344.630) [-345.415] * [-346.221] (-347.553) (-344.433) (-346.031) -- 0:00:06
899000 -- (-344.365) (-345.020) [-343.245] (-349.628) * (-344.439) (-343.989) [-345.631] (-350.132) -- 0:00:06
899500 -- (-347.104) (-345.205) [-345.336] (-347.352) * (-344.482) [-343.477] (-347.705) (-348.099) -- 0:00:06
900000 -- [-351.678] (-350.529) (-345.980) (-345.269) * (-346.563) (-344.682) [-347.282] (-344.787) -- 0:00:06
Average standard deviation of split frequencies: 0.006455
900500 -- [-349.508] (-350.600) (-348.297) (-348.877) * (-348.267) (-346.408) (-348.585) [-345.042] -- 0:00:06
901000 -- (-348.748) (-349.490) (-347.210) [-344.192] * (-349.374) (-346.431) (-349.489) [-344.027] -- 0:00:06
901500 -- (-345.609) (-346.888) [-345.099] (-344.843) * (-345.726) [-346.809] (-346.500) (-347.342) -- 0:00:06
902000 -- (-346.724) [-346.368] (-343.264) (-346.747) * (-348.914) [-343.528] (-349.177) (-346.832) -- 0:00:06
902500 -- [-343.631] (-347.415) (-346.400) (-347.536) * [-345.104] (-348.870) (-347.879) (-343.684) -- 0:00:06
903000 -- [-349.162] (-353.444) (-347.084) (-344.437) * [-345.600] (-348.198) (-347.197) (-348.695) -- 0:00:06
903500 -- (-347.021) (-343.852) (-345.976) [-346.529] * (-347.243) (-345.939) (-353.258) [-344.694] -- 0:00:06
904000 -- [-345.044] (-345.238) (-344.426) (-345.303) * (-346.304) (-344.458) (-349.639) [-344.419] -- 0:00:06
904500 -- (-344.279) (-346.505) [-346.358] (-343.878) * (-346.102) (-345.594) [-346.402] (-346.206) -- 0:00:06
905000 -- (-348.032) (-346.010) (-346.048) [-343.885] * [-349.191] (-346.796) (-344.326) (-345.409) -- 0:00:06
Average standard deviation of split frequencies: 0.006487
905500 -- [-350.971] (-344.087) (-349.325) (-344.975) * (-344.921) (-348.477) (-345.034) [-344.854] -- 0:00:06
906000 -- (-345.128) [-344.514] (-349.468) (-349.601) * (-345.107) (-343.839) (-345.293) [-345.167] -- 0:00:06
906500 -- (-347.895) (-349.799) [-347.297] (-346.925) * (-344.683) (-347.014) (-346.051) [-344.441] -- 0:00:05
907000 -- [-344.860] (-345.973) (-343.994) (-352.193) * (-345.193) (-343.297) (-348.944) [-343.328] -- 0:00:05
907500 -- [-344.617] (-346.695) (-343.734) (-345.689) * (-344.107) [-349.053] (-344.044) (-344.886) -- 0:00:05
908000 -- (-343.663) [-344.988] (-350.170) (-346.746) * (-350.143) [-348.661] (-345.389) (-345.262) -- 0:00:05
908500 -- (-343.671) [-347.139] (-349.606) (-353.611) * (-344.345) [-344.368] (-344.670) (-344.113) -- 0:00:05
909000 -- (-347.087) (-347.707) (-344.840) [-344.931] * (-344.441) (-346.866) [-344.466] (-346.462) -- 0:00:05
909500 -- (-343.475) [-346.473] (-345.273) (-345.681) * (-345.276) (-345.326) [-344.404] (-346.849) -- 0:00:05
910000 -- (-344.378) [-343.258] (-344.693) (-343.455) * (-345.935) [-346.328] (-343.899) (-344.725) -- 0:00:05
Average standard deviation of split frequencies: 0.006729
910500 -- (-344.425) [-344.165] (-346.753) (-348.094) * (-345.738) (-348.647) (-346.720) [-343.801] -- 0:00:05
911000 -- [-347.121] (-344.701) (-345.203) (-344.822) * [-344.830] (-346.155) (-343.969) (-344.855) -- 0:00:05
911500 -- [-344.839] (-344.468) (-346.124) (-343.929) * (-344.911) (-346.303) [-344.177] (-346.211) -- 0:00:05
912000 -- (-346.243) (-348.474) [-347.370] (-345.584) * (-349.119) (-345.316) (-344.673) [-348.612] -- 0:00:05
912500 -- (-346.939) (-347.722) (-356.559) [-346.544] * (-345.507) [-344.645] (-343.186) (-345.251) -- 0:00:05
913000 -- (-354.328) [-346.914] (-345.843) (-346.016) * (-346.052) [-344.373] (-343.080) (-346.813) -- 0:00:05
913500 -- (-350.060) (-348.735) (-346.459) [-345.282] * (-345.291) (-344.122) [-344.511] (-349.948) -- 0:00:05
914000 -- [-349.558] (-345.192) (-346.425) (-346.189) * (-345.064) (-344.137) (-346.826) [-345.309] -- 0:00:05
914500 -- (-344.462) [-345.989] (-345.740) (-345.152) * (-344.184) (-344.990) [-347.158] (-346.681) -- 0:00:05
915000 -- (-344.606) (-345.126) (-344.615) [-348.447] * (-345.814) (-343.379) (-346.977) [-345.526] -- 0:00:05
Average standard deviation of split frequencies: 0.006759
915500 -- [-343.833] (-344.847) (-346.647) (-343.756) * (-346.797) (-349.416) (-349.583) [-347.045] -- 0:00:05
916000 -- (-347.843) (-345.380) (-344.441) [-343.719] * [-344.900] (-345.891) (-346.255) (-344.040) -- 0:00:05
916500 -- [-344.719] (-349.555) (-344.182) (-344.338) * [-344.179] (-349.143) (-346.542) (-344.822) -- 0:00:05
917000 -- [-345.264] (-350.849) (-343.935) (-344.278) * (-344.430) (-345.476) [-347.437] (-345.652) -- 0:00:05
917500 -- [-344.322] (-344.162) (-345.147) (-347.232) * [-345.570] (-346.695) (-347.387) (-344.488) -- 0:00:05
918000 -- (-345.447) (-349.458) (-346.945) [-345.774] * [-346.097] (-347.558) (-345.005) (-343.478) -- 0:00:05
918500 -- (-343.917) [-348.247] (-346.227) (-345.547) * [-345.090] (-345.869) (-343.516) (-343.508) -- 0:00:05
919000 -- (-343.554) (-346.054) (-346.178) [-345.701] * [-344.130] (-343.462) (-344.757) (-349.304) -- 0:00:05
919500 -- [-345.725] (-343.831) (-344.955) (-346.175) * (-345.259) [-344.423] (-343.502) (-344.890) -- 0:00:05
920000 -- (-345.881) [-344.002] (-344.233) (-344.115) * [-343.322] (-344.364) (-343.985) (-345.061) -- 0:00:05
Average standard deviation of split frequencies: 0.006827
920500 -- (-347.606) (-350.266) (-344.349) [-346.412] * (-343.571) [-346.182] (-344.458) (-345.001) -- 0:00:05
921000 -- (-347.011) (-345.217) (-345.779) [-344.272] * [-347.600] (-346.542) (-344.172) (-348.116) -- 0:00:05
921500 -- (-347.231) [-346.177] (-345.897) (-344.355) * [-345.429] (-344.804) (-343.461) (-345.053) -- 0:00:05
922000 -- [-345.051] (-347.526) (-346.086) (-344.287) * (-345.331) (-346.933) [-344.389] (-347.548) -- 0:00:04
922500 -- (-345.495) (-346.729) [-345.889] (-344.349) * (-348.531) [-345.306] (-344.853) (-344.683) -- 0:00:04
923000 -- (-349.860) (-345.711) [-351.722] (-347.088) * (-346.713) [-345.700] (-344.040) (-344.715) -- 0:00:04
923500 -- (-346.954) (-346.064) (-344.861) [-350.669] * (-351.075) [-346.575] (-343.692) (-347.013) -- 0:00:04
924000 -- (-343.825) (-344.318) (-345.079) [-345.244] * (-345.468) [-344.407] (-346.994) (-343.969) -- 0:00:04
924500 -- (-345.268) [-344.244] (-343.748) (-349.544) * [-346.002] (-345.464) (-343.808) (-345.515) -- 0:00:04
925000 -- (-345.232) [-344.292] (-350.891) (-346.349) * (-344.592) (-345.837) [-345.256] (-345.357) -- 0:00:04
Average standard deviation of split frequencies: 0.006618
925500 -- (-345.163) (-344.422) [-345.381] (-345.368) * (-343.618) (-345.211) [-346.162] (-345.011) -- 0:00:04
926000 -- (-348.698) (-343.156) [-346.364] (-344.405) * (-345.375) (-345.492) (-344.620) [-345.783] -- 0:00:04
926500 -- (-349.189) (-343.593) [-347.303] (-346.187) * [-347.342] (-345.202) (-343.909) (-345.959) -- 0:00:04
927000 -- (-344.269) [-343.626] (-345.575) (-346.504) * (-345.747) (-346.983) (-344.743) [-345.341] -- 0:00:04
927500 -- [-345.427] (-346.816) (-344.626) (-355.064) * [-345.024] (-349.101) (-348.551) (-343.705) -- 0:00:04
928000 -- (-344.480) (-346.188) [-344.587] (-352.195) * (-348.288) (-348.939) (-345.050) [-345.240] -- 0:00:04
928500 -- [-348.302] (-345.861) (-347.635) (-348.432) * (-343.956) [-344.013] (-343.699) (-344.453) -- 0:00:04
929000 -- (-351.484) [-346.786] (-346.956) (-349.414) * (-346.949) (-343.989) [-346.393] (-343.755) -- 0:00:04
929500 -- (-351.162) (-345.980) [-347.875] (-348.830) * (-345.856) (-343.433) (-347.202) [-347.054] -- 0:00:04
930000 -- (-347.106) [-348.377] (-347.432) (-344.848) * (-346.042) (-345.128) [-344.648] (-344.748) -- 0:00:04
Average standard deviation of split frequencies: 0.006754
930500 -- (-347.431) (-346.336) [-345.882] (-346.951) * [-345.011] (-351.269) (-345.159) (-345.518) -- 0:00:04
931000 -- (-344.116) (-348.381) [-346.302] (-347.220) * (-343.750) [-347.305] (-345.323) (-343.925) -- 0:00:04
931500 -- (-346.981) (-351.461) (-344.745) [-344.642] * (-343.637) (-344.897) [-344.350] (-344.988) -- 0:00:04
932000 -- (-346.048) (-347.959) [-347.028] (-343.590) * (-348.323) [-344.276] (-344.479) (-351.158) -- 0:00:04
932500 -- (-347.338) [-346.516] (-349.462) (-344.713) * (-348.566) (-344.587) [-343.634] (-345.216) -- 0:00:04
933000 -- (-347.609) (-345.350) (-347.404) [-346.132] * (-348.450) [-347.638] (-345.616) (-348.040) -- 0:00:04
933500 -- [-344.506] (-347.146) (-345.312) (-347.644) * [-346.956] (-349.506) (-344.136) (-350.034) -- 0:00:04
934000 -- (-346.546) (-345.411) [-345.677] (-346.268) * (-353.296) [-344.668] (-347.607) (-344.833) -- 0:00:04
934500 -- (-346.999) [-343.681] (-345.593) (-344.154) * (-344.732) [-344.865] (-344.475) (-345.467) -- 0:00:04
935000 -- (-344.405) (-343.684) [-345.002] (-349.762) * (-345.403) [-343.368] (-346.099) (-343.795) -- 0:00:04
Average standard deviation of split frequencies: 0.006715
935500 -- [-345.103] (-344.346) (-343.283) (-347.065) * (-346.834) (-345.014) [-346.266] (-343.932) -- 0:00:04
936000 -- (-346.204) (-345.902) [-344.387] (-345.247) * [-346.765] (-345.653) (-343.318) (-345.935) -- 0:00:04
936500 -- (-343.773) (-344.143) (-345.876) [-349.783] * (-349.282) [-343.222] (-350.266) (-344.174) -- 0:00:04
937000 -- (-344.900) (-346.786) (-345.938) [-351.089] * (-344.698) (-348.184) [-345.495] (-347.376) -- 0:00:04
937500 -- (-344.524) (-345.106) [-346.320] (-345.536) * (-344.084) [-348.687] (-349.473) (-347.059) -- 0:00:04
938000 -- (-347.252) (-347.108) (-344.333) [-344.537] * (-346.232) (-346.027) [-347.711] (-345.318) -- 0:00:03
938500 -- (-355.486) (-345.177) (-344.905) [-345.160] * [-347.515] (-348.582) (-348.930) (-345.261) -- 0:00:03
939000 -- (-348.344) (-343.453) [-344.632] (-344.861) * (-345.943) (-344.554) [-344.987] (-346.627) -- 0:00:03
939500 -- (-345.343) [-344.067] (-345.289) (-343.467) * (-347.283) (-344.649) (-343.441) [-349.098] -- 0:00:03
940000 -- [-349.625] (-346.273) (-346.625) (-343.838) * [-347.938] (-344.714) (-348.151) (-344.111) -- 0:00:03
Average standard deviation of split frequencies: 0.006648
940500 -- [-343.716] (-343.828) (-346.290) (-346.258) * (-349.648) (-345.848) [-347.727] (-343.243) -- 0:00:03
941000 -- (-345.658) [-346.508] (-344.577) (-346.836) * (-343.558) [-343.832] (-346.553) (-344.063) -- 0:00:03
941500 -- [-347.964] (-345.027) (-344.695) (-345.465) * (-346.262) [-345.502] (-343.805) (-347.076) -- 0:00:03
942000 -- [-344.842] (-344.513) (-346.178) (-348.245) * (-343.560) (-349.973) (-344.528) [-343.930] -- 0:00:03
942500 -- (-347.583) (-346.015) (-343.847) [-343.950] * [-348.481] (-344.864) (-343.288) (-345.486) -- 0:00:03
943000 -- [-344.245] (-346.833) (-343.842) (-344.295) * (-345.376) [-346.140] (-343.437) (-345.686) -- 0:00:03
943500 -- (-346.485) (-349.209) (-349.995) [-343.496] * (-347.408) (-346.497) (-343.572) [-344.959] -- 0:00:03
944000 -- (-347.904) (-346.266) [-347.269] (-345.778) * (-344.982) (-343.329) [-348.308] (-345.648) -- 0:00:03
944500 -- (-344.356) (-352.348) [-347.246] (-347.175) * (-345.832) [-345.521] (-344.688) (-343.826) -- 0:00:03
945000 -- (-347.399) [-345.726] (-347.516) (-344.466) * [-344.308] (-344.304) (-346.645) (-347.650) -- 0:00:03
Average standard deviation of split frequencies: 0.006412
945500 -- (-347.112) [-346.236] (-345.198) (-343.787) * (-347.603) [-344.592] (-345.168) (-343.382) -- 0:00:03
946000 -- [-346.006] (-344.496) (-343.373) (-343.746) * [-344.482] (-346.847) (-345.519) (-346.517) -- 0:00:03
946500 -- (-346.959) (-348.079) [-345.857] (-345.639) * (-347.261) [-345.039] (-344.689) (-345.880) -- 0:00:03
947000 -- (-344.690) [-344.866] (-346.568) (-347.607) * (-346.520) (-346.155) [-345.343] (-343.101) -- 0:00:03
947500 -- [-343.950] (-346.130) (-345.554) (-345.987) * (-349.620) (-350.214) [-345.657] (-344.477) -- 0:00:03
948000 -- (-344.791) (-345.447) (-344.723) [-347.496] * (-344.905) (-343.813) (-348.053) [-345.359] -- 0:00:03
948500 -- (-343.822) (-347.790) [-345.092] (-347.245) * (-344.775) [-346.142] (-344.230) (-344.760) -- 0:00:03
949000 -- [-343.678] (-344.782) (-344.288) (-344.925) * (-345.096) (-346.395) [-346.307] (-346.556) -- 0:00:03
949500 -- (-345.107) (-344.711) (-343.820) [-345.298] * (-346.159) (-343.842) (-345.589) [-346.296] -- 0:00:03
950000 -- (-344.582) (-345.030) (-343.735) [-346.307] * (-346.318) (-343.718) (-346.321) [-343.588] -- 0:00:03
Average standard deviation of split frequencies: 0.006182
950500 -- (-346.140) (-343.876) [-343.554] (-344.248) * (-346.600) (-343.276) [-345.431] (-348.843) -- 0:00:03
951000 -- (-347.728) (-345.746) [-345.659] (-345.679) * (-344.034) (-343.276) [-344.521] (-344.975) -- 0:00:03
951500 -- (-344.093) (-347.682) [-343.491] (-344.036) * (-345.340) (-345.084) [-345.656] (-347.251) -- 0:00:03
952000 -- (-344.077) (-345.848) [-344.551] (-345.330) * (-344.749) [-344.381] (-346.993) (-344.398) -- 0:00:03
952500 -- [-345.051] (-345.310) (-344.665) (-344.790) * [-344.133] (-345.384) (-344.732) (-348.747) -- 0:00:03
953000 -- [-347.135] (-347.635) (-343.915) (-343.388) * (-347.291) (-343.771) [-345.185] (-345.696) -- 0:00:03
953500 -- (-344.025) (-347.342) (-345.923) [-347.175] * (-346.645) [-343.554] (-343.993) (-346.433) -- 0:00:02
954000 -- [-344.588] (-345.046) (-345.088) (-344.269) * [-347.897] (-346.783) (-348.395) (-344.499) -- 0:00:02
954500 -- (-343.620) (-348.731) (-348.247) [-344.804] * (-345.343) (-344.514) [-345.140] (-350.035) -- 0:00:02
955000 -- [-343.325] (-344.897) (-345.276) (-346.633) * (-345.912) (-346.373) (-345.610) [-348.595] -- 0:00:02
Average standard deviation of split frequencies: 0.006312
955500 -- (-344.893) [-344.142] (-347.077) (-344.041) * [-343.708] (-349.867) (-347.767) (-349.333) -- 0:00:02
956000 -- (-346.270) (-343.566) [-344.171] (-346.129) * (-344.490) [-345.167] (-345.103) (-344.257) -- 0:00:02
956500 -- [-348.756] (-344.895) (-344.281) (-344.158) * (-344.267) (-347.937) (-345.058) [-344.270] -- 0:00:02
957000 -- (-345.575) (-346.253) (-347.616) [-343.591] * (-347.092) (-347.057) [-345.119] (-346.626) -- 0:00:02
957500 -- (-344.553) (-345.216) [-347.247] (-347.351) * (-345.726) (-345.559) (-344.772) [-346.709] -- 0:00:02
958000 -- (-348.810) (-345.417) (-350.841) [-350.979] * (-344.564) (-347.617) [-345.479] (-346.420) -- 0:00:02
958500 -- (-346.284) (-344.195) [-349.368] (-346.302) * (-347.546) (-343.765) [-344.364] (-347.868) -- 0:00:02
959000 -- (-346.197) [-345.959] (-346.578) (-343.592) * (-347.466) (-354.699) [-343.644] (-344.188) -- 0:00:02
959500 -- (-344.331) (-345.355) (-343.679) [-346.672] * (-344.948) (-348.549) (-347.027) [-346.673] -- 0:00:02
960000 -- [-344.108] (-346.819) (-344.569) (-347.941) * [-345.175] (-346.370) (-344.865) (-343.674) -- 0:00:02
Average standard deviation of split frequencies: 0.006379
960500 -- (-345.402) (-345.522) (-344.421) [-344.753] * (-344.897) (-345.925) [-346.923] (-344.920) -- 0:00:02
961000 -- (-351.353) [-345.399] (-344.571) (-350.553) * (-345.183) (-346.980) [-346.621] (-343.988) -- 0:00:02
961500 -- (-350.541) (-344.909) (-343.942) [-346.115] * (-346.042) [-345.010] (-348.151) (-346.669) -- 0:00:02
962000 -- [-344.781] (-343.113) (-348.277) (-347.115) * (-345.216) (-345.511) [-346.261] (-347.676) -- 0:00:02
962500 -- (-345.749) [-346.789] (-345.220) (-343.543) * (-346.770) (-344.165) [-344.815] (-344.305) -- 0:00:02
963000 -- (-344.142) (-345.290) (-347.076) [-345.425] * [-347.549] (-343.829) (-343.450) (-346.472) -- 0:00:02
963500 -- [-345.306] (-347.468) (-345.009) (-345.601) * (-347.801) (-345.343) [-346.407] (-345.209) -- 0:00:02
964000 -- [-343.291] (-348.214) (-344.267) (-344.718) * [-345.697] (-344.397) (-347.521) (-345.913) -- 0:00:02
964500 -- [-343.936] (-346.064) (-345.849) (-343.830) * (-352.082) (-345.093) (-344.949) [-343.991] -- 0:00:02
965000 -- (-347.378) [-347.208] (-344.799) (-345.791) * [-347.627] (-346.154) (-344.223) (-345.317) -- 0:00:02
Average standard deviation of split frequencies: 0.006116
965500 -- (-345.692) (-344.307) [-347.345] (-346.039) * (-346.280) (-345.236) [-345.541] (-345.481) -- 0:00:02
966000 -- (-348.800) (-343.890) [-346.563] (-349.328) * (-343.830) (-345.167) (-349.798) [-347.831] -- 0:00:02
966500 -- (-343.768) [-347.642] (-346.578) (-345.069) * (-353.726) (-344.564) [-345.376] (-349.133) -- 0:00:02
967000 -- (-344.263) [-346.621] (-346.152) (-344.731) * (-351.487) (-344.342) (-345.465) [-345.207] -- 0:00:02
967500 -- (-349.221) [-343.227] (-347.116) (-348.043) * (-346.977) (-346.132) (-345.631) [-352.093] -- 0:00:02
968000 -- (-348.315) (-345.699) [-346.142] (-344.072) * (-346.485) [-347.473] (-345.516) (-344.738) -- 0:00:02
968500 -- (-345.175) (-343.924) (-344.222) [-343.614] * (-349.366) (-349.177) [-345.685] (-345.253) -- 0:00:02
969000 -- (-347.302) (-345.793) (-345.232) [-344.955] * [-345.278] (-349.697) (-343.212) (-344.947) -- 0:00:01
969500 -- (-348.317) [-347.394] (-346.505) (-344.566) * (-344.321) [-344.453] (-345.361) (-346.633) -- 0:00:01
970000 -- (-347.487) (-351.024) [-346.523] (-343.385) * (-343.462) (-343.909) [-343.586] (-344.285) -- 0:00:01
Average standard deviation of split frequencies: 0.005925
970500 -- (-346.585) (-346.121) (-346.784) [-345.280] * (-344.821) [-345.207] (-346.024) (-344.289) -- 0:00:01
971000 -- (-344.737) (-353.386) [-345.654] (-344.413) * [-345.815] (-344.184) (-346.269) (-343.957) -- 0:00:01
971500 -- (-347.759) (-344.426) [-347.415] (-352.480) * (-344.931) [-345.972] (-347.062) (-344.759) -- 0:00:01
972000 -- (-345.522) [-344.744] (-349.480) (-352.476) * (-343.210) (-346.752) [-345.357] (-343.793) -- 0:00:01
972500 -- [-344.191] (-344.569) (-349.156) (-348.757) * (-345.025) (-346.381) (-348.660) [-343.848] -- 0:00:01
973000 -- (-344.895) (-345.880) (-344.471) [-344.236] * (-346.659) (-346.310) (-347.803) [-345.610] -- 0:00:01
973500 -- (-352.174) (-344.284) [-347.509] (-344.463) * (-345.502) (-345.897) (-346.285) [-347.738] -- 0:00:01
974000 -- [-346.746] (-346.738) (-347.960) (-346.306) * (-348.229) [-345.196] (-344.729) (-346.392) -- 0:00:01
974500 -- (-345.754) [-346.512] (-346.807) (-350.602) * (-344.054) (-345.819) (-345.061) [-344.895] -- 0:00:01
975000 -- (-344.472) (-344.535) [-348.032] (-346.841) * (-345.552) (-346.353) [-345.153] (-344.762) -- 0:00:01
Average standard deviation of split frequencies: 0.005989
975500 -- [-345.522] (-346.766) (-345.950) (-352.935) * (-345.777) (-348.876) (-344.493) [-344.782] -- 0:00:01
976000 -- (-344.578) (-344.377) (-345.416) [-345.810] * (-346.567) (-346.363) (-344.753) [-348.453] -- 0:00:01
976500 -- (-348.608) (-347.849) (-343.531) [-345.964] * [-347.073] (-344.664) (-345.636) (-348.383) -- 0:00:01
977000 -- (-347.578) [-344.519] (-345.976) (-348.102) * (-346.938) (-344.587) [-343.944] (-345.429) -- 0:00:01
977500 -- (-344.798) [-346.892] (-343.483) (-347.266) * (-344.439) (-343.761) (-343.885) [-344.984] -- 0:00:01
978000 -- (-346.942) (-345.696) [-347.150] (-349.051) * (-345.900) (-347.146) [-350.094] (-346.452) -- 0:00:01
978500 -- (-346.853) [-345.601] (-343.663) (-350.768) * (-345.756) [-345.689] (-346.742) (-343.746) -- 0:00:01
979000 -- (-344.080) (-343.918) [-343.777] (-349.555) * (-347.408) (-347.840) (-345.976) [-343.925] -- 0:00:01
979500 -- (-343.636) [-347.347] (-346.093) (-346.225) * (-344.952) [-344.319] (-348.155) (-345.610) -- 0:00:01
980000 -- [-344.186] (-346.797) (-345.711) (-344.482) * (-346.558) (-344.916) [-346.074] (-346.393) -- 0:00:01
Average standard deviation of split frequencies: 0.006121
980500 -- (-345.065) (-346.406) [-346.414] (-345.070) * (-351.059) (-347.118) [-345.907] (-344.761) -- 0:00:01
981000 -- [-346.547] (-344.262) (-350.285) (-347.756) * (-349.598) (-346.596) [-346.550] (-346.671) -- 0:00:01
981500 -- (-347.665) [-343.799] (-343.360) (-343.518) * (-343.842) (-346.765) [-345.347] (-344.789) -- 0:00:01
982000 -- (-343.942) (-345.156) [-351.803] (-346.492) * [-343.791] (-345.073) (-346.818) (-343.459) -- 0:00:01
982500 -- (-343.961) [-347.811] (-345.251) (-345.726) * (-343.417) [-343.681] (-347.083) (-344.403) -- 0:00:01
983000 -- [-347.111] (-344.909) (-347.488) (-345.131) * (-343.089) [-344.480] (-345.410) (-346.897) -- 0:00:01
983500 -- (-348.707) [-346.069] (-350.006) (-345.254) * (-343.642) (-343.419) (-348.555) [-346.784] -- 0:00:01
984000 -- (-343.849) [-346.717] (-345.647) (-346.229) * (-343.816) (-343.376) (-346.892) [-346.927] -- 0:00:01
984500 -- [-347.209] (-346.485) (-346.724) (-346.105) * (-344.449) [-343.293] (-345.763) (-348.423) -- 0:00:00
985000 -- (-347.383) (-344.384) [-344.433] (-343.997) * (-343.726) [-343.172] (-345.340) (-350.568) -- 0:00:00
Average standard deviation of split frequencies: 0.006120
985500 -- (-343.697) [-344.176] (-343.455) (-343.951) * [-344.023] (-346.276) (-344.007) (-344.784) -- 0:00:00
986000 -- (-343.358) (-345.173) [-345.453] (-346.067) * [-346.402] (-347.717) (-344.675) (-343.984) -- 0:00:00
986500 -- [-343.749] (-349.276) (-347.932) (-354.124) * [-344.602] (-347.741) (-345.511) (-343.941) -- 0:00:00
987000 -- (-344.162) (-344.691) (-346.660) [-344.525] * (-344.308) (-347.008) (-345.430) [-348.158] -- 0:00:00
987500 -- (-344.567) [-343.492] (-344.939) (-348.558) * (-344.440) [-346.901] (-344.419) (-344.628) -- 0:00:00
988000 -- (-344.565) (-343.477) (-349.050) [-350.480] * (-347.782) (-346.933) (-345.523) [-346.130] -- 0:00:00
988500 -- (-351.278) (-343.499) (-346.899) [-346.057] * (-346.378) (-345.798) [-346.257] (-345.672) -- 0:00:00
989000 -- (-346.002) (-344.545) (-343.953) [-344.600] * (-345.292) [-345.708] (-345.993) (-343.847) -- 0:00:00
989500 -- (-344.083) [-343.787] (-345.159) (-343.588) * (-348.003) [-345.858] (-345.198) (-344.758) -- 0:00:00
990000 -- (-349.285) (-347.673) [-344.416] (-343.487) * [-343.760] (-346.698) (-343.738) (-345.986) -- 0:00:00
Average standard deviation of split frequencies: 0.005996
990500 -- (-345.183) (-347.405) [-344.210] (-345.986) * (-345.624) [-344.102] (-343.708) (-348.027) -- 0:00:00
991000 -- (-346.640) [-344.521] (-343.533) (-346.140) * [-344.836] (-345.054) (-344.918) (-348.693) -- 0:00:00
991500 -- [-344.063] (-345.654) (-345.233) (-343.721) * (-345.730) (-346.049) (-344.371) [-345.092] -- 0:00:00
992000 -- (-344.551) (-344.672) [-347.391] (-347.434) * [-344.341] (-346.292) (-346.067) (-347.642) -- 0:00:00
992500 -- (-345.712) (-344.230) [-344.496] (-348.792) * (-344.316) (-344.568) (-345.279) [-346.527] -- 0:00:00
993000 -- [-345.022] (-343.765) (-344.383) (-345.279) * (-343.843) [-346.023] (-347.015) (-349.263) -- 0:00:00
993500 -- (-345.174) (-346.774) [-344.644] (-346.032) * (-346.872) (-346.738) (-347.093) [-349.114] -- 0:00:00
994000 -- (-344.663) (-349.334) (-345.458) [-346.065] * [-353.027] (-345.729) (-346.428) (-347.281) -- 0:00:00
994500 -- (-346.435) (-344.897) (-349.734) [-346.779] * (-347.385) [-343.628] (-343.409) (-344.085) -- 0:00:00
995000 -- (-346.867) (-345.007) (-346.094) [-347.112] * (-343.978) (-343.219) [-343.932] (-343.753) -- 0:00:00
Average standard deviation of split frequencies: 0.006248
995500 -- [-346.838] (-344.726) (-346.236) (-345.499) * (-344.967) (-343.113) [-345.328] (-346.497) -- 0:00:00
996000 -- [-346.298] (-347.427) (-345.280) (-346.964) * (-345.521) (-343.113) [-345.970] (-347.127) -- 0:00:00
996500 -- (-345.080) (-347.942) [-348.845] (-351.041) * [-347.440] (-343.288) (-345.037) (-344.755) -- 0:00:00
997000 -- (-345.759) (-347.601) [-348.068] (-344.096) * [-345.378] (-343.955) (-345.805) (-348.559) -- 0:00:00
997500 -- (-349.298) (-345.518) [-344.149] (-345.680) * (-345.806) (-345.044) (-345.231) [-346.210] -- 0:00:00
998000 -- (-345.129) (-343.923) (-345.397) [-344.852] * (-346.073) [-346.084] (-344.376) (-349.193) -- 0:00:00
998500 -- (-344.842) (-343.800) [-347.023] (-347.075) * (-356.944) (-344.415) (-346.494) [-344.796] -- 0:00:00
999000 -- (-348.160) (-345.993) [-348.132] (-344.419) * (-349.016) [-347.435] (-343.452) (-346.469) -- 0:00:00
999500 -- (-346.054) (-345.149) (-345.921) [-344.105] * (-345.501) (-344.816) [-345.999] (-349.799) -- 0:00:00
1000000 -- [-345.678] (-346.271) (-349.968) (-354.364) * [-344.628] (-344.725) (-349.101) (-345.184) -- 0:00:00
Average standard deviation of split frequencies: 0.006218
Analysis completed in 1 mins 4 seconds
Analysis used 63.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -342.97
Likelihood of best state for "cold" chain of run 2 was -342.97
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.3 % ( 33 %) Dirichlet(Pi{all})
41.8 % ( 29 %) Slider(Pi{all})
78.3 % ( 51 %) Multiplier(Alpha{1,2})
77.1 % ( 50 %) Multiplier(Alpha{3})
26.4 % ( 27 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 90 %) ParsSPR(Tau{all},V{all})
28.0 % ( 16 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.3 % ( 35 %) Dirichlet(Pi{all})
41.4 % ( 23 %) Slider(Pi{all})
78.5 % ( 55 %) Multiplier(Alpha{1,2})
77.8 % ( 56 %) Multiplier(Alpha{3})
27.0 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.1 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166666 0.83 0.67
3 | 167218 166059 0.84
4 | 166530 166732 166795
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166727 0.82 0.67
3 | 166946 166241 0.84
4 | 166248 166488 167350
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -344.77
| 1 2 1 |
| 2 1 *2 |
| 1 |
| 2 1 2 2 |
|2 2 2 1 2 |
| 22 1 1 1 2 2 1 2 1 12 2 |
| 1121 2 *1 1 2 * 2 22 |
| 1 1 22 2 2 * 2 2 111 * 21 22 1 2 |
| 1 111 2 * 2 |
|1 21 2 2 1 21 2 12 1 112 1 |
| 2 * 1 1 1 12 1 1 1 1|
| 1 2 1 2 2 2|
| 1 1 2 1 |
| 2 11 2 |
| 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -346.26
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -344.76 -347.89
2 -344.77 -348.26
--------------------------------------
TOTAL -344.76 -348.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894678 0.088258 0.394370 1.519389 0.863336 1299.86 1400.43 1.001
r(A<->C){all} 0.159576 0.018549 0.000093 0.436396 0.121492 165.48 195.12 1.000
r(A<->G){all} 0.161443 0.018251 0.000030 0.439253 0.126382 217.16 239.18 1.002
r(A<->T){all} 0.167405 0.020025 0.000028 0.458592 0.128345 162.02 199.96 1.000
r(C<->G){all} 0.157167 0.017755 0.000031 0.418328 0.122672 207.95 292.52 1.004
r(C<->T){all} 0.177621 0.021971 0.000175 0.475461 0.138615 253.22 274.08 1.003
r(G<->T){all} 0.176788 0.021803 0.000003 0.466215 0.133663 186.45 205.84 1.000
pi(A){all} 0.227261 0.000697 0.174545 0.276150 0.227037 1306.71 1336.31 1.000
pi(C){all} 0.323670 0.000881 0.267949 0.383024 0.323266 1289.02 1347.25 1.000
pi(G){all} 0.273354 0.000776 0.218414 0.327107 0.272760 1316.28 1338.53 1.000
pi(T){all} 0.175716 0.000554 0.132111 0.221963 0.174780 1357.91 1408.63 1.000
alpha{1,2} 0.429228 0.237845 0.000238 1.449755 0.247098 1263.31 1267.18 1.000
alpha{3} 0.452109 0.234900 0.000521 1.432846 0.288085 1047.58 1137.31 1.000
pinvar{all} 0.993178 0.000068 0.977784 0.999999 0.995809 1100.47 1190.18 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ..*.*.
9 -- ...*.*
10 -- .*..*.
11 -- ..*..*
12 -- ..**..
13 -- ....**
14 -- .**...
15 -- .*.*..
16 -- .***.*
17 -- .*...*
18 -- .****.
19 -- .*.***
20 -- .**.**
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 451 0.150233 0.006124 0.145903 0.154564 2
8 444 0.147901 0.000942 0.147235 0.148568 2
9 444 0.147901 0.004711 0.144570 0.151233 2
10 444 0.147901 0.000942 0.147235 0.148568 2
11 443 0.147568 0.004240 0.144570 0.150566 2
12 438 0.145903 0.016017 0.134577 0.157229 2
13 437 0.145570 0.001413 0.144570 0.146569 2
14 426 0.141905 0.009422 0.135243 0.148568 2
15 424 0.141239 0.003769 0.138574 0.143904 2
16 423 0.140906 0.014604 0.130580 0.151233 2
17 423 0.140906 0.003298 0.138574 0.143238 2
18 418 0.139241 0.001884 0.137908 0.140573 2
19 417 0.138907 0.010835 0.131246 0.146569 2
20 415 0.138241 0.002355 0.136576 0.139907 2
21 407 0.135576 0.012719 0.126582 0.144570 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100105 0.009597 0.000030 0.294342 0.069754 1.000 2
length{all}[2] 0.101077 0.009982 0.000008 0.300908 0.071684 1.000 2
length{all}[3] 0.098150 0.009491 0.000004 0.291861 0.069325 1.000 2
length{all}[4] 0.099085 0.009994 0.000022 0.309108 0.068788 1.000 2
length{all}[5] 0.099206 0.009947 0.000004 0.305508 0.068949 1.000 2
length{all}[6] 0.099428 0.010663 0.000033 0.300904 0.065473 1.000 2
length{all}[7] 0.103016 0.011842 0.000084 0.355700 0.067026 1.005 2
length{all}[8] 0.102870 0.008619 0.000083 0.288494 0.076727 1.004 2
length{all}[9] 0.105811 0.010259 0.000440 0.322706 0.078582 0.998 2
length{all}[10] 0.096269 0.009400 0.000700 0.294336 0.070193 1.004 2
length{all}[11] 0.098344 0.008108 0.000040 0.286472 0.068853 0.998 2
length{all}[12] 0.096923 0.008407 0.000660 0.282446 0.070380 0.999 2
length{all}[13] 0.113648 0.012323 0.000216 0.315464 0.078528 0.998 2
length{all}[14] 0.099219 0.008044 0.000177 0.291841 0.070731 0.998 2
length{all}[15] 0.098359 0.009760 0.000446 0.314521 0.066805 1.000 2
length{all}[16] 0.096706 0.008709 0.000094 0.295801 0.066429 1.004 2
length{all}[17] 0.094512 0.009504 0.000047 0.278654 0.063465 0.998 2
length{all}[18] 0.105591 0.012207 0.000036 0.315204 0.069228 1.000 2
length{all}[19] 0.099061 0.009704 0.000040 0.293909 0.068632 0.998 2
length{all}[20] 0.095854 0.010942 0.000042 0.309608 0.064597 0.998 2
length{all}[21] 0.102665 0.009680 0.000035 0.296322 0.071389 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006218
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 252
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 45 patterns at 84 / 84 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 45 patterns at 84 / 84 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
43920 bytes for conP
3960 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042697 0.072401 0.064404 0.056952 0.014618 0.066876 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -357.675964
Iterating by ming2
Initial: fx= 357.675964
x= 0.04270 0.07240 0.06440 0.05695 0.01462 0.06688 0.30000 1.30000
1 h-m-p 0.0000 0.0002 201.6847 +++ 350.495479 m 0.0002 14 | 1/8
2 h-m-p 0.0013 0.0133 24.9494 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 184.3333 +++ 338.900341 m 0.0003 46 | 2/8
4 h-m-p 0.0030 0.0189 18.8840 ------------.. | 2/8
5 h-m-p 0.0000 0.0002 165.5534 +++ 334.146131 m 0.0002 79 | 3/8
6 h-m-p 0.0018 0.0310 13.5419 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 143.6625 ++ 332.273032 m 0.0001 111 | 4/8
8 h-m-p 0.0011 0.0489 10.0224 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 117.4171 ++ 331.858012 m 0.0000 142 | 5/8
10 h-m-p 0.0004 0.0790 6.8042 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 83.0222 ++ 331.393717 m 0.0001 172 | 6/8
12 h-m-p 0.5486 8.0000 0.0000 ----C 331.393717 0 0.0005 187 | 6/8
13 h-m-p 0.0847 8.0000 0.0000 N 331.393717 0 0.0847 200
Out..
lnL = -331.393717
201 lfun, 201 eigenQcodon, 1206 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090617 0.057005 0.013998 0.036495 0.085301 0.056344 0.299924 0.541333 0.159603
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.766843
np = 9
lnL0 = -357.957654
Iterating by ming2
Initial: fx= 357.957654
x= 0.09062 0.05701 0.01400 0.03649 0.08530 0.05634 0.29992 0.54133 0.15960
1 h-m-p 0.0000 0.0002 180.4300 +++ 351.739447 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0011 105.1347 ++ 342.834109 m 0.0011 27 | 2/9
3 h-m-p 0.0000 0.0002 398.6742 ++ 336.849620 m 0.0002 39 | 3/9
4 h-m-p 0.0000 0.0000 101.9947 ++ 336.679499 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 2352.0418 ++ 336.331894 m 0.0000 63 | 5/9
6 h-m-p 0.0004 0.0341 12.2312 -----------.. | 5/9
7 h-m-p 0.0000 0.0003 111.9770 +++ 331.864015 m 0.0003 97 | 6/9
8 h-m-p 0.0053 0.0775 5.2312 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 82.7779 ++ 331.393721 m 0.0001 131 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 331.393721 m 8.0000 146 | 7/9
11 h-m-p 0.0160 8.0000 0.0081 ------C 331.393721 0 0.0000 166 | 7/9
12 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 331.393721 m 8.0000 208 | 7/9
14 h-m-p 0.0011 0.5363 0.9125 +++++ 331.393716 m 0.5363 225 | 8/9
15 h-m-p 0.1603 0.8014 0.2609 ++ 331.393716 m 0.8014 239 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 N 331.393716 0 0.0160 252
Out..
lnL = -331.393716
253 lfun, 759 eigenQcodon, 3036 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049228 0.053587 0.032229 0.048088 0.087116 0.056563 0.000100 1.208146 0.227863 0.383353 1.375763
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.328156
np = 11
lnL0 = -357.441718
Iterating by ming2
Initial: fx= 357.441718
x= 0.04923 0.05359 0.03223 0.04809 0.08712 0.05656 0.00011 1.20815 0.22786 0.38335 1.37576
1 h-m-p 0.0000 0.0000 187.7980 ++ 357.025510 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0020 98.9441 ++++ 341.843173 m 0.0020 32 | 2/11
3 h-m-p 0.0000 0.0002 354.7068 ++ 335.844113 m 0.0002 46 | 3/11
4 h-m-p 0.0002 0.0009 31.9620 ++ 335.227236 m 0.0009 60 | 4/11
5 h-m-p 0.0000 0.0000 11499.4081 ++ 333.744248 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 2782.7406 ++ 333.057084 m 0.0000 88 | 6/11
7 h-m-p 0.0000 0.0000 27774.2281 ++ 333.002551 m 0.0000 102 | 7/11
8 h-m-p 0.0005 0.2677 3.3428 -----------.. | 7/11
9 h-m-p 0.0000 0.0002 81.0671 +++ 331.393718 m 0.0002 140 | 8/11
10 h-m-p 1.2188 8.0000 0.0000 ++ 331.393718 m 8.0000 154 | 8/11
11 h-m-p 0.0203 8.0000 0.0010 +++++ 331.393718 m 8.0000 174 | 8/11
12 h-m-p 0.0160 8.0000 1.6417 ++++Y 331.393714 0 4.0960 195 | 8/11
13 h-m-p 1.6000 8.0000 0.0744 --------Y 331.393714 0 0.0000 217 | 8/11
14 h-m-p 0.8669 8.0000 0.0000 ++ 331.393714 m 8.0000 234 | 8/11
15 h-m-p 0.0160 8.0000 0.0058 +++++ 331.393714 m 8.0000 254 | 8/11
16 h-m-p 0.0160 8.0000 11.4435 +++++ 331.393713 m 8.0000 274 | 8/11
17 h-m-p 1.6000 8.0000 0.1179 ++ 331.393713 m 8.0000 288 | 8/11
18 h-m-p 0.0236 5.2931 39.9182 -------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 Y 331.393713 0 0.0040 330
Out..
lnL = -331.393713
331 lfun, 1324 eigenQcodon, 5958 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -331.392407 S = -331.391793 -0.000234
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:03
did 20 / 45 patterns 0:03
did 30 / 45 patterns 0:03
did 40 / 45 patterns 0:03
did 45 / 45 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059548 0.046241 0.064490 0.053402 0.030094 0.049113 0.000100 0.284989 1.107146
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 24.330494
np = 9
lnL0 = -354.970094
Iterating by ming2
Initial: fx= 354.970094
x= 0.05955 0.04624 0.06449 0.05340 0.03009 0.04911 0.00011 0.28499 1.10715
1 h-m-p 0.0000 0.0000 178.9143 ++ 354.760418 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0203 16.1259 +++YCYCCC 354.052079 5 0.0131 37 | 1/9
3 h-m-p 0.0302 0.1512 4.5310 --------------.. | 1/9
4 h-m-p 0.0000 0.0004 180.8584 +++ 341.255334 m 0.0004 74 | 2/9
5 h-m-p 0.0003 0.0016 69.6611 ++ 334.892166 m 0.0016 86 | 3/9
6 h-m-p 0.0000 0.0001 322.1319 ++ 334.108794 m 0.0001 98 | 4/9
7 h-m-p 0.0040 0.1017 7.0547 ------------.. | 4/9
8 h-m-p 0.0000 0.0001 141.4684 ++ 332.957682 m 0.0001 132 | 5/9
9 h-m-p 0.0041 0.2011 1.6022 ------------.. | 5/9
10 h-m-p 0.0000 0.0001 116.2886 ++ 331.844404 m 0.0001 166 | 6/9
11 h-m-p 0.0076 1.0216 0.8888 -------------.. | 6/9
12 h-m-p 0.0000 0.0001 82.8638 ++ 331.393721 m 0.0001 204 | 7/9
13 h-m-p 0.0457 8.0000 0.0000 ++++ 331.393721 m 8.0000 218 | 7/9
14 h-m-p 0.0416 8.0000 0.0006 -----C 331.393721 0 0.0000 237
Out..
lnL = -331.393721
238 lfun, 2618 eigenQcodon, 14280 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058961 0.067375 0.074968 0.099923 0.014593 0.042489 0.000100 0.900000 1.114317 1.963202 1.300014
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.372190
np = 11
lnL0 = -359.370203
Iterating by ming2
Initial: fx= 359.370203
x= 0.05896 0.06738 0.07497 0.09992 0.01459 0.04249 0.00011 0.90000 1.11432 1.96320 1.30001
1 h-m-p 0.0000 0.0000 180.7941 ++ 359.126265 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0013 80.2379 ++++ 352.371416 m 0.0013 32 | 2/11
3 h-m-p 0.0002 0.0012 69.4077 ++ 341.588163 m 0.0012 46 | 3/11
4 h-m-p 0.0029 0.0148 28.2885 ++ 335.562390 m 0.0148 60 | 4/11
5 h-m-p 0.0000 0.0000 44482.4661 ++ 333.759315 m 0.0000 74 | 5/11
6 h-m-p 0.0002 0.0008 437.3273 ++ 332.624968 m 0.0008 88 | 6/11
7 h-m-p 0.0000 0.0000 26937908.5876 ++ 331.393716 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 331.393716 m 8.0000 116 | 7/11
9 h-m-p 0.0855 8.0000 0.0100 ++++ 331.393716 m 8.0000 136 | 7/11
10 h-m-p 0.0122 0.0609 3.3960 +
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
+ 331.393715 m 0.0609 154
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.093917e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057016e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057017e-160 2000 rounds
| 7/11
11 h-m-p 0.2622 2.9175 0.7888 -------
QuantileBeta(0.15, 0.00500, 2.42639) = 1.207061e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.092885e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.066438e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.059177e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057556e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057049e-160 2000 rounds
Y 331.393715 0 0.0000 180
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42652) = 1.057083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42627) = 1.057220e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057152e-160 2000 rounds
| 7/11
12 h-m-p 0.0018 0.0088 0.0000
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057145e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057150e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057151e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057151e-160 2000 rounds
Y 331.393715 0 0.0000 200
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057151e-160 2000 rounds
Out..
lnL = -331.393715
201 lfun, 2412 eigenQcodon, 13266 P(t)
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057151e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -331.396922 S = -331.392143 -0.002093
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 45 patterns 0:11
did 20 / 45 patterns 0:11
did 30 / 45 patterns 0:11
did 40 / 45 patterns 0:11
did 45 / 45 patterns 0:12
QuantileBeta(0.15, 0.00500, 2.42639) = 1.057151e-160 2000 rounds
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
NC_011896_1_WP_010907559_1_143_MLBR_RS00710 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
NC_002677_1_NP_301234_1_106_ML0141 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM
**************************************************
NC_011896_1_WP_010907559_1_143_MLBR_RS00710 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
NC_002677_1_NP_301234_1_106_ML0141 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760 KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
**********************************
>NC_011896_1_WP_010907559_1_143_MLBR_RS00710 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT >NC_002677_1_NP_301234_1_106_ML0141 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT >NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT >NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT >NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT >NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760 ATGCGTCTCAAAGTCATTGACAGCCCGGCCAGCACCCGGACTAATCGGAT TGTCTTGCAAGAACATCTGCACCTCAGCGTCGGCAACCGCGGCGGCACTG GGATGCGTGGCGGCTACTCCCTCTTCAACGTGCCTGTCGATCCGTACATG AAGATGATCCACACACCGAGGCACGTACCAGAGGCTCCGCGGCCAACCAG TCACGGAACAAGCCGGGGCTTCGTTTACACGCCCATGGACAGGTCAGCGA GT
>NC_011896_1_WP_010907559_1_143_MLBR_RS00710 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS >NC_002677_1_NP_301234_1_106_ML0141 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS >NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS >NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS >NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS >NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760 MRLKVIDSPASTRTNRIVLQEHLHLSVGNRGGTGMRGGYSLFNVPVDPYM KMIHTPRHVPEAPRPTSHGTSRGFVYTPMDRSAS
#NEXUS
[ID: 0768293489]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907559_1_143_MLBR_RS00710
NC_002677_1_NP_301234_1_106_ML0141
NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955
NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030
NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735
NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907559_1_143_MLBR_RS00710,
2 NC_002677_1_NP_301234_1_106_ML0141,
3 NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955,
4 NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030,
5 NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735,
6 NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06975397,2:0.07168445,3:0.06932537,4:0.06878847,5:0.06894937,6:0.06547295);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06975397,2:0.07168445,3:0.06932537,4:0.06878847,5:0.06894937,6:0.06547295);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -344.76 -347.89
2 -344.77 -348.26
--------------------------------------
TOTAL -344.76 -348.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0141/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894678 0.088258 0.394370 1.519389 0.863336 1299.86 1400.43 1.001
r(A<->C){all} 0.159576 0.018549 0.000093 0.436396 0.121492 165.48 195.12 1.000
r(A<->G){all} 0.161443 0.018251 0.000030 0.439253 0.126382 217.16 239.18 1.002
r(A<->T){all} 0.167405 0.020025 0.000028 0.458592 0.128345 162.02 199.96 1.000
r(C<->G){all} 0.157167 0.017755 0.000031 0.418328 0.122672 207.95 292.52 1.004
r(C<->T){all} 0.177621 0.021971 0.000175 0.475461 0.138615 253.22 274.08 1.003
r(G<->T){all} 0.176788 0.021803 0.000003 0.466215 0.133663 186.45 205.84 1.000
pi(A){all} 0.227261 0.000697 0.174545 0.276150 0.227037 1306.71 1336.31 1.000
pi(C){all} 0.323670 0.000881 0.267949 0.383024 0.323266 1289.02 1347.25 1.000
pi(G){all} 0.273354 0.000776 0.218414 0.327107 0.272760 1316.28 1338.53 1.000
pi(T){all} 0.175716 0.000554 0.132111 0.221963 0.174780 1357.91 1408.63 1.000
alpha{1,2} 0.429228 0.237845 0.000238 1.449755 0.247098 1263.31 1267.18 1.000
alpha{3} 0.452109 0.234900 0.000521 1.432846 0.288085 1047.58 1137.31 1.000
pinvar{all} 0.993178 0.000068 0.977784 0.999999 0.995809 1100.47 1190.18 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0141/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 84
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 4 | CAG 0 0 0 0 0 0 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 2 2 2 2 2 2 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 0 0 0 0 0 0
GTC 4 4 4 4 4 4 | GCC 1 1 1 1 1 1 | GAC 2 2 2 2 2 2 | GGC 6 6 6 6 6 6
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 1 1 1 1 1 1 | GCG 1 1 1 1 1 1 | GAG 1 1 1 1 1 1 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907559_1_143_MLBR_RS00710
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
#2: NC_002677_1_NP_301234_1_106_ML0141
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
#3: NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
#4: NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
#5: NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
#6: NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 12
CTC 18 | CCC 6 | CAC 24 | CGC 6
CTA 0 | CCA 12 | Gln Q CAA 6 | CGA 0
CTG 6 | CCG 24 | CAG 0 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 12
ATC 6 | ACC 12 | AAC 12 | AGC 24
ATA 0 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 30 | ACG 6 | AAG 6 | AGG 12
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 0
GTC 24 | GCC 6 | GAC 12 | GGC 36
GTA 6 | GCA 0 | Glu E GAA 6 | GGA 6
GTG 6 | GCG 6 | GAG 6 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09524 C:0.29762 A:0.33333 G:0.27381
position 2: T:0.26190 C:0.23810 A:0.22619 G:0.27381
position 3: T:0.16667 C:0.44048 A:0.11905 G:0.27381
Average T:0.17460 C:0.32540 A:0.22619 G:0.27381
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -331.393717 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299924 1.300014
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907559_1_143_MLBR_RS00710: 0.000004, NC_002677_1_NP_301234_1_106_ML0141: 0.000004, NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955: 0.000004, NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030: 0.000004, NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735: 0.000004, NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29992
omega (dN/dS) = 1.30001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 202.4 49.6 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -331.393716 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907559_1_143_MLBR_RS00710: 0.000004, NC_002677_1_NP_301234_1_106_ML0141: 0.000004, NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955: 0.000004, NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030: 0.000004, NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735: 0.000004, NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 205.0 47.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -331.393713 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 7.718099
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907559_1_143_MLBR_RS00710: 0.000004, NC_002677_1_NP_301234_1_106_ML0141: 0.000004, NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955: 0.000004, NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030: 0.000004, NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735: 0.000004, NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 7.71810
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
7..2 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
7..3 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
7..4 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
7..5 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
7..6 0.000 205.0 47.0 7.7181 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907559_1_143_MLBR_RS00710)
Pr(w>1) post mean +- SE for w
1 M 1.000** 7.718
2 R 1.000** 7.718
3 L 1.000** 7.718
4 K 1.000** 7.718
5 V 1.000** 7.718
6 I 1.000** 7.718
7 D 1.000** 7.718
8 S 1.000** 7.718
9 P 1.000** 7.718
10 A 1.000** 7.718
11 S 1.000** 7.718
12 T 1.000** 7.718
13 R 1.000** 7.718
14 T 1.000** 7.718
15 N 1.000** 7.718
16 R 1.000** 7.718
17 I 1.000** 7.718
18 V 1.000** 7.718
19 L 1.000** 7.718
20 Q 1.000** 7.718
21 E 1.000** 7.718
22 H 1.000** 7.718
23 L 1.000** 7.718
24 H 1.000** 7.718
25 L 1.000** 7.718
26 S 1.000** 7.718
27 V 1.000** 7.718
28 G 1.000** 7.718
29 N 1.000** 7.718
30 R 1.000** 7.718
31 G 1.000** 7.718
32 G 1.000** 7.718
33 T 1.000** 7.718
34 G 1.000** 7.718
35 M 1.000** 7.718
36 R 1.000** 7.718
37 G 1.000** 7.718
38 G 1.000** 7.718
39 Y 1.000** 7.718
40 S 1.000** 7.718
41 L 1.000** 7.718
42 F 1.000** 7.718
43 N 1.000** 7.718
44 V 1.000** 7.718
45 P 1.000** 7.718
46 V 1.000** 7.718
47 D 1.000** 7.718
48 P 1.000** 7.718
49 Y 1.000** 7.718
50 M 1.000** 7.718
51 K 1.000** 7.718
52 M 1.000** 7.718
53 I 1.000** 7.718
54 H 1.000** 7.718
55 T 1.000** 7.718
56 P 1.000** 7.718
57 R 1.000** 7.718
58 H 1.000** 7.718
59 V 1.000** 7.718
60 P 1.000** 7.718
61 E 1.000** 7.718
62 A 1.000** 7.718
63 P 1.000** 7.718
64 R 1.000** 7.718
65 P 1.000** 7.718
66 T 1.000** 7.718
67 S 1.000** 7.718
68 H 1.000** 7.718
69 G 1.000** 7.718
70 T 1.000** 7.718
71 S 1.000** 7.718
72 R 1.000** 7.718
73 G 1.000** 7.718
74 F 1.000** 7.718
75 V 1.000** 7.718
76 Y 1.000** 7.718
77 T 1.000** 7.718
78 P 1.000** 7.718
79 M 1.000** 7.718
80 D 1.000** 7.718
81 R 1.000** 7.718
82 S 1.000** 7.718
83 A 1.000** 7.718
84 S 1.000** 7.718
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907559_1_143_MLBR_RS00710)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -331.393721 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.232989 0.967703
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907559_1_143_MLBR_RS00710: 0.000004, NC_002677_1_NP_301234_1_106_ML0141: 0.000004, NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955: 0.000004, NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030: 0.000004, NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735: 0.000004, NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.23299 q = 0.96770
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00030 0.00273 0.01157 0.03400 0.08034 0.16417 0.30215 0.51325 0.81563
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
7..2 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
7..3 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
7..4 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
7..5 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
7..6 0.000 205.0 47.0 0.1924 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -331.393715 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.608890 0.005000 2.426393 2.816061
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907559_1_143_MLBR_RS00710: 0.000004, NC_002677_1_NP_301234_1_106_ML0141: 0.000004, NZ_LVXE01000056_1_WP_010907559_1_2218_A3216_RS11955: 0.000004, NZ_LYPH01000036_1_WP_010907559_1_1467_A8144_RS07030: 0.000004, NZ_CP029543_1_WP_010907559_1_141_DIJ64_RS00735: 0.000004, NZ_AP014567_1_WP_010907559_1_146_JK2ML_RS00760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.60889 p = 0.00500 q = 2.42639
(p1 = 0.39111) w = 2.81606
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06089 0.06089 0.06089 0.06089 0.06089 0.06089 0.06089 0.06089 0.06089 0.06089 0.39111
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.81606
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
7..2 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
7..3 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
7..4 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
7..5 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
7..6 0.000 205.0 47.0 1.1014 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907559_1_143_MLBR_RS00710)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907559_1_143_MLBR_RS00710)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -331.393716 Model 2: PositiveSelection -331.393713 Model 0: one-ratio -331.393717 Model 7: beta -331.393721 Model 8: beta&w>1 -331.393715 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 5.999999984851456E-6 Model 8 vs 7 1.200000008338975E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
