--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:11:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0180/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.10 -413.45
2 -410.14 -413.29
--------------------------------------
TOTAL -410.12 -413.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895095 0.087463 0.360635 1.490384 0.859947 1375.29 1438.15 1.001
r(A<->C){all} 0.167801 0.018845 0.000010 0.445026 0.130678 291.27 333.54 1.000
r(A<->G){all} 0.166805 0.019338 0.000070 0.452556 0.133687 230.09 260.94 1.001
r(A<->T){all} 0.171284 0.021589 0.000070 0.472499 0.128397 133.16 137.17 1.000
r(C<->G){all} 0.165871 0.021245 0.000036 0.462425 0.125937 145.69 162.21 1.000
r(C<->T){all} 0.165051 0.020054 0.000082 0.456405 0.126017 190.78 254.57 1.000
r(G<->T){all} 0.163187 0.019363 0.000078 0.450036 0.123479 165.88 237.57 1.006
pi(A){all} 0.226618 0.000576 0.178309 0.272107 0.226200 1123.62 1141.95 1.000
pi(C){all} 0.292659 0.000671 0.244063 0.343803 0.292714 1205.53 1326.85 1.000
pi(G){all} 0.278895 0.000680 0.228969 0.329645 0.278459 890.04 1111.67 1.000
pi(T){all} 0.201827 0.000530 0.160026 0.249475 0.201105 1338.95 1400.50 1.000
alpha{1,2} 0.432105 0.260077 0.000235 1.445716 0.249996 1142.28 1210.46 1.001
alpha{3} 0.454820 0.249189 0.000125 1.433755 0.296488 922.57 1146.22 1.000
pinvar{all} 0.994500 0.000044 0.981778 0.999998 0.996637 1218.57 1298.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -388.954848
Model 2: PositiveSelection -388.954848
Model 0: one-ratio -388.954854
Model 7: beta -388.954849
Model 8: beta&w>1 -388.954848
Model 0 vs 1 1.1999999969702912E-5
Model 2 vs 1 0.0
Model 8 vs 7 1.9999999949504854E-6
>C1
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C2
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C3
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C4
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C5
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C6
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=99
C1 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C2 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C3 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C4 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C5 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C6 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
**************************************************
C1 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C2 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C3 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C4 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C5 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C6 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
*************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 99 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 99 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2970]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2970]--->[2970]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.453 Mb, Max= 30.623 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C2 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C3 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C4 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C5 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
C6 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
**************************************************
C1 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C2 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C3 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C4 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C5 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
C6 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
*************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
C2 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
C3 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
C4 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
C5 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
C6 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
**************************************************
C1 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
C2 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
C3 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
C4 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
C5 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
C6 TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
**************************************************
C1 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
C2 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
C3 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
C4 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
C5 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
C6 GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
**************************************************
C1 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
C2 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
C3 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
C4 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
C5 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
C6 GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
**************************************************
C1 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
C2 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
C3 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
C4 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
C5 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
C6 AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
**************************************************
C1 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
C2 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
C3 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
C4 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
C5 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
C6 ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
***********************************************
>C1
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C2
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C3
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C4
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C5
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C6
GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT
TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG
GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT
GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC
AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG
ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>C1
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C2
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C3
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C4
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C5
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
>C6
VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 297 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579795806
Setting output file names to "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 258459758
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0098223599
Seed = 1321308556
Swapseed = 1579795806
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -664.700201 -- -24.965149
Chain 2 -- -664.700239 -- -24.965149
Chain 3 -- -664.700138 -- -24.965149
Chain 4 -- -664.700138 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -664.700201 -- -24.965149
Chain 2 -- -664.700201 -- -24.965149
Chain 3 -- -664.700239 -- -24.965149
Chain 4 -- -664.700239 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-664.700] (-664.700) (-664.700) (-664.700) * [-664.700] (-664.700) (-664.700) (-664.700)
500 -- (-421.231) (-422.577) (-416.484) [-419.039] * (-421.150) (-420.444) (-414.186) [-417.622] -- 0:00:00
1000 -- (-423.325) (-420.184) [-420.689] (-419.708) * [-414.064] (-417.636) (-418.745) (-418.166) -- 0:00:00
1500 -- (-417.550) (-422.562) (-425.253) [-416.603] * [-418.689] (-421.250) (-422.599) (-421.103) -- 0:00:00
2000 -- (-416.947) (-420.884) (-418.907) [-420.979] * (-420.013) [-416.737] (-429.524) (-420.537) -- 0:00:00
2500 -- [-416.680] (-430.611) (-420.984) (-420.477) * (-413.873) (-416.805) [-420.952] (-421.155) -- 0:00:00
3000 -- [-418.556] (-418.245) (-417.949) (-424.742) * [-415.959] (-420.769) (-418.538) (-416.664) -- 0:00:00
3500 -- (-422.898) (-426.588) (-422.178) [-419.644] * (-418.443) [-420.755] (-420.020) (-418.994) -- 0:00:00
4000 -- (-426.670) (-419.306) [-415.674] (-423.346) * [-418.187] (-423.167) (-416.083) (-422.254) -- 0:00:00
4500 -- (-423.268) [-419.176] (-426.053) (-422.880) * (-418.314) [-421.153] (-415.214) (-418.380) -- 0:00:00
5000 -- (-419.625) (-428.898) [-426.217] (-421.721) * (-424.387) (-425.860) (-423.188) [-415.025] -- 0:00:00
Average standard deviation of split frequencies: 0.102138
5500 -- (-418.472) (-416.727) [-418.953] (-422.494) * (-416.835) (-425.461) [-416.450] (-417.366) -- 0:00:00
6000 -- (-424.454) (-426.259) [-421.887] (-418.771) * (-421.384) (-419.116) (-423.114) [-420.436] -- 0:02:45
6500 -- (-411.226) (-425.865) (-419.691) [-412.848] * [-416.186] (-427.672) (-425.513) (-418.348) -- 0:02:32
7000 -- (-415.877) (-421.154) (-415.049) [-418.892] * (-419.010) (-427.321) (-426.752) [-417.269] -- 0:02:21
7500 -- (-412.019) (-427.100) (-430.883) [-416.871] * [-415.457] (-443.604) (-426.831) (-427.188) -- 0:02:12
8000 -- [-410.972] (-412.815) (-424.398) (-424.583) * (-418.899) (-430.438) (-426.541) [-419.985] -- 0:02:04
8500 -- (-415.191) [-416.216] (-423.178) (-424.857) * [-416.697] (-412.397) (-421.803) (-418.771) -- 0:01:56
9000 -- (-412.499) (-427.012) (-423.636) [-422.011] * (-420.082) (-410.447) [-418.572] (-416.790) -- 0:01:50
9500 -- (-411.092) (-428.944) [-418.025] (-419.218) * [-414.591] (-408.645) (-420.245) (-430.415) -- 0:01:44
10000 -- (-411.054) (-417.284) (-420.867) [-414.396] * (-427.737) (-409.731) [-417.376] (-421.211) -- 0:01:39
Average standard deviation of split frequencies: 0.097227
10500 -- [-409.041] (-421.615) (-425.882) (-416.536) * (-420.160) (-412.096) [-425.153] (-417.848) -- 0:01:34
11000 -- (-412.428) (-418.888) (-424.630) [-414.962] * [-422.756] (-413.668) (-422.342) (-416.532) -- 0:01:29
11500 -- (-409.038) (-424.040) (-425.621) [-420.178] * (-422.898) (-409.602) [-416.722] (-422.242) -- 0:01:25
12000 -- (-409.592) (-422.240) (-421.903) [-421.252] * (-421.899) [-412.071] (-421.669) (-420.924) -- 0:01:22
12500 -- (-409.444) [-412.852] (-421.211) (-415.787) * [-420.971] (-410.474) (-418.449) (-419.217) -- 0:01:19
13000 -- (-409.831) (-418.457) (-427.989) [-420.266] * (-418.522) (-411.074) [-417.646] (-415.559) -- 0:01:15
13500 -- (-409.018) (-415.232) (-423.433) [-418.647] * (-421.893) [-411.089] (-421.752) (-424.438) -- 0:01:13
14000 -- (-414.039) (-418.777) [-415.460] (-417.806) * (-422.198) (-410.417) [-415.685] (-417.929) -- 0:01:10
14500 -- [-411.738] (-419.809) (-424.878) (-422.622) * (-424.279) (-413.497) [-418.003] (-423.744) -- 0:01:07
15000 -- [-410.922] (-420.662) (-424.366) (-420.326) * (-423.426) [-410.550] (-414.981) (-423.398) -- 0:01:05
Average standard deviation of split frequencies: 0.067110
15500 -- (-410.416) (-422.199) [-419.954] (-422.200) * [-416.334] (-410.571) (-415.708) (-419.436) -- 0:01:03
16000 -- (-410.556) (-416.094) [-418.608] (-438.368) * (-423.145) (-413.076) [-420.641] (-422.280) -- 0:01:01
16500 -- (-413.298) [-416.851] (-419.849) (-422.389) * (-424.685) (-410.571) [-412.144] (-416.834) -- 0:00:59
17000 -- (-411.718) [-422.206] (-423.285) (-427.604) * (-425.550) (-410.970) (-420.064) [-420.123] -- 0:00:57
17500 -- (-409.613) [-422.909] (-414.284) (-436.443) * (-417.779) (-409.928) (-416.852) [-413.553] -- 0:00:56
18000 -- (-410.932) (-423.302) [-423.721] (-425.103) * (-421.094) (-410.065) [-413.439] (-420.334) -- 0:00:54
18500 -- [-409.717] (-416.145) (-431.665) (-417.028) * (-420.120) (-410.938) [-418.820] (-416.807) -- 0:00:53
19000 -- (-411.126) [-425.259] (-438.585) (-411.829) * [-422.352] (-409.118) (-421.362) (-419.874) -- 0:00:51
19500 -- (-412.526) [-417.996] (-429.093) (-411.257) * (-426.311) (-409.937) (-415.999) [-417.687] -- 0:00:50
20000 -- (-411.486) (-420.111) (-421.061) [-408.903] * (-417.242) (-409.352) [-421.612] (-416.539) -- 0:00:49
Average standard deviation of split frequencies: 0.050182
20500 -- (-410.267) (-422.642) (-415.899) [-409.395] * [-418.283] (-410.033) (-420.406) (-425.870) -- 0:00:47
21000 -- [-411.535] (-415.619) (-422.776) (-409.401) * (-417.716) [-410.269] (-423.089) (-416.701) -- 0:00:46
21500 -- (-410.427) (-421.636) [-416.669] (-410.728) * (-420.226) (-411.612) (-420.887) [-417.967] -- 0:00:45
22000 -- [-410.701] (-415.600) (-414.003) (-411.904) * (-428.457) (-408.830) [-414.729] (-417.230) -- 0:00:44
22500 -- [-409.954] (-414.545) (-425.237) (-408.805) * (-428.571) [-409.720] (-428.801) (-426.363) -- 0:00:43
23000 -- [-410.275] (-429.177) (-420.296) (-409.902) * (-433.409) [-409.049] (-417.991) (-426.573) -- 0:01:24
23500 -- (-410.652) (-446.243) [-419.135] (-409.016) * (-421.516) (-409.799) [-415.635] (-409.750) -- 0:01:23
24000 -- (-418.940) (-438.467) (-418.568) [-412.901] * (-415.669) (-410.002) [-421.108] (-409.449) -- 0:01:21
24500 -- (-414.959) (-429.269) [-420.252] (-410.753) * (-410.634) (-409.896) [-418.789] (-410.896) -- 0:01:19
25000 -- (-408.992) (-411.812) (-426.958) [-410.519] * (-417.178) (-410.514) [-423.319] (-415.642) -- 0:01:18
Average standard deviation of split frequencies: 0.040383
25500 -- (-409.453) [-413.406] (-415.803) (-412.449) * (-413.238) (-410.387) (-422.156) [-409.932] -- 0:01:16
26000 -- (-411.431) (-412.086) (-419.330) [-411.238] * (-409.732) [-411.732] (-424.662) (-409.493) -- 0:01:14
26500 -- [-411.867] (-414.873) (-419.932) (-409.846) * [-411.349] (-410.339) (-418.298) (-408.907) -- 0:01:13
27000 -- [-410.900] (-409.782) (-421.768) (-412.079) * (-411.430) (-409.969) [-415.876] (-409.196) -- 0:01:12
27500 -- (-412.170) [-410.418] (-437.106) (-411.966) * (-409.742) (-410.872) [-416.532] (-410.360) -- 0:01:10
28000 -- (-410.548) [-410.862] (-427.375) (-409.937) * (-409.342) [-411.563] (-426.001) (-409.157) -- 0:01:09
28500 -- (-413.079) (-408.600) [-413.089] (-410.377) * (-412.366) (-411.362) (-421.910) [-410.129] -- 0:01:08
29000 -- (-416.182) (-411.257) (-412.835) [-412.003] * (-410.228) (-413.989) [-420.312] (-411.302) -- 0:01:06
29500 -- (-411.612) (-408.618) (-413.341) [-410.809] * (-412.012) (-414.806) (-418.134) [-410.080] -- 0:01:05
30000 -- (-411.183) (-411.672) (-418.136) [-409.965] * (-414.850) (-414.103) (-424.268) [-415.061] -- 0:01:04
Average standard deviation of split frequencies: 0.036893
30500 -- (-408.787) [-413.599] (-413.261) (-408.891) * (-410.963) (-412.501) (-417.146) [-411.164] -- 0:01:03
31000 -- (-411.113) (-413.369) (-411.007) [-413.945] * [-410.128] (-412.679) (-421.975) (-409.319) -- 0:01:02
31500 -- (-411.278) [-409.188] (-411.362) (-409.100) * (-411.292) [-409.345] (-416.755) (-409.146) -- 0:01:01
32000 -- (-410.476) (-411.346) [-410.392] (-411.934) * (-410.548) [-409.996] (-428.510) (-414.906) -- 0:01:00
32500 -- (-413.336) (-410.064) [-411.294] (-410.874) * (-413.775) (-412.718) (-426.264) [-411.788] -- 0:00:59
33000 -- [-412.960] (-411.405) (-413.396) (-411.476) * [-409.609] (-408.861) (-426.078) (-409.475) -- 0:00:58
33500 -- (-414.352) [-412.917] (-409.596) (-411.404) * (-410.378) [-409.368] (-429.205) (-409.867) -- 0:00:57
34000 -- (-413.820) [-412.291] (-410.112) (-411.779) * (-413.739) (-410.692) [-421.162] (-414.379) -- 0:00:56
34500 -- (-411.879) (-418.008) [-412.606] (-409.011) * (-414.886) [-412.747] (-422.688) (-411.305) -- 0:00:55
35000 -- (-409.608) [-409.098] (-411.543) (-411.294) * [-413.225] (-411.460) (-422.077) (-411.295) -- 0:00:55
Average standard deviation of split frequencies: 0.030324
35500 -- (-412.013) (-409.368) [-411.165] (-409.499) * (-410.639) [-410.246] (-418.159) (-410.487) -- 0:00:54
36000 -- (-415.419) [-409.130] (-409.374) (-410.434) * (-408.892) (-408.710) [-418.702] (-415.339) -- 0:00:53
36500 -- (-413.557) (-408.863) (-413.018) [-409.875] * (-410.063) [-408.936] (-420.166) (-410.789) -- 0:00:52
37000 -- (-412.006) [-411.702] (-411.055) (-411.785) * (-412.681) (-409.886) [-420.188] (-411.906) -- 0:00:52
37500 -- (-410.654) [-414.079] (-410.826) (-409.694) * (-411.690) (-410.261) [-418.869] (-410.870) -- 0:00:51
38000 -- (-409.586) [-412.784] (-409.435) (-412.986) * (-413.513) [-411.476] (-420.827) (-410.278) -- 0:00:50
38500 -- (-410.290) (-414.581) [-409.762] (-410.722) * (-408.894) (-410.261) [-422.647] (-409.910) -- 0:00:49
39000 -- (-410.490) (-414.499) (-409.583) [-409.791] * (-413.604) (-409.932) [-426.168] (-411.144) -- 0:00:49
39500 -- [-415.402] (-414.950) (-410.809) (-413.252) * (-413.047) (-412.721) [-420.063] (-411.010) -- 0:00:48
40000 -- (-411.507) (-410.464) (-415.600) [-412.958] * (-411.339) [-416.289] (-434.921) (-409.252) -- 0:00:48
Average standard deviation of split frequencies: 0.024923
40500 -- (-409.801) [-412.114] (-417.438) (-413.602) * (-413.598) [-417.824] (-432.505) (-409.730) -- 0:01:11
41000 -- (-409.766) (-410.907) (-417.585) [-409.625] * [-409.069] (-414.366) (-418.267) (-410.463) -- 0:01:10
41500 -- (-410.707) (-408.821) [-410.074] (-411.014) * (-410.250) (-412.563) (-411.329) [-410.162] -- 0:01:09
42000 -- (-411.764) [-410.626] (-410.652) (-412.362) * (-411.487) (-419.449) (-413.691) [-409.966] -- 0:01:08
42500 -- (-411.956) [-413.220] (-410.832) (-409.119) * (-409.078) (-412.713) (-409.929) [-411.978] -- 0:01:07
43000 -- (-412.278) [-412.886] (-410.093) (-412.140) * (-411.200) [-418.749] (-409.094) (-414.499) -- 0:01:06
43500 -- (-418.823) (-410.846) (-409.699) [-410.791] * (-412.638) (-413.202) [-409.344] (-416.699) -- 0:01:05
44000 -- (-416.464) [-411.538] (-411.918) (-409.561) * (-410.611) [-409.748] (-410.687) (-412.444) -- 0:01:05
44500 -- (-409.964) (-411.378) (-410.865) [-410.494] * (-411.789) [-410.097] (-413.519) (-410.877) -- 0:01:04
45000 -- (-410.370) [-409.915] (-410.595) (-411.063) * (-410.611) (-409.833) [-409.832] (-410.809) -- 0:01:03
Average standard deviation of split frequencies: 0.029605
45500 -- [-411.597] (-410.758) (-413.917) (-413.380) * (-411.134) (-410.659) [-413.875] (-412.428) -- 0:01:02
46000 -- [-409.870] (-409.235) (-410.560) (-411.645) * [-410.482] (-412.826) (-415.506) (-414.506) -- 0:01:02
46500 -- (-409.753) [-410.244] (-413.331) (-410.080) * (-409.127) [-411.110] (-409.171) (-410.174) -- 0:01:01
47000 -- (-411.233) [-411.033] (-410.079) (-410.296) * (-411.060) [-410.912] (-409.620) (-412.332) -- 0:01:00
47500 -- (-413.235) [-410.563] (-409.613) (-408.736) * [-413.263] (-412.920) (-408.825) (-411.527) -- 0:01:00
48000 -- (-410.539) [-409.951] (-411.472) (-410.983) * (-409.850) (-411.606) [-410.122] (-409.683) -- 0:00:59
48500 -- (-412.022) (-414.681) [-409.579] (-412.580) * (-410.977) [-412.567] (-410.058) (-414.192) -- 0:00:58
49000 -- (-410.665) (-412.782) [-411.170] (-409.980) * (-417.015) (-410.578) [-409.716] (-412.386) -- 0:00:58
49500 -- (-412.855) [-412.616] (-412.247) (-409.156) * (-409.709) (-412.406) [-409.755] (-412.422) -- 0:00:57
50000 -- (-411.983) (-412.909) (-410.177) [-411.456] * [-410.591] (-410.422) (-409.231) (-411.193) -- 0:00:57
Average standard deviation of split frequencies: 0.025586
50500 -- (-409.919) (-409.901) [-414.983] (-410.556) * (-410.235) (-410.264) (-409.846) [-411.921] -- 0:00:56
51000 -- (-409.628) [-410.784] (-414.069) (-413.535) * [-410.422] (-411.375) (-410.166) (-410.151) -- 0:00:55
51500 -- [-409.440] (-411.755) (-409.646) (-410.567) * [-410.907] (-412.317) (-412.244) (-412.720) -- 0:00:55
52000 -- [-408.617] (-412.127) (-412.380) (-409.143) * (-409.183) (-410.554) (-411.902) [-411.162] -- 0:00:54
52500 -- [-409.043] (-412.227) (-415.329) (-409.507) * [-410.813] (-411.697) (-411.266) (-411.490) -- 0:00:54
53000 -- (-412.601) [-411.570] (-408.743) (-412.371) * (-410.430) (-412.972) [-410.905] (-410.877) -- 0:00:53
53500 -- (-410.179) (-410.898) [-408.607] (-409.130) * (-411.456) (-412.935) [-418.803] (-411.065) -- 0:00:53
54000 -- (-413.946) (-410.570) [-409.417] (-410.956) * (-414.782) (-410.676) (-419.522) [-415.162] -- 0:00:52
54500 -- [-409.434] (-408.890) (-411.532) (-413.655) * (-414.539) [-411.048] (-412.016) (-411.092) -- 0:00:52
55000 -- (-414.281) (-409.979) [-412.312] (-410.228) * (-410.694) [-411.031] (-410.443) (-411.231) -- 0:00:51
Average standard deviation of split frequencies: 0.024853
55500 -- [-411.687] (-410.086) (-412.112) (-409.862) * (-410.078) (-413.641) [-410.664] (-414.306) -- 0:00:51
56000 -- [-410.709] (-409.722) (-411.629) (-410.884) * (-412.356) (-415.795) [-410.583] (-411.392) -- 0:00:50
56500 -- [-409.134] (-408.912) (-417.247) (-411.695) * (-409.710) (-410.834) [-412.756] (-411.632) -- 0:00:50
57000 -- [-410.163] (-410.488) (-410.697) (-411.439) * [-410.176] (-414.244) (-409.713) (-409.895) -- 0:00:49
57500 -- (-409.179) [-417.428] (-409.337) (-412.546) * (-410.590) (-412.725) (-410.573) [-411.263] -- 0:01:05
58000 -- [-408.835] (-410.021) (-410.777) (-411.459) * [-410.317] (-414.745) (-411.907) (-410.610) -- 0:01:04
58500 -- (-413.467) [-408.521] (-411.869) (-412.673) * (-412.570) (-410.262) (-409.742) [-408.801] -- 0:01:04
59000 -- (-409.014) (-410.138) [-409.768] (-415.655) * (-413.536) (-411.887) (-409.769) [-408.846] -- 0:01:03
59500 -- (-409.637) (-408.991) [-409.825] (-414.586) * [-410.383] (-409.980) (-410.696) (-411.369) -- 0:01:03
60000 -- (-418.234) [-409.027] (-411.728) (-410.947) * (-409.946) (-411.056) (-409.598) [-409.849] -- 0:01:02
Average standard deviation of split frequencies: 0.027401
60500 -- (-408.959) [-409.744] (-413.686) (-411.338) * (-411.807) (-411.607) (-409.731) [-410.365] -- 0:01:02
61000 -- (-410.176) [-409.713] (-409.811) (-410.603) * (-409.845) (-411.412) [-414.158] (-409.804) -- 0:01:01
61500 -- (-410.666) [-410.640] (-413.461) (-409.708) * (-409.122) (-410.343) [-408.822] (-409.406) -- 0:01:01
62000 -- (-414.339) (-410.772) (-409.853) [-412.238] * (-409.679) (-409.292) (-412.738) [-410.882] -- 0:01:00
62500 -- (-409.623) (-410.152) (-411.689) [-410.146] * (-408.918) (-410.970) (-412.970) [-410.803] -- 0:01:00
63000 -- (-411.290) [-411.631] (-411.515) (-413.799) * (-410.015) (-410.279) [-409.961] (-413.584) -- 0:00:59
63500 -- (-410.372) [-409.039] (-410.988) (-413.068) * (-412.140) [-410.179] (-412.515) (-415.312) -- 0:00:58
64000 -- (-411.880) [-409.181] (-412.616) (-412.551) * (-410.489) (-410.562) (-412.402) [-414.405] -- 0:00:58
64500 -- (-409.802) [-410.114] (-413.021) (-415.898) * (-413.754) (-415.629) [-410.730] (-409.474) -- 0:00:58
65000 -- (-412.445) (-410.870) [-409.984] (-411.151) * (-410.634) [-409.762] (-410.199) (-410.185) -- 0:00:57
Average standard deviation of split frequencies: 0.024284
65500 -- (-412.655) [-411.264] (-415.992) (-411.867) * (-409.156) (-410.027) [-410.925] (-409.563) -- 0:00:57
66000 -- [-411.437] (-408.934) (-415.864) (-409.726) * (-409.773) (-412.124) [-411.060] (-410.209) -- 0:00:56
66500 -- [-411.150] (-410.114) (-414.711) (-412.554) * (-411.931) (-412.058) (-411.072) [-410.384] -- 0:00:56
67000 -- [-410.120] (-411.352) (-414.295) (-410.313) * (-409.752) (-412.808) [-412.109] (-410.025) -- 0:00:55
67500 -- (-410.675) (-412.313) [-410.162] (-410.671) * [-409.788] (-411.775) (-411.020) (-412.944) -- 0:00:55
68000 -- (-411.857) (-410.804) (-410.678) [-411.574] * (-409.251) (-413.301) (-412.218) [-410.611] -- 0:00:54
68500 -- [-410.705] (-414.573) (-414.221) (-410.293) * (-408.868) (-412.643) [-412.619] (-415.202) -- 0:00:54
69000 -- (-412.324) (-416.587) [-409.238] (-412.311) * [-412.005] (-414.052) (-411.401) (-413.933) -- 0:00:53
69500 -- [-412.942] (-409.940) (-415.424) (-412.785) * (-410.857) (-411.087) (-409.279) [-410.953] -- 0:00:53
70000 -- [-410.518] (-410.409) (-411.088) (-408.948) * (-409.942) (-409.782) (-409.540) [-412.400] -- 0:00:53
Average standard deviation of split frequencies: 0.029141
70500 -- (-412.020) (-412.180) [-411.676] (-410.988) * (-414.182) [-410.085] (-409.436) (-410.350) -- 0:00:52
71000 -- [-416.206] (-412.426) (-410.654) (-409.577) * (-414.558) (-415.394) (-412.255) [-410.583] -- 0:00:52
71500 -- (-416.298) (-409.297) [-414.815] (-409.398) * (-412.217) (-410.424) (-412.589) [-411.906] -- 0:00:51
72000 -- (-416.185) [-409.266] (-411.408) (-409.941) * [-412.052] (-409.274) (-411.156) (-410.748) -- 0:00:51
72500 -- (-414.031) [-412.052] (-411.434) (-413.717) * (-411.351) (-409.672) [-412.256] (-409.932) -- 0:00:51
73000 -- (-409.511) [-411.721] (-410.307) (-411.600) * (-413.889) (-409.707) [-410.743] (-408.818) -- 0:00:50
73500 -- (-410.868) (-408.781) [-409.192] (-411.820) * (-413.063) [-411.094] (-411.782) (-410.177) -- 0:00:50
74000 -- (-408.533) [-408.808] (-411.830) (-410.498) * [-411.885] (-414.374) (-410.617) (-408.981) -- 0:01:02
74500 -- [-408.901] (-411.918) (-410.425) (-411.485) * (-408.705) [-411.334] (-409.625) (-411.469) -- 0:01:02
75000 -- (-413.350) (-411.293) [-410.714] (-410.165) * (-410.747) (-415.580) (-409.740) [-408.977] -- 0:01:01
Average standard deviation of split frequencies: 0.030238
75500 -- (-410.423) (-410.122) [-412.066] (-412.007) * (-409.136) [-408.937] (-412.359) (-411.046) -- 0:01:01
76000 -- (-408.846) (-411.174) (-409.973) [-411.584] * (-414.936) (-412.528) (-411.656) [-410.575] -- 0:01:00
76500 -- (-410.386) [-412.752] (-411.813) (-413.484) * [-413.716] (-412.159) (-408.751) (-411.501) -- 0:01:00
77000 -- (-410.449) (-412.557) (-410.355) [-410.642] * (-410.145) (-409.968) (-409.211) [-410.394] -- 0:00:59
77500 -- [-409.503] (-411.860) (-411.065) (-410.467) * (-413.945) [-411.034] (-410.202) (-409.010) -- 0:00:59
78000 -- (-410.666) [-411.148] (-412.626) (-409.653) * (-416.394) (-411.384) (-411.709) [-408.804] -- 0:00:59
78500 -- (-412.513) (-415.890) [-412.818] (-412.384) * (-414.392) (-411.625) [-411.541] (-409.100) -- 0:00:58
79000 -- [-409.799] (-410.686) (-414.354) (-417.980) * (-409.789) [-410.878] (-412.790) (-409.100) -- 0:00:58
79500 -- (-412.999) (-414.889) [-408.895] (-412.561) * [-411.841] (-410.906) (-412.447) (-414.439) -- 0:00:57
80000 -- (-411.360) (-412.274) (-418.041) [-409.630] * [-410.523] (-411.091) (-411.372) (-410.468) -- 0:00:57
Average standard deviation of split frequencies: 0.027844
80500 -- (-410.199) [-411.818] (-411.828) (-412.792) * (-412.964) [-409.010] (-409.775) (-410.347) -- 0:00:57
81000 -- (-411.830) (-416.523) [-412.196] (-414.221) * (-411.293) [-410.504] (-409.999) (-411.589) -- 0:00:56
81500 -- [-410.774] (-419.626) (-411.849) (-412.864) * (-413.608) (-410.156) (-412.402) [-410.886] -- 0:00:56
82000 -- (-418.227) (-414.674) (-413.672) [-410.371] * (-415.087) (-409.560) (-413.879) [-409.920] -- 0:00:55
82500 -- (-411.740) (-409.712) [-410.028] (-409.693) * (-410.725) (-413.970) (-409.482) [-411.300] -- 0:00:55
83000 -- (-411.224) (-409.216) [-408.563] (-409.701) * (-409.877) (-410.142) (-409.950) [-409.754] -- 0:00:55
83500 -- (-413.397) (-411.190) [-408.780] (-409.282) * [-409.563] (-412.593) (-411.699) (-409.607) -- 0:00:54
84000 -- (-410.427) (-411.413) (-413.378) [-410.359] * (-409.791) (-409.408) (-411.409) [-409.284] -- 0:00:54
84500 -- (-409.159) [-409.753] (-414.724) (-410.947) * (-412.292) (-416.673) [-409.182] (-411.886) -- 0:00:54
85000 -- (-409.845) [-409.280] (-412.224) (-410.423) * (-411.035) (-409.929) (-410.580) [-411.029] -- 0:00:53
Average standard deviation of split frequencies: 0.027103
85500 -- [-411.589] (-412.337) (-409.440) (-410.368) * [-415.549] (-411.113) (-412.459) (-411.878) -- 0:00:53
86000 -- (-411.076) (-411.590) [-411.295] (-416.023) * (-412.796) (-413.394) [-409.432] (-409.153) -- 0:00:53
86500 -- (-412.374) (-412.162) [-409.967] (-412.059) * (-409.653) [-411.620] (-408.924) (-411.284) -- 0:00:52
87000 -- (-411.897) [-413.281] (-410.525) (-415.411) * [-410.410] (-410.579) (-408.971) (-415.074) -- 0:00:52
87500 -- [-410.858] (-408.993) (-412.480) (-409.292) * [-408.804] (-416.210) (-409.000) (-413.312) -- 0:00:52
88000 -- (-409.327) (-409.064) [-414.496] (-415.178) * (-409.150) (-409.759) [-410.124] (-413.843) -- 0:00:51
88500 -- (-415.179) (-413.075) (-418.500) [-414.166] * (-410.735) (-412.464) (-413.126) [-413.085] -- 0:00:51
89000 -- [-412.550] (-414.458) (-410.883) (-412.702) * (-412.166) (-411.606) [-409.292] (-410.160) -- 0:00:51
89500 -- (-409.249) (-410.734) [-409.181] (-412.047) * (-409.542) (-409.415) (-409.804) [-409.147] -- 0:00:50
90000 -- (-409.144) (-412.099) [-410.112] (-411.031) * (-409.341) (-410.034) [-408.700] (-409.992) -- 0:00:50
Average standard deviation of split frequencies: 0.027730
90500 -- (-409.548) (-411.669) [-409.813] (-409.157) * (-411.405) [-410.589] (-412.667) (-414.420) -- 0:00:50
91000 -- (-408.869) (-411.402) [-408.854] (-414.445) * (-411.150) (-409.853) (-414.519) [-413.105] -- 0:00:59
91500 -- (-411.372) (-409.831) [-409.153] (-414.472) * (-408.653) [-409.203] (-411.038) (-411.808) -- 0:00:59
92000 -- (-412.319) (-410.476) (-410.238) [-409.948] * (-413.437) (-410.578) [-409.751] (-412.101) -- 0:00:59
92500 -- (-413.977) [-408.779] (-413.495) (-409.231) * (-413.045) (-411.467) (-413.294) [-410.002] -- 0:00:58
93000 -- [-412.118] (-410.853) (-412.776) (-409.142) * (-413.643) [-412.524] (-411.758) (-411.177) -- 0:00:58
93500 -- [-410.997] (-409.682) (-416.117) (-410.228) * (-413.908) [-411.014] (-411.470) (-409.838) -- 0:00:58
94000 -- (-412.691) [-410.187] (-412.203) (-409.841) * [-411.853] (-410.410) (-410.016) (-411.162) -- 0:00:57
94500 -- (-409.377) (-416.635) (-411.371) [-412.257] * (-410.636) (-411.248) [-408.945] (-412.722) -- 0:00:57
95000 -- [-417.514] (-409.543) (-411.220) (-410.835) * (-409.564) (-409.936) [-412.047] (-414.902) -- 0:00:57
Average standard deviation of split frequencies: 0.027008
95500 -- (-414.946) (-410.640) [-410.044] (-409.754) * (-411.154) (-409.516) (-409.967) [-411.578] -- 0:00:56
96000 -- (-419.328) (-413.914) [-409.899] (-410.753) * (-412.108) [-410.656] (-409.147) (-414.764) -- 0:00:56
96500 -- (-411.325) (-412.204) [-411.574] (-412.764) * (-409.770) (-410.384) (-410.061) [-411.805] -- 0:00:56
97000 -- (-415.013) [-414.005] (-414.756) (-411.617) * (-408.979) (-409.873) (-409.195) [-410.271] -- 0:00:55
97500 -- (-409.766) (-415.889) [-409.620] (-411.364) * [-409.993] (-412.110) (-410.748) (-410.968) -- 0:00:55
98000 -- (-408.949) [-413.815] (-413.850) (-413.401) * (-409.824) [-412.244] (-410.034) (-410.421) -- 0:00:55
98500 -- (-410.084) [-411.580] (-410.168) (-410.673) * [-410.948] (-410.373) (-409.899) (-413.589) -- 0:00:54
99000 -- (-409.963) (-409.848) [-410.857] (-409.730) * (-412.371) [-410.415] (-413.095) (-410.306) -- 0:00:54
99500 -- (-409.067) (-415.340) [-412.771] (-413.933) * [-409.329] (-409.868) (-408.576) (-409.054) -- 0:00:54
100000 -- (-410.936) (-413.041) [-409.100] (-411.035) * [-410.547] (-411.481) (-408.876) (-409.188) -- 0:00:54
Average standard deviation of split frequencies: 0.025067
100500 -- (-411.699) (-411.589) (-414.538) [-410.175] * (-410.600) (-413.807) [-409.230] (-409.618) -- 0:00:53
101000 -- (-411.687) (-410.441) [-411.005] (-411.429) * (-411.092) (-412.443) [-409.909] (-410.655) -- 0:00:53
101500 -- (-410.739) [-411.497] (-414.016) (-410.804) * (-411.573) (-417.170) (-414.421) [-412.783] -- 0:00:53
102000 -- (-410.814) [-409.803] (-411.228) (-409.437) * [-411.258] (-410.078) (-414.995) (-410.468) -- 0:00:52
102500 -- [-408.954] (-409.649) (-411.157) (-410.028) * (-414.625) [-411.201] (-410.043) (-411.823) -- 0:00:52
103000 -- [-410.148] (-411.832) (-413.825) (-413.519) * (-409.238) (-410.628) [-409.050] (-412.266) -- 0:00:52
103500 -- (-413.068) (-413.006) (-409.227) [-411.208] * [-411.663] (-408.990) (-415.728) (-410.565) -- 0:00:51
104000 -- (-413.328) (-410.479) (-410.662) [-409.547] * (-409.723) [-410.896] (-411.389) (-410.415) -- 0:00:51
104500 -- (-408.937) (-411.135) (-409.889) [-416.373] * (-410.203) (-409.795) (-414.481) [-409.476] -- 0:00:51
105000 -- (-408.706) (-411.135) (-411.681) [-413.425] * (-410.302) (-410.847) (-409.686) [-411.119] -- 0:00:51
Average standard deviation of split frequencies: 0.022470
105500 -- (-411.560) (-411.823) [-411.671] (-411.173) * (-411.872) (-412.005) [-411.587] (-408.631) -- 0:00:50
106000 -- (-410.934) (-412.727) [-410.566] (-410.679) * (-410.049) [-410.600] (-412.238) (-412.917) -- 0:00:50
106500 -- (-410.204) (-411.729) [-411.354] (-409.500) * (-409.708) (-413.751) [-409.776] (-411.146) -- 0:00:50
107000 -- (-410.518) (-413.940) [-411.443] (-411.556) * (-409.260) (-413.650) [-409.744] (-413.385) -- 0:00:50
107500 -- (-412.045) [-409.266] (-411.063) (-414.611) * (-410.816) (-421.373) (-413.078) [-409.464] -- 0:00:58
108000 -- (-410.162) (-411.576) (-409.706) [-413.012] * (-409.986) [-411.921] (-411.397) (-411.693) -- 0:00:57
108500 -- (-410.210) (-410.906) [-410.475] (-411.351) * (-412.711) (-411.937) [-411.684] (-409.388) -- 0:00:57
109000 -- [-412.079] (-412.286) (-409.883) (-413.145) * [-410.798] (-410.665) (-410.386) (-413.589) -- 0:00:57
109500 -- (-413.377) (-410.231) (-411.863) [-409.955] * (-411.860) (-410.462) (-409.486) [-412.389] -- 0:00:56
110000 -- (-410.470) (-412.953) [-408.971] (-409.531) * (-408.855) (-409.441) [-413.752] (-414.422) -- 0:00:56
Average standard deviation of split frequencies: 0.020626
110500 -- (-413.479) (-413.265) (-411.996) [-410.929] * (-409.558) (-409.741) [-410.984] (-408.984) -- 0:00:56
111000 -- [-409.664] (-412.187) (-413.798) (-410.026) * (-411.464) (-410.957) (-412.288) [-411.179] -- 0:00:56
111500 -- (-409.606) [-410.832] (-410.022) (-412.144) * (-413.691) [-412.850] (-410.274) (-411.425) -- 0:00:55
112000 -- [-414.646] (-411.333) (-410.345) (-415.075) * (-410.028) (-411.197) [-411.487] (-411.190) -- 0:00:55
112500 -- (-414.486) (-413.433) [-414.163] (-411.370) * (-411.271) (-409.503) [-410.476] (-409.423) -- 0:00:55
113000 -- (-412.523) (-412.556) [-412.334] (-409.426) * [-410.820] (-412.887) (-410.615) (-415.304) -- 0:00:54
113500 -- (-411.388) (-413.462) [-412.069] (-412.429) * [-411.280] (-409.148) (-409.351) (-411.222) -- 0:00:54
114000 -- (-412.338) [-411.723] (-410.086) (-410.752) * (-410.937) (-409.331) (-410.587) [-409.518] -- 0:00:54
114500 -- [-409.661] (-414.201) (-410.287) (-410.167) * (-413.971) (-415.453) [-409.511] (-410.698) -- 0:00:54
115000 -- (-410.885) [-409.361] (-411.903) (-412.562) * (-417.744) [-413.776] (-411.560) (-413.244) -- 0:00:53
Average standard deviation of split frequencies: 0.021816
115500 -- [-409.741] (-410.943) (-410.339) (-412.149) * (-409.356) (-412.008) (-410.632) [-409.645] -- 0:00:53
116000 -- [-409.627] (-409.723) (-410.275) (-411.167) * [-412.463] (-414.107) (-409.638) (-408.624) -- 0:00:53
116500 -- [-413.997] (-410.486) (-409.063) (-415.768) * (-413.043) (-410.250) (-411.593) [-410.420] -- 0:00:53
117000 -- (-409.534) (-412.879) (-409.194) [-410.648] * (-410.768) [-409.160] (-410.762) (-412.751) -- 0:00:52
117500 -- [-408.475] (-412.825) (-409.320) (-411.968) * (-410.225) [-411.122] (-414.818) (-410.612) -- 0:00:52
118000 -- (-409.256) (-412.429) (-411.778) [-409.954] * (-412.430) (-410.781) [-409.322] (-411.465) -- 0:00:52
118500 -- [-409.041] (-409.578) (-409.252) (-409.874) * (-409.204) (-410.397) (-410.011) [-409.920] -- 0:00:52
119000 -- (-409.273) (-411.289) [-410.202] (-411.389) * [-411.212] (-410.873) (-410.454) (-410.012) -- 0:00:51
119500 -- (-410.677) [-411.059] (-411.691) (-411.707) * (-414.778) (-411.689) [-411.741] (-410.828) -- 0:00:51
120000 -- (-410.122) (-410.555) (-414.059) [-408.863] * (-410.507) (-412.224) [-410.607] (-410.078) -- 0:00:51
Average standard deviation of split frequencies: 0.021053
120500 -- (-417.112) (-409.332) (-416.250) [-408.852] * (-417.234) (-410.514) (-410.569) [-412.216] -- 0:00:51
121000 -- (-411.672) (-410.687) (-410.062) [-409.458] * (-410.265) (-412.273) [-410.482] (-414.430) -- 0:00:50
121500 -- [-412.213] (-410.893) (-409.531) (-412.038) * [-409.480] (-409.233) (-410.534) (-410.951) -- 0:00:50
122000 -- (-409.020) (-409.120) [-409.717] (-411.009) * [-409.486] (-411.051) (-410.638) (-409.356) -- 0:00:50
122500 -- (-409.878) [-408.636] (-410.181) (-409.935) * (-412.182) [-410.250] (-417.156) (-410.702) -- 0:00:50
123000 -- (-410.727) [-413.676] (-411.135) (-409.776) * (-410.561) [-411.957] (-415.900) (-413.282) -- 0:00:49
123500 -- (-410.763) (-410.414) (-413.491) [-412.288] * [-409.632] (-414.225) (-411.847) (-410.926) -- 0:00:49
124000 -- [-409.977] (-410.649) (-413.182) (-410.718) * [-409.845] (-412.189) (-410.031) (-415.154) -- 0:00:56
124500 -- [-409.536] (-412.434) (-412.354) (-412.304) * (-410.048) (-411.435) (-409.031) [-410.117] -- 0:00:56
125000 -- [-409.755] (-411.986) (-412.140) (-410.618) * (-410.889) (-408.823) [-408.930] (-410.930) -- 0:00:56
Average standard deviation of split frequencies: 0.020016
125500 -- [-409.816] (-412.022) (-411.670) (-409.985) * (-410.240) (-409.554) [-409.465] (-410.343) -- 0:00:55
126000 -- (-415.424) (-410.155) (-413.574) [-409.159] * [-410.389] (-414.696) (-410.679) (-410.352) -- 0:00:55
126500 -- (-411.145) (-409.788) (-409.219) [-411.779] * (-410.109) (-415.080) [-409.129] (-411.036) -- 0:00:55
127000 -- (-409.939) [-411.410] (-411.331) (-411.993) * [-409.609] (-410.549) (-410.911) (-410.741) -- 0:00:54
127500 -- (-411.046) [-410.680] (-412.856) (-410.196) * (-410.988) (-411.953) (-410.381) [-412.305] -- 0:00:54
128000 -- (-413.151) (-410.175) [-412.523] (-410.824) * [-409.054] (-409.422) (-410.060) (-410.722) -- 0:00:54
128500 -- [-408.954] (-409.128) (-412.140) (-410.426) * (-413.368) (-410.466) [-408.988] (-409.488) -- 0:00:54
129000 -- (-409.857) (-409.558) (-410.607) [-409.310] * (-411.717) (-409.407) [-409.237] (-413.225) -- 0:00:54
129500 -- (-408.888) (-410.474) [-411.546] (-414.142) * (-411.374) (-408.725) [-409.840] (-411.344) -- 0:00:53
130000 -- (-411.770) (-409.659) [-409.630] (-411.264) * [-412.286] (-409.498) (-411.514) (-409.048) -- 0:00:53
Average standard deviation of split frequencies: 0.017237
130500 -- [-411.768] (-409.151) (-414.495) (-411.849) * (-409.559) (-411.143) (-410.620) [-418.233] -- 0:00:53
131000 -- (-409.186) [-408.897] (-411.845) (-410.630) * (-410.843) (-410.180) [-412.475] (-410.014) -- 0:00:53
131500 -- (-413.273) [-413.654] (-410.523) (-411.376) * (-416.415) (-410.129) [-409.013] (-414.759) -- 0:00:52
132000 -- (-414.058) (-409.823) [-412.584] (-410.227) * (-412.173) (-408.673) (-412.337) [-410.634] -- 0:00:52
132500 -- (-411.185) (-408.973) [-414.470] (-411.212) * (-416.830) (-409.189) [-410.634] (-409.112) -- 0:00:52
133000 -- (-411.040) (-408.849) (-409.731) [-408.782] * (-412.777) [-410.362] (-409.978) (-411.325) -- 0:00:52
133500 -- (-411.181) [-409.367] (-409.946) (-409.194) * (-411.378) (-412.019) [-409.434] (-414.243) -- 0:00:51
134000 -- (-410.495) [-409.773] (-409.394) (-412.692) * (-411.009) [-411.180] (-414.052) (-411.587) -- 0:00:51
134500 -- (-411.974) (-409.799) (-409.812) [-416.799] * (-414.121) (-413.600) (-415.473) [-411.357] -- 0:00:51
135000 -- (-412.058) [-411.353] (-410.241) (-412.778) * (-414.855) [-410.014] (-412.323) (-411.010) -- 0:00:51
Average standard deviation of split frequencies: 0.016601
135500 -- (-414.971) [-411.874] (-409.114) (-411.323) * [-412.783] (-412.247) (-413.753) (-412.443) -- 0:00:51
136000 -- (-420.046) (-409.911) (-414.235) [-409.020] * (-412.313) [-409.558] (-410.695) (-409.934) -- 0:00:50
136500 -- [-411.179] (-414.417) (-410.883) (-412.244) * (-411.587) (-413.734) (-408.829) [-411.550] -- 0:00:50
137000 -- (-414.949) (-411.416) (-414.209) [-410.100] * [-413.277] (-413.839) (-409.729) (-411.975) -- 0:00:50
137500 -- (-414.462) [-412.908] (-412.129) (-411.857) * [-409.793] (-414.192) (-411.849) (-414.825) -- 0:00:50
138000 -- (-409.836) (-411.908) [-411.226] (-410.215) * (-411.623) (-413.000) (-410.849) [-409.780] -- 0:00:49
138500 -- [-412.413] (-412.597) (-411.032) (-409.064) * (-411.117) (-410.600) (-409.771) [-411.008] -- 0:00:49
139000 -- (-410.451) [-408.979] (-409.683) (-409.456) * (-411.552) [-410.636] (-411.425) (-409.221) -- 0:00:49
139500 -- (-411.357) (-411.193) [-411.923] (-410.403) * (-410.773) [-410.540] (-411.004) (-409.048) -- 0:00:49
140000 -- [-410.466] (-411.460) (-413.824) (-409.556) * (-408.880) (-412.379) (-410.121) [-409.731] -- 0:00:49
Average standard deviation of split frequencies: 0.015080
140500 -- (-410.993) (-418.497) (-413.080) [-409.912] * [-412.051] (-410.365) (-412.722) (-412.596) -- 0:00:55
141000 -- (-410.594) (-411.892) (-410.369) [-412.893] * [-409.272] (-409.782) (-412.539) (-411.681) -- 0:00:54
141500 -- (-411.558) (-409.725) [-408.883] (-412.559) * (-411.360) (-411.408) [-411.249] (-409.096) -- 0:00:54
142000 -- [-410.636] (-414.067) (-410.323) (-413.877) * (-411.100) [-410.154] (-410.410) (-410.370) -- 0:00:54
142500 -- (-410.123) (-413.826) [-412.103] (-412.257) * [-411.667] (-409.583) (-410.406) (-413.517) -- 0:00:54
143000 -- [-409.016] (-411.355) (-411.752) (-410.050) * [-412.154] (-414.810) (-409.509) (-412.860) -- 0:00:53
143500 -- (-409.697) (-409.959) [-409.968] (-411.264) * (-411.596) (-412.987) [-409.897] (-410.910) -- 0:00:53
144000 -- (-409.262) (-410.295) (-410.030) [-412.349] * [-410.763] (-413.023) (-409.588) (-410.967) -- 0:00:53
144500 -- [-409.756] (-411.117) (-414.108) (-412.780) * (-411.533) (-412.116) (-411.718) [-408.947] -- 0:00:53
145000 -- (-410.645) [-409.327] (-412.915) (-410.448) * [-413.625] (-410.375) (-409.820) (-410.235) -- 0:00:53
Average standard deviation of split frequencies: 0.013991
145500 -- (-410.622) (-411.527) (-410.660) [-410.874] * (-410.544) (-410.628) (-412.257) [-411.697] -- 0:00:52
146000 -- [-409.979] (-410.939) (-410.341) (-410.077) * (-412.111) (-410.839) [-410.912] (-411.273) -- 0:00:52
146500 -- (-411.193) [-410.304] (-411.391) (-411.112) * (-409.997) (-414.396) [-410.465] (-412.286) -- 0:00:52
147000 -- (-410.608) (-413.024) [-416.223] (-411.916) * (-409.874) (-412.745) (-409.335) [-410.780] -- 0:00:52
147500 -- (-410.442) [-410.878] (-408.946) (-411.950) * (-409.262) (-410.724) (-417.203) [-410.231] -- 0:00:52
148000 -- [-408.851] (-410.379) (-411.623) (-409.036) * (-411.379) [-411.885] (-412.972) (-410.986) -- 0:00:51
148500 -- [-411.541] (-408.746) (-411.585) (-410.192) * (-414.524) (-412.751) (-410.898) [-410.001] -- 0:00:51
149000 -- (-409.276) (-412.488) (-412.895) [-410.355] * (-416.719) (-410.123) [-410.474] (-411.240) -- 0:00:51
149500 -- [-409.345] (-410.567) (-411.819) (-409.693) * (-412.334) [-410.954] (-413.590) (-409.578) -- 0:00:51
150000 -- (-413.508) (-413.251) [-411.700] (-411.553) * [-410.905] (-409.553) (-409.499) (-409.928) -- 0:00:51
Average standard deviation of split frequencies: 0.013503
150500 -- (-409.833) [-411.799] (-413.755) (-411.295) * [-412.398] (-408.942) (-408.929) (-417.786) -- 0:00:50
151000 -- (-408.892) (-412.764) [-411.744] (-411.479) * [-413.431] (-410.037) (-410.484) (-413.800) -- 0:00:50
151500 -- [-409.537] (-413.234) (-411.019) (-411.849) * (-413.474) (-410.364) (-411.400) [-409.698] -- 0:00:50
152000 -- [-410.246] (-409.571) (-409.593) (-411.832) * (-412.971) (-412.686) (-414.384) [-411.917] -- 0:00:50
152500 -- (-410.483) [-409.228] (-412.128) (-411.107) * (-408.893) (-410.308) [-409.609] (-410.785) -- 0:00:50
153000 -- (-411.798) (-410.107) (-412.872) [-410.016] * [-411.945] (-411.216) (-409.342) (-409.467) -- 0:00:49
153500 -- (-413.113) (-411.272) (-414.428) [-409.001] * (-414.978) [-410.422] (-410.021) (-411.807) -- 0:00:49
154000 -- (-410.541) (-412.188) (-410.001) [-410.722] * (-413.672) (-410.045) (-409.451) [-409.801] -- 0:00:49
154500 -- [-409.521] (-412.067) (-409.557) (-410.482) * (-409.068) [-409.709] (-410.203) (-412.181) -- 0:00:49
155000 -- (-410.111) (-410.886) (-413.601) [-409.821] * (-408.871) (-411.149) [-410.094] (-410.174) -- 0:00:49
Average standard deviation of split frequencies: 0.013678
155500 -- [-411.572] (-414.283) (-413.997) (-410.557) * (-409.818) [-408.746] (-410.445) (-410.243) -- 0:00:48
156000 -- (-409.813) (-411.110) [-409.255] (-413.349) * (-412.346) (-411.015) (-409.366) [-410.683] -- 0:00:48
156500 -- (-410.204) (-413.149) (-409.897) [-409.761] * (-417.588) [-411.216] (-410.987) (-409.097) -- 0:00:48
157000 -- (-410.403) (-408.582) (-414.166) [-408.796] * (-409.891) (-412.692) [-409.204] (-413.643) -- 0:00:53
157500 -- (-408.931) (-411.493) (-409.902) [-412.485] * (-410.700) (-416.807) (-410.740) [-411.784] -- 0:00:53
158000 -- [-410.473] (-414.063) (-410.076) (-411.486) * (-414.294) (-410.228) [-413.073] (-412.695) -- 0:00:53
158500 -- [-409.018] (-409.811) (-409.745) (-411.457) * (-411.368) [-410.251] (-411.656) (-411.561) -- 0:00:53
159000 -- (-409.074) [-411.047] (-409.904) (-412.807) * (-411.612) (-413.383) (-412.843) [-409.207] -- 0:00:52
159500 -- (-417.183) [-408.788] (-412.340) (-411.972) * [-410.924] (-411.474) (-413.333) (-410.169) -- 0:00:52
160000 -- (-409.908) (-412.448) (-411.252) [-410.598] * [-417.026] (-410.176) (-411.663) (-411.279) -- 0:00:52
Average standard deviation of split frequencies: 0.013589
160500 -- (-409.995) [-409.625] (-409.713) (-409.568) * (-410.885) [-410.983] (-412.845) (-409.141) -- 0:00:52
161000 -- (-409.239) (-412.413) [-411.437] (-411.621) * [-412.274] (-413.288) (-411.456) (-411.285) -- 0:00:52
161500 -- (-413.049) [-410.914] (-409.937) (-409.851) * [-409.029] (-412.043) (-410.944) (-408.967) -- 0:00:51
162000 -- (-411.898) (-409.509) (-410.257) [-409.486] * (-411.513) (-411.732) (-410.001) [-410.237] -- 0:00:51
162500 -- (-410.658) (-411.236) [-410.173] (-412.188) * (-411.380) [-410.691] (-409.488) (-410.042) -- 0:00:51
163000 -- (-409.739) [-409.132] (-409.251) (-409.962) * [-410.200] (-410.198) (-413.094) (-409.136) -- 0:00:51
163500 -- (-409.497) (-411.403) (-410.444) [-414.521] * (-415.359) (-411.408) [-409.217] (-411.884) -- 0:00:51
164000 -- (-410.712) (-409.833) [-410.715] (-413.867) * (-411.886) [-413.697] (-411.956) (-409.688) -- 0:00:50
164500 -- (-409.404) (-411.319) (-410.549) [-412.736] * (-409.140) (-414.195) [-411.665] (-411.511) -- 0:00:50
165000 -- (-408.728) [-413.542] (-411.941) (-413.542) * (-410.052) [-410.446] (-409.281) (-411.246) -- 0:00:50
Average standard deviation of split frequencies: 0.013003
165500 -- (-411.191) (-415.191) [-409.585] (-412.249) * (-411.463) (-412.394) [-410.364] (-410.670) -- 0:00:50
166000 -- (-409.293) (-409.904) (-408.843) [-409.457] * (-411.104) [-411.057] (-408.909) (-409.822) -- 0:00:50
166500 -- (-412.507) (-415.853) [-412.428] (-414.272) * (-411.143) (-414.828) (-409.385) [-410.635] -- 0:00:50
167000 -- (-411.175) (-412.856) [-412.670] (-416.825) * [-409.809] (-410.721) (-411.341) (-408.835) -- 0:00:49
167500 -- [-409.339] (-411.099) (-411.570) (-411.667) * [-409.714] (-411.066) (-412.788) (-413.366) -- 0:00:49
168000 -- (-409.374) (-411.665) [-411.022] (-410.849) * [-409.660] (-412.312) (-412.067) (-416.394) -- 0:00:49
168500 -- (-412.984) (-413.183) (-410.895) [-411.123] * (-408.734) [-409.943] (-409.981) (-411.986) -- 0:00:49
169000 -- (-414.253) (-409.313) [-408.583] (-410.997) * [-412.404] (-411.140) (-411.389) (-410.297) -- 0:00:49
169500 -- (-413.772) (-409.961) (-412.596) [-410.133] * (-410.395) (-412.475) (-413.382) [-410.260] -- 0:00:48
170000 -- (-413.445) (-409.244) (-414.221) [-411.007] * (-411.237) (-413.421) (-410.955) [-411.545] -- 0:00:48
Average standard deviation of split frequencies: 0.011509
170500 -- (-412.456) (-409.286) (-413.694) [-412.323] * (-410.695) [-409.614] (-412.191) (-410.864) -- 0:00:48
171000 -- (-412.184) [-411.016] (-411.545) (-410.362) * (-409.035) (-410.168) [-409.746] (-409.953) -- 0:00:48
171500 -- (-410.906) (-413.699) [-410.439] (-411.448) * (-410.572) (-411.364) [-408.809] (-409.691) -- 0:00:48
172000 -- [-410.845] (-409.682) (-419.643) (-410.991) * (-412.222) (-410.365) [-410.608] (-411.000) -- 0:00:48
172500 -- [-409.969] (-409.329) (-413.770) (-411.297) * (-411.433) (-411.087) [-408.974] (-410.636) -- 0:00:47
173000 -- (-411.693) (-418.608) [-410.855] (-412.666) * (-412.311) (-412.114) [-413.781] (-413.279) -- 0:00:47
173500 -- (-411.580) (-414.523) [-409.931] (-411.311) * (-410.495) (-410.822) (-411.447) [-410.548] -- 0:00:52
174000 -- [-409.147] (-412.902) (-409.663) (-409.998) * (-411.033) [-414.218] (-413.386) (-413.047) -- 0:00:52
174500 -- (-410.058) (-410.703) [-410.886] (-411.975) * (-411.405) [-412.970] (-410.542) (-415.446) -- 0:00:52
175000 -- (-410.353) (-412.088) (-410.662) [-411.655] * (-412.270) (-416.611) (-408.766) [-412.932] -- 0:00:51
Average standard deviation of split frequencies: 0.013235
175500 -- (-411.397) (-409.194) (-410.360) [-410.611] * (-410.642) (-409.319) (-409.976) [-411.555] -- 0:00:51
176000 -- (-410.113) [-410.509] (-410.655) (-414.710) * (-410.568) [-411.868] (-409.088) (-410.541) -- 0:00:51
176500 -- (-410.181) [-410.670] (-409.510) (-408.821) * [-411.232] (-412.418) (-413.783) (-412.315) -- 0:00:51
177000 -- [-413.004] (-410.409) (-409.710) (-413.665) * (-413.246) (-410.875) [-408.978] (-409.774) -- 0:00:51
177500 -- [-413.842] (-415.013) (-410.860) (-410.292) * (-415.584) (-411.366) (-410.254) [-410.506] -- 0:00:50
178000 -- (-411.255) (-412.863) [-414.467] (-411.418) * (-417.404) [-410.529] (-409.626) (-408.672) -- 0:00:50
178500 -- (-410.331) (-409.854) (-411.985) [-411.261] * (-413.759) (-408.754) [-410.925] (-411.106) -- 0:00:50
179000 -- [-410.920] (-408.699) (-412.240) (-410.266) * [-410.553] (-421.457) (-410.369) (-412.919) -- 0:00:50
179500 -- (-411.522) [-413.555] (-411.715) (-411.962) * [-412.974] (-423.558) (-412.150) (-410.636) -- 0:00:50
180000 -- (-416.879) [-414.852] (-410.000) (-415.500) * (-409.320) (-420.614) (-411.404) [-410.882] -- 0:00:50
Average standard deviation of split frequencies: 0.015502
180500 -- [-413.247] (-412.311) (-409.812) (-412.744) * (-410.104) (-410.269) (-412.846) [-409.805] -- 0:00:49
181000 -- (-413.866) [-411.662] (-409.822) (-410.138) * (-411.626) [-410.590] (-413.838) (-410.073) -- 0:00:49
181500 -- [-409.939] (-411.899) (-409.476) (-409.581) * (-411.892) (-412.487) [-410.360] (-410.175) -- 0:00:49
182000 -- [-410.009] (-411.998) (-408.685) (-409.276) * (-412.869) (-412.616) (-409.192) [-410.438] -- 0:00:49
182500 -- [-409.844] (-410.086) (-411.396) (-408.700) * (-411.348) [-415.214] (-409.732) (-411.171) -- 0:00:49
183000 -- (-411.629) [-411.639] (-409.822) (-410.060) * [-410.322] (-408.919) (-409.717) (-411.153) -- 0:00:49
183500 -- (-409.254) (-412.733) [-410.079] (-410.119) * (-415.076) [-410.371] (-412.844) (-409.876) -- 0:00:48
184000 -- (-409.523) (-413.092) (-410.304) [-409.970] * [-412.070] (-413.804) (-410.185) (-410.010) -- 0:00:48
184500 -- [-411.249] (-412.374) (-408.965) (-409.786) * (-415.411) (-413.604) [-410.081] (-411.705) -- 0:00:48
185000 -- (-411.569) (-408.981) [-410.607] (-413.626) * [-410.298] (-415.047) (-409.570) (-411.354) -- 0:00:48
Average standard deviation of split frequencies: 0.014925
185500 -- (-409.354) [-409.060] (-409.025) (-410.477) * (-409.859) [-410.009] (-409.003) (-410.868) -- 0:00:48
186000 -- [-409.447] (-408.990) (-410.575) (-412.508) * (-410.490) (-413.173) (-408.457) [-410.626] -- 0:00:48
186500 -- (-410.206) (-409.908) (-410.565) [-412.518] * [-412.438] (-408.986) (-410.617) (-414.272) -- 0:00:47
187000 -- [-409.786] (-410.694) (-410.203) (-413.344) * [-411.328] (-411.750) (-409.851) (-410.083) -- 0:00:47
187500 -- (-409.412) [-410.014] (-409.235) (-410.100) * [-410.454] (-411.884) (-411.399) (-411.970) -- 0:00:47
188000 -- [-409.422] (-409.944) (-408.732) (-413.171) * (-410.021) [-409.323] (-410.284) (-414.315) -- 0:00:47
188500 -- (-411.099) [-408.976] (-412.572) (-413.863) * (-411.716) (-412.322) [-410.414] (-409.777) -- 0:00:47
189000 -- (-412.210) (-410.350) (-409.552) [-409.397] * (-411.099) [-411.650] (-412.496) (-410.496) -- 0:00:47
189500 -- (-411.478) [-409.664] (-410.900) (-410.071) * (-409.450) (-412.881) [-410.479] (-410.365) -- 0:00:47
190000 -- (-412.206) (-410.399) [-408.940] (-411.765) * (-409.968) [-411.585] (-411.998) (-409.131) -- 0:00:51
Average standard deviation of split frequencies: 0.013049
190500 -- (-412.429) [-409.327] (-410.593) (-411.825) * (-411.871) (-409.550) [-409.551] (-411.804) -- 0:00:50
191000 -- [-412.959] (-409.747) (-413.893) (-411.466) * (-413.382) [-408.801] (-408.882) (-410.167) -- 0:00:50
191500 -- (-410.699) (-409.261) (-411.228) [-410.098] * (-410.806) (-410.051) (-408.837) [-410.030] -- 0:00:50
192000 -- [-409.145] (-409.936) (-410.286) (-410.148) * [-409.441] (-409.916) (-409.754) (-408.912) -- 0:00:50
192500 -- (-409.289) [-410.385] (-410.901) (-410.663) * (-411.950) [-410.080] (-409.099) (-411.238) -- 0:00:50
193000 -- [-409.738] (-414.936) (-408.543) (-410.546) * (-414.123) (-410.150) (-409.247) [-408.864] -- 0:00:50
193500 -- (-411.105) (-415.799) [-410.163] (-410.437) * (-408.977) (-411.038) (-409.359) [-410.220] -- 0:00:50
194000 -- (-409.776) (-411.452) [-411.374] (-408.997) * (-410.522) [-409.250] (-412.188) (-410.575) -- 0:00:49
194500 -- (-410.041) (-411.650) (-411.608) [-413.273] * [-409.242] (-410.127) (-409.384) (-411.087) -- 0:00:49
195000 -- (-412.342) [-409.903] (-412.602) (-412.273) * (-409.892) (-409.547) [-409.928] (-414.834) -- 0:00:49
Average standard deviation of split frequencies: 0.012627
195500 -- (-411.183) (-413.369) [-410.815] (-412.314) * [-409.448] (-409.496) (-415.688) (-410.288) -- 0:00:49
196000 -- (-410.716) (-415.159) (-412.453) [-411.002] * (-409.544) (-411.018) (-412.241) [-409.359] -- 0:00:49
196500 -- (-410.731) [-416.444] (-412.814) (-411.478) * [-410.640] (-411.303) (-414.140) (-410.694) -- 0:00:49
197000 -- (-411.995) (-413.991) (-414.271) [-409.131] * (-411.188) [-413.094] (-412.219) (-413.891) -- 0:00:48
197500 -- (-410.965) (-410.695) (-427.545) [-409.353] * (-413.909) (-410.889) (-417.268) [-415.248] -- 0:00:48
198000 -- (-409.383) (-411.069) (-412.714) [-409.488] * (-413.690) (-410.797) [-411.587] (-410.362) -- 0:00:48
198500 -- [-412.395] (-411.242) (-413.631) (-412.644) * (-412.374) (-409.804) [-411.450] (-412.558) -- 0:00:48
199000 -- (-409.565) (-411.327) [-409.343] (-409.750) * (-410.594) (-412.022) [-408.732] (-409.560) -- 0:00:48
199500 -- (-410.369) (-417.021) [-414.491] (-410.525) * (-409.585) (-411.015) (-413.011) [-410.918] -- 0:00:48
200000 -- (-411.205) [-413.681] (-410.668) (-416.064) * (-411.043) [-409.384] (-410.930) (-409.361) -- 0:00:48
Average standard deviation of split frequencies: 0.012627
200500 -- (-411.715) (-408.703) (-413.223) [-410.649] * [-410.021] (-412.665) (-409.462) (-410.606) -- 0:00:47
201000 -- (-411.863) [-409.863] (-413.607) (-408.728) * (-408.537) (-411.672) [-410.276] (-415.444) -- 0:00:47
201500 -- [-409.819] (-411.682) (-410.569) (-410.116) * (-413.174) (-410.871) [-410.656] (-412.004) -- 0:00:47
202000 -- (-410.403) (-410.345) [-409.581] (-410.134) * [-409.208] (-412.265) (-409.921) (-409.747) -- 0:00:47
202500 -- [-412.331] (-410.935) (-411.739) (-410.332) * (-412.209) (-409.015) [-411.255] (-408.964) -- 0:00:47
203000 -- (-413.319) (-410.508) [-412.687] (-409.519) * (-411.010) (-409.811) (-410.423) [-410.943] -- 0:00:47
203500 -- (-414.457) (-412.966) [-408.702] (-412.702) * (-409.737) (-411.059) [-411.826] (-409.380) -- 0:00:46
204000 -- (-418.445) [-410.800] (-409.712) (-409.649) * (-410.313) (-412.485) [-413.678] (-410.739) -- 0:00:46
204500 -- (-409.910) (-408.677) (-412.209) [-411.716] * [-409.795] (-413.242) (-414.104) (-414.288) -- 0:00:46
205000 -- (-410.240) (-410.688) (-410.966) [-409.486] * (-412.890) [-412.453] (-412.284) (-412.552) -- 0:00:46
Average standard deviation of split frequencies: 0.012332
205500 -- (-416.378) (-410.111) [-409.662] (-410.265) * (-413.251) (-410.347) [-414.286] (-412.594) -- 0:00:46
206000 -- (-416.369) [-411.990] (-411.200) (-410.903) * (-408.881) [-413.244] (-409.605) (-414.004) -- 0:00:46
206500 -- (-412.345) (-411.759) [-410.264] (-410.103) * [-413.448] (-415.926) (-410.866) (-410.342) -- 0:00:49
207000 -- [-413.967] (-411.291) (-409.474) (-410.546) * (-411.677) (-412.414) [-409.286] (-411.889) -- 0:00:49
207500 -- (-415.459) (-410.482) [-411.654] (-410.524) * (-409.533) [-408.479] (-409.254) (-409.876) -- 0:00:49
208000 -- [-410.090] (-410.171) (-409.947) (-413.477) * (-409.144) (-413.403) [-409.170] (-410.198) -- 0:00:49
208500 -- (-412.041) (-409.715) (-411.021) [-410.572] * (-410.584) (-411.932) [-409.240] (-409.330) -- 0:00:49
209000 -- [-410.305] (-410.256) (-408.776) (-411.456) * (-409.499) [-411.445] (-412.476) (-411.074) -- 0:00:49
209500 -- [-411.640] (-409.664) (-410.724) (-410.191) * (-412.903) (-414.445) [-411.023] (-410.191) -- 0:00:49
210000 -- (-410.210) (-410.214) [-408.711] (-410.301) * (-413.970) [-410.152] (-411.182) (-412.170) -- 0:00:48
Average standard deviation of split frequencies: 0.012110
210500 -- (-410.102) [-409.041] (-410.238) (-410.338) * (-415.823) (-412.679) [-408.842] (-413.488) -- 0:00:48
211000 -- (-409.865) [-410.182] (-410.029) (-413.037) * [-414.440] (-411.035) (-410.584) (-410.300) -- 0:00:48
211500 -- (-411.515) [-410.234] (-412.955) (-410.655) * (-411.518) (-410.859) [-410.861] (-419.512) -- 0:00:48
212000 -- (-410.239) (-413.177) (-414.767) [-410.937] * (-410.916) [-411.599] (-409.531) (-414.817) -- 0:00:48
212500 -- (-409.545) (-411.830) [-410.560] (-410.240) * (-418.365) (-413.850) (-410.133) [-409.278] -- 0:00:48
213000 -- (-411.865) (-410.570) (-412.233) [-413.257] * [-413.662] (-411.111) (-410.136) (-409.209) -- 0:00:48
213500 -- (-410.023) [-412.136] (-412.511) (-412.046) * (-410.554) (-411.136) (-409.427) [-408.622] -- 0:00:47
214000 -- (-409.950) [-412.745] (-410.027) (-419.331) * [-409.114] (-411.306) (-412.318) (-408.892) -- 0:00:47
214500 -- (-409.420) [-411.468] (-410.333) (-409.968) * (-411.769) [-412.329] (-409.998) (-411.149) -- 0:00:47
215000 -- [-410.231] (-411.313) (-408.716) (-411.773) * (-412.025) [-412.521] (-409.522) (-409.692) -- 0:00:47
Average standard deviation of split frequencies: 0.012549
215500 -- (-409.686) (-411.427) (-409.316) [-410.862] * (-409.444) (-411.091) (-408.748) [-409.804] -- 0:00:47
216000 -- (-412.452) (-412.961) (-410.364) [-410.585] * [-410.452] (-410.263) (-409.131) (-411.077) -- 0:00:47
216500 -- (-409.422) [-410.312] (-410.973) (-411.547) * (-411.167) (-410.798) (-410.078) [-411.657] -- 0:00:47
217000 -- (-410.653) [-408.938] (-410.702) (-410.740) * (-411.529) [-410.997] (-410.989) (-411.925) -- 0:00:46
217500 -- (-414.832) (-409.983) (-410.946) [-408.957] * (-411.537) [-408.821] (-411.502) (-409.994) -- 0:00:46
218000 -- (-410.056) (-409.939) (-421.159) [-409.095] * (-411.407) [-411.512] (-411.963) (-412.792) -- 0:00:46
218500 -- [-409.638] (-410.458) (-411.346) (-409.637) * [-411.672] (-411.307) (-409.713) (-412.270) -- 0:00:46
219000 -- (-412.918) [-412.676] (-410.083) (-412.403) * (-410.548) [-412.685] (-411.042) (-414.176) -- 0:00:46
219500 -- (-412.994) [-410.465] (-411.224) (-410.712) * (-410.781) (-409.649) [-409.036] (-414.439) -- 0:00:46
220000 -- (-416.060) [-411.418] (-410.302) (-412.826) * [-411.918] (-410.751) (-411.267) (-412.067) -- 0:00:46
Average standard deviation of split frequencies: 0.012818
220500 -- (-413.971) (-415.783) (-410.317) [-410.273] * (-410.541) (-410.559) (-410.405) [-408.486] -- 0:00:45
221000 -- (-410.983) (-413.760) [-411.192] (-412.339) * [-412.407] (-411.160) (-410.060) (-410.809) -- 0:00:45
221500 -- [-409.576] (-409.182) (-411.566) (-412.117) * (-411.106) [-409.487] (-410.461) (-411.349) -- 0:00:45
222000 -- (-412.279) [-411.731] (-411.462) (-412.657) * (-409.684) [-409.805] (-411.111) (-410.940) -- 0:00:45
222500 -- (-412.775) [-410.136] (-410.703) (-410.784) * (-413.001) (-411.356) (-412.286) [-409.243] -- 0:00:45
223000 -- [-412.046] (-410.901) (-410.551) (-409.026) * (-412.064) (-413.442) (-410.628) [-411.040] -- 0:00:45
223500 -- [-411.497] (-410.395) (-409.733) (-411.539) * (-413.167) [-409.269] (-408.492) (-410.040) -- 0:00:48
224000 -- [-410.827] (-409.111) (-414.246) (-410.097) * (-412.249) (-410.373) [-408.854] (-410.250) -- 0:00:48
224500 -- (-409.905) [-409.015] (-409.991) (-411.933) * (-409.641) (-409.208) [-410.885] (-412.450) -- 0:00:48
225000 -- [-411.715] (-410.163) (-410.698) (-412.788) * [-411.257] (-415.618) (-416.354) (-411.447) -- 0:00:48
Average standard deviation of split frequencies: 0.012515
225500 -- [-409.529] (-409.334) (-412.521) (-414.406) * (-410.808) (-410.363) (-416.564) [-409.689] -- 0:00:48
226000 -- [-412.976] (-411.067) (-414.331) (-411.873) * (-412.735) (-411.367) (-418.984) [-410.625] -- 0:00:47
226500 -- (-409.526) (-409.838) (-411.243) [-409.189] * (-412.122) (-412.215) (-414.202) [-409.417] -- 0:00:47
227000 -- (-413.511) (-412.839) [-410.163] (-409.891) * (-410.371) (-413.201) (-410.459) [-412.088] -- 0:00:47
227500 -- (-414.530) (-410.298) [-408.975] (-409.583) * [-413.086] (-411.760) (-410.919) (-411.846) -- 0:00:47
228000 -- (-411.832) (-410.434) [-410.111] (-412.591) * (-409.793) (-416.523) [-411.181] (-410.903) -- 0:00:47
228500 -- (-411.744) (-409.977) [-409.123] (-413.348) * [-410.657] (-410.746) (-410.487) (-409.604) -- 0:00:47
229000 -- (-411.808) [-411.331] (-409.281) (-412.696) * (-410.769) (-410.328) (-412.337) [-411.512] -- 0:00:47
229500 -- (-410.301) [-409.457] (-409.493) (-409.289) * [-410.393] (-410.133) (-412.037) (-409.767) -- 0:00:47
230000 -- (-409.825) (-412.748) [-409.266] (-413.962) * [-412.722] (-410.892) (-411.491) (-413.428) -- 0:00:46
Average standard deviation of split frequencies: 0.013667
230500 -- [-409.635] (-409.644) (-413.077) (-408.835) * (-412.265) [-410.374] (-413.289) (-412.059) -- 0:00:46
231000 -- [-409.916] (-410.990) (-409.340) (-410.972) * (-412.114) [-410.985] (-416.027) (-411.814) -- 0:00:46
231500 -- (-412.192) (-409.282) [-410.050] (-409.332) * (-413.380) (-411.242) (-414.108) [-409.368] -- 0:00:46
232000 -- (-417.323) (-410.242) [-410.267] (-410.726) * [-414.356] (-409.995) (-412.344) (-409.195) -- 0:00:46
232500 -- (-409.879) (-410.134) [-411.291] (-411.076) * [-410.518] (-414.049) (-409.741) (-408.716) -- 0:00:46
233000 -- [-415.360] (-410.176) (-408.698) (-415.029) * (-409.037) (-413.228) [-410.000] (-409.037) -- 0:00:46
233500 -- (-412.299) [-411.228] (-414.170) (-412.816) * (-412.278) [-409.411] (-410.254) (-412.745) -- 0:00:45
234000 -- (-410.346) [-410.943] (-411.295) (-412.902) * [-409.242] (-410.284) (-411.583) (-409.691) -- 0:00:45
234500 -- (-409.757) (-412.446) [-410.577] (-411.877) * (-409.719) (-411.935) [-411.843] (-411.400) -- 0:00:45
235000 -- (-410.202) (-413.464) (-409.211) [-411.055] * (-409.455) (-412.136) [-409.735] (-409.212) -- 0:00:45
Average standard deviation of split frequencies: 0.014107
235500 -- (-412.789) (-411.316) (-410.779) [-409.300] * (-412.265) (-412.356) (-409.964) [-408.779] -- 0:00:45
236000 -- (-410.095) (-409.651) (-411.617) [-410.221] * (-409.473) (-415.105) (-409.615) [-412.441] -- 0:00:45
236500 -- (-409.342) [-409.284] (-412.893) (-409.834) * [-410.421] (-413.187) (-409.170) (-410.512) -- 0:00:45
237000 -- (-408.810) (-408.884) (-415.590) [-410.814] * [-409.689] (-413.066) (-413.920) (-409.869) -- 0:00:45
237500 -- [-410.498] (-409.905) (-412.784) (-412.311) * [-410.610] (-411.596) (-409.035) (-409.633) -- 0:00:44
238000 -- (-413.359) (-409.278) (-413.232) [-411.150] * (-414.061) [-408.810] (-409.303) (-411.547) -- 0:00:44
238500 -- (-418.285) (-410.765) (-411.057) [-413.226] * (-410.810) [-410.906] (-409.869) (-412.797) -- 0:00:44
239000 -- [-412.046] (-410.198) (-413.647) (-417.048) * (-410.166) [-411.228] (-410.083) (-409.372) -- 0:00:44
239500 -- (-409.015) (-412.880) (-413.841) [-413.299] * [-410.074] (-411.356) (-411.961) (-410.217) -- 0:00:47
240000 -- (-408.486) (-410.482) (-409.468) [-412.859] * [-410.175] (-411.567) (-412.443) (-410.530) -- 0:00:47
Average standard deviation of split frequencies: 0.012120
240500 -- (-410.384) (-413.084) [-409.656] (-409.189) * (-412.619) (-414.732) (-409.890) [-411.857] -- 0:00:47
241000 -- (-414.466) [-413.640] (-411.727) (-408.528) * [-409.358] (-413.835) (-412.239) (-412.705) -- 0:00:47
241500 -- (-410.086) [-410.607] (-412.241) (-412.044) * (-411.287) (-411.460) (-415.840) [-414.563] -- 0:00:47
242000 -- (-411.744) [-409.800] (-410.652) (-417.580) * [-410.054] (-410.158) (-411.265) (-410.119) -- 0:00:46
242500 -- [-409.932] (-410.037) (-409.333) (-411.535) * (-409.860) (-410.367) (-409.150) [-410.495] -- 0:00:46
243000 -- (-409.700) (-409.821) [-413.236] (-410.589) * (-409.901) (-414.703) (-408.687) [-409.397] -- 0:00:46
243500 -- (-408.911) (-408.921) (-418.786) [-411.071] * (-416.917) (-410.067) (-409.512) [-413.497] -- 0:00:46
244000 -- (-409.467) [-409.125] (-411.349) (-408.712) * (-412.087) (-410.543) [-408.700] (-410.688) -- 0:00:46
244500 -- (-410.586) (-411.066) [-412.078] (-408.928) * (-410.595) (-410.303) [-409.836] (-411.360) -- 0:00:46
245000 -- (-411.963) [-410.276] (-410.468) (-410.188) * [-411.908] (-412.306) (-411.852) (-410.940) -- 0:00:46
Average standard deviation of split frequencies: 0.012512
245500 -- [-410.944] (-410.457) (-409.641) (-409.377) * (-412.428) (-411.954) (-410.538) [-410.636] -- 0:00:46
246000 -- (-414.517) [-410.639] (-410.903) (-409.640) * (-412.379) (-411.817) [-410.053] (-412.860) -- 0:00:45
246500 -- (-408.716) (-414.570) (-412.562) [-411.145] * (-411.002) (-411.026) (-411.880) [-410.697] -- 0:00:45
247000 -- (-413.701) [-408.679] (-413.432) (-411.004) * (-410.300) [-410.967] (-409.453) (-411.594) -- 0:00:45
247500 -- (-411.200) (-413.594) [-410.260] (-415.829) * [-410.610] (-410.311) (-413.360) (-410.332) -- 0:00:45
248000 -- (-409.647) (-412.533) (-410.647) [-412.518] * (-412.203) [-411.597] (-414.401) (-412.709) -- 0:00:45
248500 -- [-409.543] (-412.251) (-412.172) (-410.446) * [-410.357] (-409.451) (-413.676) (-412.950) -- 0:00:45
249000 -- (-411.386) (-410.317) [-412.272] (-410.968) * (-409.304) (-411.986) [-411.253] (-411.030) -- 0:00:45
249500 -- (-412.080) [-411.546] (-417.242) (-409.755) * (-412.554) (-413.774) (-412.532) [-413.576] -- 0:00:45
250000 -- [-410.378] (-409.297) (-415.588) (-410.482) * (-411.588) [-411.126] (-411.710) (-412.286) -- 0:00:45
Average standard deviation of split frequencies: 0.012943
250500 -- (-410.746) (-411.254) [-410.870] (-413.847) * (-412.353) [-410.806] (-410.682) (-409.405) -- 0:00:44
251000 -- [-410.304] (-412.356) (-409.122) (-414.595) * (-411.401) [-408.863] (-411.677) (-411.230) -- 0:00:44
251500 -- (-411.144) (-411.731) [-409.327] (-412.846) * (-410.369) (-410.760) (-409.984) [-411.795] -- 0:00:44
252000 -- (-413.352) [-411.930] (-417.947) (-412.996) * (-410.214) (-409.225) [-412.895] (-410.830) -- 0:00:44
252500 -- (-410.862) [-413.871] (-417.718) (-410.172) * (-412.249) [-409.761] (-414.406) (-408.967) -- 0:00:44
253000 -- (-413.262) (-410.580) [-413.582] (-411.056) * (-410.323) (-411.017) (-418.419) [-410.893] -- 0:00:44
253500 -- (-410.479) (-409.988) [-412.879] (-410.736) * (-411.438) [-411.062] (-410.748) (-413.167) -- 0:00:44
254000 -- (-408.927) (-416.657) (-411.069) [-409.358] * (-412.637) [-409.403] (-411.834) (-415.329) -- 0:00:44
254500 -- (-409.487) (-412.676) [-414.990] (-409.629) * (-413.870) (-410.519) (-415.278) [-411.494] -- 0:00:43
255000 -- (-410.177) (-414.044) [-410.578] (-409.953) * (-410.966) [-410.174] (-410.540) (-411.547) -- 0:00:43
Average standard deviation of split frequencies: 0.012782
255500 -- (-412.026) (-412.580) [-410.639] (-412.882) * (-410.078) [-410.591] (-409.648) (-410.831) -- 0:00:43
256000 -- (-417.364) (-414.458) (-410.991) [-410.847] * [-411.012] (-413.173) (-409.849) (-411.723) -- 0:00:46
256500 -- [-410.200] (-409.965) (-411.336) (-410.193) * (-409.218) (-410.576) (-410.272) [-410.358] -- 0:00:46
257000 -- (-409.696) [-411.672] (-411.557) (-416.642) * (-411.700) (-410.573) (-409.164) [-411.080] -- 0:00:46
257500 -- [-409.822] (-409.269) (-411.179) (-409.586) * (-410.061) [-411.663] (-413.918) (-410.114) -- 0:00:46
258000 -- (-409.604) [-409.205] (-411.747) (-409.696) * [-410.199] (-410.659) (-410.738) (-408.973) -- 0:00:46
258500 -- (-413.044) (-410.061) (-410.891) [-411.413] * (-411.976) (-411.629) [-411.393] (-410.398) -- 0:00:45
259000 -- [-410.605] (-413.413) (-412.206) (-412.782) * (-410.179) [-409.688] (-410.178) (-413.200) -- 0:00:45
259500 -- (-409.671) (-412.451) (-411.848) [-411.998] * [-410.303] (-409.916) (-409.258) (-411.762) -- 0:00:45
260000 -- (-411.526) [-410.283] (-411.287) (-412.179) * [-410.382] (-413.323) (-411.213) (-416.552) -- 0:00:45
Average standard deviation of split frequencies: 0.011702
260500 -- (-410.727) (-411.340) [-410.050] (-412.290) * (-409.463) (-414.588) [-409.639] (-414.624) -- 0:00:45
261000 -- (-409.440) (-418.180) [-412.112] (-412.268) * (-417.872) (-415.938) (-412.511) [-412.159] -- 0:00:45
261500 -- [-410.105] (-409.336) (-408.729) (-413.709) * [-411.562] (-410.965) (-412.547) (-413.951) -- 0:00:45
262000 -- [-409.168] (-413.265) (-410.832) (-412.331) * (-416.172) [-409.962] (-409.375) (-410.247) -- 0:00:45
262500 -- (-410.139) (-409.141) [-410.058] (-412.565) * [-409.078] (-411.141) (-410.594) (-409.017) -- 0:00:44
263000 -- [-412.291] (-411.815) (-408.984) (-412.909) * (-411.796) (-409.420) [-409.029] (-410.163) -- 0:00:44
263500 -- (-415.505) [-409.719] (-409.136) (-409.718) * [-408.979] (-414.766) (-410.320) (-412.749) -- 0:00:44
264000 -- (-414.393) (-410.020) [-413.666] (-409.556) * (-411.407) [-414.022] (-410.917) (-409.201) -- 0:00:44
264500 -- (-410.357) (-410.445) [-410.944] (-409.298) * [-409.333] (-412.926) (-413.625) (-411.145) -- 0:00:44
265000 -- (-409.418) [-411.326] (-411.797) (-409.475) * (-409.365) (-409.971) [-411.202] (-408.830) -- 0:00:44
Average standard deviation of split frequencies: 0.012701
265500 -- (-412.373) (-411.233) (-410.070) [-409.555] * (-409.820) (-409.717) [-411.792] (-409.959) -- 0:00:44
266000 -- (-410.012) (-411.814) (-409.960) [-411.994] * (-412.320) [-410.547] (-411.497) (-411.426) -- 0:00:44
266500 -- (-409.778) [-415.960] (-411.407) (-408.713) * (-412.423) (-414.361) [-409.607] (-409.979) -- 0:00:44
267000 -- [-410.220] (-413.417) (-411.310) (-410.732) * (-415.131) (-412.147) [-410.087] (-408.611) -- 0:00:43
267500 -- [-409.244] (-412.003) (-408.784) (-413.528) * (-411.689) (-409.862) [-410.056] (-414.337) -- 0:00:43
268000 -- (-410.437) [-413.100] (-410.952) (-412.877) * (-412.204) (-409.459) [-409.930] (-412.507) -- 0:00:43
268500 -- (-413.270) (-411.242) (-411.717) [-413.129] * (-411.918) [-409.536] (-410.611) (-413.018) -- 0:00:43
269000 -- (-414.002) [-413.157] (-409.191) (-409.193) * (-414.654) (-412.960) [-408.629] (-411.652) -- 0:00:43
269500 -- (-410.560) [-409.947] (-410.607) (-413.609) * (-411.143) (-410.502) (-408.655) [-411.565] -- 0:00:43
270000 -- (-410.535) [-409.904] (-409.639) (-410.693) * (-410.731) (-411.670) (-409.433) [-412.070] -- 0:00:43
Average standard deviation of split frequencies: 0.014223
270500 -- (-410.923) (-410.454) (-410.202) [-414.329] * (-410.866) (-413.871) (-410.642) [-410.692] -- 0:00:43
271000 -- (-409.981) (-410.146) (-410.426) [-408.842] * [-410.974] (-414.819) (-413.304) (-414.452) -- 0:00:43
271500 -- (-410.491) (-409.356) (-415.399) [-409.269] * (-412.817) [-416.533] (-421.357) (-412.732) -- 0:00:42
272000 -- (-409.235) (-415.069) [-409.178] (-411.914) * (-412.837) [-410.419] (-412.461) (-413.628) -- 0:00:42
272500 -- (-408.982) (-409.693) (-410.880) [-411.608] * (-412.122) (-413.898) (-411.093) [-411.423] -- 0:00:42
273000 -- [-409.628] (-408.967) (-413.582) (-409.180) * (-409.662) (-410.736) (-409.510) [-412.560] -- 0:00:45
273500 -- (-411.832) (-412.283) [-411.879] (-409.876) * (-410.971) (-411.586) (-410.395) [-409.749] -- 0:00:45
274000 -- (-411.966) (-410.824) (-412.908) [-411.671] * [-412.635] (-412.502) (-411.169) (-410.514) -- 0:00:45
274500 -- (-409.554) (-411.331) [-410.549] (-410.007) * (-414.781) (-414.676) [-410.336] (-410.810) -- 0:00:44
275000 -- (-409.603) (-411.811) [-409.637] (-409.429) * (-410.977) [-409.857] (-413.230) (-409.008) -- 0:00:44
Average standard deviation of split frequencies: 0.013474
275500 -- (-410.540) (-411.808) (-409.264) [-409.809] * (-413.067) (-409.247) (-410.387) [-410.704] -- 0:00:44
276000 -- (-413.048) (-410.287) (-409.913) [-409.779] * [-411.956] (-411.835) (-409.281) (-412.790) -- 0:00:44
276500 -- (-411.497) (-412.071) (-410.479) [-411.710] * [-409.359] (-411.349) (-411.408) (-411.202) -- 0:00:44
277000 -- [-410.606] (-411.085) (-410.065) (-412.014) * (-411.333) [-411.173] (-412.313) (-411.054) -- 0:00:44
277500 -- [-411.231] (-411.141) (-412.976) (-412.032) * (-414.508) [-411.105] (-411.604) (-411.209) -- 0:00:44
278000 -- (-412.669) [-410.457] (-412.103) (-410.155) * [-412.479] (-412.920) (-411.441) (-412.812) -- 0:00:44
278500 -- [-412.287] (-413.233) (-412.823) (-409.567) * [-412.994] (-411.981) (-410.891) (-409.352) -- 0:00:44
279000 -- [-412.190] (-411.363) (-411.332) (-414.882) * (-410.422) (-408.731) [-410.052] (-409.487) -- 0:00:43
279500 -- (-418.184) (-410.489) [-410.111] (-411.059) * (-410.542) (-410.315) (-408.853) [-409.762] -- 0:00:43
280000 -- (-411.449) (-410.553) (-408.840) [-410.399] * [-408.703] (-413.666) (-411.172) (-408.952) -- 0:00:43
Average standard deviation of split frequencies: 0.012877
280500 -- (-410.599) (-411.346) [-408.983] (-410.190) * [-410.122] (-409.698) (-413.648) (-411.601) -- 0:00:43
281000 -- (-411.569) (-413.242) [-411.046] (-411.328) * (-411.774) (-409.043) [-415.701] (-412.323) -- 0:00:43
281500 -- [-408.632] (-414.533) (-409.635) (-410.494) * (-410.872) (-412.911) [-411.215] (-409.534) -- 0:00:43
282000 -- (-409.812) [-412.092] (-410.753) (-409.928) * (-410.842) (-412.329) [-411.425] (-409.258) -- 0:00:43
282500 -- (-409.440) [-411.486] (-410.322) (-410.963) * (-412.740) (-410.144) (-409.491) [-411.844] -- 0:00:43
283000 -- [-409.478] (-410.910) (-412.542) (-409.392) * (-411.971) (-411.279) (-409.491) [-415.684] -- 0:00:43
283500 -- (-410.675) (-409.256) (-410.464) [-410.161] * (-409.335) (-412.896) (-411.087) [-410.923] -- 0:00:42
284000 -- (-409.930) (-415.635) (-410.709) [-410.234] * (-410.531) (-412.085) [-410.254] (-410.089) -- 0:00:42
284500 -- (-409.366) (-416.288) [-410.861] (-409.593) * (-411.238) [-411.759] (-411.214) (-416.649) -- 0:00:42
285000 -- (-409.332) [-410.324] (-410.715) (-413.261) * (-409.223) (-411.367) (-410.450) [-412.076] -- 0:00:42
Average standard deviation of split frequencies: 0.013644
285500 -- (-414.314) [-412.308] (-409.685) (-410.021) * (-412.678) [-412.037] (-408.935) (-410.049) -- 0:00:42
286000 -- (-413.452) (-413.029) (-413.015) [-410.212] * (-409.736) [-410.055] (-408.517) (-411.666) -- 0:00:42
286500 -- (-413.102) (-410.713) (-416.155) [-411.142] * [-411.277] (-410.774) (-410.060) (-412.183) -- 0:00:42
287000 -- (-411.593) (-411.234) (-409.552) [-409.880] * (-413.281) (-411.594) [-410.485] (-411.137) -- 0:00:42
287500 -- (-414.593) (-408.622) (-409.017) [-411.750] * [-412.836] (-411.422) (-412.576) (-411.493) -- 0:00:42
288000 -- (-412.467) (-408.992) [-411.725] (-409.407) * [-409.371] (-409.759) (-413.248) (-410.559) -- 0:00:42
288500 -- (-412.155) (-416.439) [-413.761] (-411.970) * (-409.280) (-410.269) [-409.340] (-410.762) -- 0:00:41
289000 -- (-411.604) (-412.182) [-412.023] (-415.816) * (-411.150) (-409.654) (-409.449) [-412.375] -- 0:00:41
289500 -- (-408.738) [-412.937] (-411.422) (-412.548) * [-410.703] (-410.718) (-409.943) (-410.437) -- 0:00:44
290000 -- (-412.885) [-409.714] (-412.860) (-412.085) * (-409.464) (-410.824) (-413.143) [-411.630] -- 0:00:44
Average standard deviation of split frequencies: 0.013356
290500 -- [-410.735] (-410.630) (-409.705) (-416.425) * (-414.805) [-411.072] (-412.238) (-409.241) -- 0:00:43
291000 -- [-409.782] (-413.361) (-409.645) (-409.805) * [-409.549] (-413.050) (-410.036) (-413.269) -- 0:00:43
291500 -- [-411.215] (-413.651) (-411.366) (-410.069) * (-412.652) [-410.417] (-413.630) (-408.949) -- 0:00:43
292000 -- (-413.725) (-408.651) (-409.104) [-410.125] * [-408.701] (-409.520) (-409.413) (-409.546) -- 0:00:43
292500 -- (-414.408) [-409.961] (-409.347) (-410.377) * (-411.588) (-409.678) [-409.553] (-409.630) -- 0:00:43
293000 -- (-408.938) [-410.808] (-412.421) (-418.129) * [-413.530] (-408.999) (-413.742) (-412.536) -- 0:00:43
293500 -- (-410.470) [-410.699] (-409.888) (-412.737) * (-413.229) (-409.644) (-413.259) [-409.922] -- 0:00:43
294000 -- [-410.646] (-411.651) (-413.908) (-411.048) * (-411.814) [-411.319] (-411.148) (-410.644) -- 0:00:43
294500 -- (-410.226) (-410.790) [-412.025] (-417.276) * (-409.453) (-411.784) (-413.185) [-410.863] -- 0:00:43
295000 -- [-411.959] (-411.945) (-412.742) (-413.218) * (-409.467) (-412.617) (-409.487) [-410.188] -- 0:00:43
Average standard deviation of split frequencies: 0.013771
295500 -- (-412.218) (-410.348) [-412.257] (-410.013) * (-409.268) (-413.108) (-410.944) [-409.863] -- 0:00:42
296000 -- [-408.886] (-412.130) (-411.936) (-411.729) * [-409.396] (-415.080) (-409.372) (-410.164) -- 0:00:42
296500 -- [-409.040] (-409.087) (-411.173) (-410.385) * (-410.235) (-411.329) (-413.650) [-412.648] -- 0:00:42
297000 -- [-410.904] (-410.344) (-418.800) (-411.161) * (-412.493) (-409.524) [-410.608] (-408.947) -- 0:00:42
297500 -- (-409.750) [-409.336] (-411.757) (-409.844) * (-410.690) (-410.827) [-411.732] (-408.607) -- 0:00:42
298000 -- (-409.193) [-412.183] (-408.701) (-411.040) * (-413.577) (-410.839) [-410.291] (-410.469) -- 0:00:42
298500 -- (-411.527) (-408.801) (-409.925) [-409.908] * (-410.039) (-410.819) [-410.598] (-414.664) -- 0:00:42
299000 -- (-411.581) [-410.734] (-410.237) (-410.867) * (-411.094) [-410.514] (-415.247) (-409.397) -- 0:00:42
299500 -- (-410.457) [-409.377] (-409.575) (-412.450) * (-413.524) (-412.759) [-412.519] (-409.460) -- 0:00:42
300000 -- (-410.707) (-410.148) (-408.663) [-411.542] * [-412.212] (-411.129) (-412.371) (-409.994) -- 0:00:42
Average standard deviation of split frequencies: 0.014797
300500 -- (-409.048) (-410.682) [-412.094] (-411.854) * (-411.684) (-409.945) (-411.930) [-410.011] -- 0:00:41
301000 -- [-408.914] (-413.876) (-409.558) (-408.956) * (-409.330) [-409.974] (-413.244) (-409.499) -- 0:00:41
301500 -- (-409.068) (-413.928) (-409.964) [-408.881] * (-414.233) (-412.618) (-410.841) [-409.380] -- 0:00:41
302000 -- (-410.113) [-413.749] (-409.639) (-409.229) * (-414.882) [-411.848] (-410.375) (-410.344) -- 0:00:41
302500 -- [-409.681] (-416.273) (-410.077) (-411.162) * [-414.230] (-414.234) (-410.915) (-409.966) -- 0:00:41
303000 -- (-411.426) [-411.141] (-412.445) (-411.846) * (-415.213) [-410.172] (-409.551) (-409.703) -- 0:00:41
303500 -- (-411.857) [-411.537] (-411.855) (-410.116) * (-412.396) [-408.694] (-410.756) (-410.660) -- 0:00:41
304000 -- [-415.190] (-410.464) (-409.116) (-411.099) * (-410.316) (-409.661) (-409.211) [-410.146] -- 0:00:41
304500 -- (-410.683) (-413.458) [-410.043] (-408.958) * (-410.293) (-409.755) [-409.310] (-409.826) -- 0:00:41
305000 -- (-414.579) (-410.147) (-410.492) [-409.262] * (-409.151) [-410.742] (-408.700) (-410.120) -- 0:00:41
Average standard deviation of split frequencies: 0.014036
305500 -- [-411.447] (-410.198) (-410.574) (-413.200) * [-411.798] (-409.980) (-410.604) (-411.618) -- 0:00:43
306000 -- (-411.282) (-409.976) (-409.964) [-410.591] * [-411.267] (-411.968) (-412.568) (-409.339) -- 0:00:43
306500 -- (-409.527) (-410.656) [-414.590] (-410.095) * (-410.991) (-410.155) [-409.813] (-415.441) -- 0:00:42
307000 -- (-410.446) (-410.077) (-411.451) [-409.225] * (-415.682) [-410.892] (-409.733) (-411.402) -- 0:00:42
307500 -- (-410.957) (-410.151) (-412.244) [-409.882] * (-411.333) [-410.573] (-412.342) (-409.560) -- 0:00:42
308000 -- (-409.903) (-408.642) [-415.998] (-413.657) * [-409.543] (-413.466) (-414.523) (-409.776) -- 0:00:42
308500 -- (-410.964) (-410.160) [-414.361] (-411.347) * [-408.956] (-412.648) (-415.544) (-412.134) -- 0:00:42
309000 -- (-409.717) (-412.257) (-409.400) [-410.857] * [-408.538] (-410.470) (-410.157) (-409.181) -- 0:00:42
309500 -- (-412.085) [-412.397] (-409.585) (-412.147) * (-408.636) [-413.793] (-411.757) (-418.673) -- 0:00:42
310000 -- (-410.288) (-413.626) [-410.316] (-410.850) * (-410.095) [-409.941] (-414.383) (-414.248) -- 0:00:42
Average standard deviation of split frequencies: 0.013994
310500 -- [-409.872] (-411.271) (-409.712) (-410.796) * [-410.662] (-414.738) (-409.340) (-410.599) -- 0:00:42
311000 -- (-411.933) (-410.228) (-411.418) [-410.081] * (-409.714) (-414.730) (-409.673) [-412.048] -- 0:00:42
311500 -- (-409.738) (-409.713) [-410.202] (-410.366) * [-410.654] (-409.286) (-409.320) (-414.363) -- 0:00:41
312000 -- (-415.301) [-409.476] (-413.626) (-412.622) * (-410.740) [-409.604] (-408.969) (-408.823) -- 0:00:41
312500 -- (-410.909) (-411.107) [-410.459] (-410.304) * (-411.646) (-409.826) (-410.126) [-411.182] -- 0:00:41
313000 -- (-410.357) (-412.623) [-410.192] (-411.155) * (-412.416) (-410.526) [-409.760] (-409.626) -- 0:00:41
313500 -- (-410.448) (-411.848) [-411.478] (-411.472) * (-411.001) [-410.480] (-411.562) (-409.919) -- 0:00:41
314000 -- (-410.460) (-409.908) (-409.450) [-410.933] * (-410.678) (-410.648) (-412.322) [-409.915] -- 0:00:41
314500 -- (-412.250) (-412.362) [-409.784] (-409.603) * (-409.411) (-410.388) (-409.940) [-409.645] -- 0:00:41
315000 -- [-408.985] (-410.525) (-409.366) (-409.979) * (-411.296) (-412.345) [-411.005] (-410.273) -- 0:00:41
Average standard deviation of split frequencies: 0.014503
315500 -- (-417.635) (-409.270) [-409.669] (-411.446) * [-409.497] (-410.955) (-414.135) (-409.638) -- 0:00:41
316000 -- (-410.025) [-411.913] (-413.900) (-408.884) * (-412.390) (-412.146) (-409.999) [-411.466] -- 0:00:41
316500 -- (-413.821) [-411.541] (-410.791) (-409.533) * [-412.925] (-411.403) (-411.272) (-409.863) -- 0:00:41
317000 -- (-409.048) (-411.511) [-413.309] (-411.648) * (-414.414) (-408.667) [-414.365] (-415.659) -- 0:00:40
317500 -- (-411.153) (-413.358) (-409.428) [-410.577] * (-418.193) [-410.285] (-415.129) (-410.544) -- 0:00:40
318000 -- (-412.378) (-410.114) (-409.580) [-413.085] * (-410.523) (-409.958) (-409.665) [-411.401] -- 0:00:40
318500 -- [-412.203] (-410.985) (-410.259) (-410.620) * (-412.419) (-410.308) [-408.900] (-409.806) -- 0:00:40
319000 -- (-409.201) (-410.625) [-408.987] (-410.938) * (-412.055) [-410.741] (-409.670) (-410.614) -- 0:00:40
319500 -- (-417.408) (-410.326) (-412.908) [-409.242] * [-410.707] (-410.418) (-410.631) (-410.873) -- 0:00:40
320000 -- (-413.989) (-410.169) (-410.087) [-413.477] * (-410.462) [-412.242] (-411.586) (-410.673) -- 0:00:40
Average standard deviation of split frequencies: 0.015027
320500 -- [-411.629] (-409.214) (-410.158) (-410.198) * (-411.307) (-412.487) (-411.223) [-412.837] -- 0:00:40
321000 -- (-409.848) (-410.583) [-411.111] (-410.486) * (-411.021) [-411.957] (-410.462) (-410.861) -- 0:00:40
321500 -- [-410.041] (-411.954) (-411.655) (-410.133) * (-411.998) (-408.478) [-409.490] (-411.398) -- 0:00:40
322000 -- (-412.579) (-411.575) (-413.651) [-411.556] * (-409.761) (-413.659) (-411.889) [-411.490] -- 0:00:42
322500 -- (-409.509) (-414.241) (-412.226) [-417.325] * [-410.856] (-408.538) (-410.247) (-411.061) -- 0:00:42
323000 -- (-411.286) (-412.201) (-409.137) [-412.242] * [-409.674] (-410.952) (-411.283) (-410.460) -- 0:00:41
323500 -- [-408.498] (-415.383) (-410.847) (-410.671) * (-409.565) (-409.887) [-411.189] (-411.125) -- 0:00:41
324000 -- (-408.549) (-411.965) [-410.008] (-408.908) * (-411.552) (-409.186) [-413.285] (-408.877) -- 0:00:41
324500 -- (-409.718) (-411.181) [-413.268] (-412.871) * (-412.301) [-410.203] (-416.063) (-409.853) -- 0:00:41
325000 -- (-412.343) (-412.276) (-412.771) [-409.875] * (-414.345) [-415.135] (-412.533) (-410.954) -- 0:00:41
Average standard deviation of split frequencies: 0.015424
325500 -- (-412.157) (-408.816) [-410.613] (-409.692) * (-410.401) [-411.146] (-409.887) (-409.880) -- 0:00:41
326000 -- (-408.963) [-408.733] (-412.475) (-409.198) * (-414.488) (-409.723) (-411.050) [-409.901] -- 0:00:41
326500 -- (-410.095) (-408.876) [-409.605] (-411.340) * (-413.092) [-409.538] (-411.990) (-410.993) -- 0:00:41
327000 -- (-409.134) (-413.702) [-410.403] (-411.346) * (-408.947) (-410.837) [-410.562] (-409.749) -- 0:00:41
327500 -- (-414.249) (-412.814) (-410.553) [-410.936] * (-410.200) [-411.612] (-412.720) (-410.561) -- 0:00:41
328000 -- (-410.537) (-410.937) [-408.902] (-408.832) * [-410.374] (-409.156) (-408.923) (-410.309) -- 0:00:40
328500 -- [-410.588] (-413.537) (-409.754) (-408.720) * (-413.100) (-410.345) (-413.477) [-410.250] -- 0:00:40
329000 -- [-409.160] (-411.161) (-411.089) (-411.956) * (-411.257) [-409.904] (-413.969) (-410.131) -- 0:00:40
329500 -- (-412.451) (-409.989) [-411.841] (-415.080) * (-411.233) [-409.794] (-411.576) (-412.049) -- 0:00:40
330000 -- (-411.623) (-409.149) (-412.991) [-410.567] * (-409.318) [-408.760] (-411.372) (-409.482) -- 0:00:40
Average standard deviation of split frequencies: 0.014256
330500 -- (-410.150) [-410.346] (-411.921) (-410.432) * (-411.571) (-409.768) (-410.050) [-410.532] -- 0:00:40
331000 -- (-410.095) (-409.079) [-416.395] (-408.705) * (-409.865) (-409.205) (-413.048) [-411.134] -- 0:00:40
331500 -- (-413.708) (-412.946) (-408.675) [-410.871] * [-412.877] (-408.941) (-411.668) (-410.766) -- 0:00:40
332000 -- [-411.249] (-410.917) (-415.085) (-410.231) * [-410.721] (-408.837) (-409.941) (-408.992) -- 0:00:40
332500 -- (-416.709) (-411.139) (-414.339) [-409.151] * (-412.709) (-411.325) (-410.198) [-410.713] -- 0:00:40
333000 -- (-414.374) (-412.666) (-409.301) [-409.487] * (-415.162) [-414.052] (-410.584) (-411.091) -- 0:00:40
333500 -- (-415.963) (-409.762) [-411.602] (-411.243) * [-410.721] (-414.175) (-409.205) (-414.288) -- 0:00:39
334000 -- (-413.110) (-409.086) (-411.631) [-408.998] * (-410.271) (-412.014) [-409.028] (-410.711) -- 0:00:39
334500 -- (-413.658) [-409.567] (-412.472) (-409.111) * (-410.187) (-415.964) [-412.484] (-410.547) -- 0:00:39
335000 -- (-410.940) [-410.791] (-410.180) (-411.359) * [-409.834] (-413.579) (-411.113) (-409.325) -- 0:00:39
Average standard deviation of split frequencies: 0.014576
335500 -- (-410.780) [-410.022] (-409.708) (-410.982) * (-413.164) (-411.502) (-410.919) [-411.877] -- 0:00:39
336000 -- [-410.095] (-414.433) (-411.984) (-411.658) * (-410.514) [-409.365] (-411.204) (-411.857) -- 0:00:39
336500 -- (-411.549) (-410.881) (-410.431) [-409.070] * (-414.289) (-409.957) [-411.246] (-412.381) -- 0:00:39
337000 -- [-410.730] (-409.928) (-410.431) (-412.466) * (-412.553) (-413.849) [-412.191] (-409.099) -- 0:00:39
337500 -- (-412.418) (-409.042) (-411.706) [-412.091] * (-411.944) (-409.538) (-411.298) [-411.861] -- 0:00:41
338000 -- (-410.696) (-411.016) [-411.657] (-411.859) * (-412.143) (-413.214) [-410.267] (-410.013) -- 0:00:41
338500 -- (-410.056) (-410.983) [-410.582] (-412.015) * (-410.625) [-409.103] (-414.584) (-409.854) -- 0:00:41
339000 -- (-412.263) (-410.631) (-412.138) [-409.250] * [-411.924] (-410.468) (-410.225) (-411.775) -- 0:00:40
339500 -- (-412.798) (-411.319) [-409.010] (-409.407) * (-414.203) [-409.965] (-411.186) (-411.277) -- 0:00:40
340000 -- (-411.757) [-410.279] (-408.630) (-409.198) * (-410.270) [-410.741] (-413.482) (-417.261) -- 0:00:40
Average standard deviation of split frequencies: 0.015145
340500 -- (-410.498) [-413.841] (-408.973) (-410.489) * (-411.684) (-410.534) [-411.638] (-410.018) -- 0:00:40
341000 -- [-412.097] (-412.826) (-408.800) (-411.001) * (-411.801) (-409.593) (-409.675) [-410.834] -- 0:00:40
341500 -- [-411.136] (-412.873) (-409.718) (-409.436) * (-416.194) (-409.152) (-410.761) [-409.867] -- 0:00:40
342000 -- (-410.365) [-413.445] (-409.640) (-410.029) * (-413.270) (-409.443) (-412.560) [-410.621] -- 0:00:40
342500 -- (-413.230) (-422.057) [-410.290] (-409.683) * (-411.146) (-416.181) [-414.530] (-411.312) -- 0:00:40
343000 -- (-411.400) (-413.758) [-408.734] (-413.206) * (-409.341) (-411.182) [-410.819] (-410.132) -- 0:00:40
343500 -- [-410.181] (-411.890) (-408.972) (-412.004) * (-410.481) (-411.018) (-416.104) [-413.632] -- 0:00:40
344000 -- (-411.602) (-412.205) (-413.335) [-410.300] * (-411.963) (-412.380) [-414.447] (-411.057) -- 0:00:40
344500 -- (-413.027) (-412.588) [-410.823] (-411.638) * (-410.224) (-416.173) (-410.985) [-410.782] -- 0:00:39
345000 -- (-410.912) (-414.034) (-410.235) [-411.077] * [-410.687] (-412.068) (-409.721) (-409.321) -- 0:00:39
Average standard deviation of split frequencies: 0.016122
345500 -- [-409.547] (-410.762) (-409.337) (-410.745) * (-412.345) (-410.363) [-409.759] (-410.231) -- 0:00:39
346000 -- [-410.357] (-409.298) (-409.818) (-412.235) * (-414.333) [-410.629] (-409.166) (-409.585) -- 0:00:39
346500 -- (-411.722) (-410.443) [-410.574] (-410.408) * (-412.657) (-411.648) (-413.121) [-415.170] -- 0:00:39
347000 -- [-409.768] (-411.149) (-411.638) (-413.921) * (-409.036) (-409.167) [-409.148] (-410.144) -- 0:00:39
347500 -- (-411.000) [-409.186] (-410.644) (-409.581) * (-409.762) (-411.836) (-410.880) [-413.293] -- 0:00:39
348000 -- [-410.234] (-409.288) (-410.084) (-411.729) * [-410.556] (-410.686) (-416.375) (-412.289) -- 0:00:39
348500 -- (-412.370) [-411.109] (-409.419) (-414.728) * [-409.477] (-412.281) (-414.405) (-412.438) -- 0:00:39
349000 -- [-409.645] (-411.714) (-410.407) (-410.029) * [-410.524] (-410.906) (-412.209) (-410.576) -- 0:00:39
349500 -- [-410.443] (-413.022) (-411.139) (-408.754) * [-410.945] (-411.751) (-409.132) (-410.497) -- 0:00:39
350000 -- (-409.553) (-410.256) (-411.900) [-412.321] * (-410.759) (-413.140) (-410.087) [-413.035] -- 0:00:39
Average standard deviation of split frequencies: 0.015609
350500 -- (-410.356) (-409.913) (-411.276) [-413.733] * [-408.988] (-411.818) (-414.287) (-411.871) -- 0:00:38
351000 -- (-414.783) (-410.679) [-410.419] (-411.392) * (-412.503) [-410.009] (-410.214) (-414.635) -- 0:00:38
351500 -- (-410.511) (-409.626) (-409.556) [-409.899] * [-409.939] (-414.223) (-411.863) (-414.794) -- 0:00:38
352000 -- (-411.154) (-409.655) (-413.547) [-408.845] * (-412.773) [-410.181] (-412.754) (-409.296) -- 0:00:38
352500 -- (-409.789) (-412.129) (-411.412) [-410.877] * (-413.828) (-410.871) (-413.098) [-409.581] -- 0:00:38
353000 -- (-414.435) [-410.636] (-408.592) (-409.748) * (-409.076) (-414.793) (-410.708) [-412.432] -- 0:00:38
353500 -- (-413.567) [-410.149] (-410.072) (-409.413) * [-408.718] (-408.592) (-410.465) (-410.247) -- 0:00:40
354000 -- [-410.086] (-410.906) (-410.143) (-408.778) * (-413.690) [-408.856] (-409.073) (-409.611) -- 0:00:40
354500 -- [-409.984] (-411.673) (-411.193) (-410.447) * (-413.306) (-412.905) (-409.644) [-411.171] -- 0:00:40
355000 -- (-411.108) (-409.675) (-412.239) [-411.470] * [-414.854] (-412.430) (-411.068) (-410.515) -- 0:00:39
Average standard deviation of split frequencies: 0.015228
355500 -- (-412.515) (-409.906) (-409.420) [-409.641] * [-412.711] (-411.548) (-412.193) (-410.197) -- 0:00:39
356000 -- (-410.292) (-411.038) [-410.100] (-409.807) * [-412.332] (-410.804) (-412.062) (-409.678) -- 0:00:39
356500 -- (-412.937) (-409.101) (-411.578) [-409.857] * (-409.527) (-410.784) [-410.219] (-411.460) -- 0:00:39
357000 -- (-412.879) (-410.472) (-410.577) [-409.197] * (-409.264) (-411.590) [-409.937] (-410.372) -- 0:00:39
357500 -- [-411.290] (-409.514) (-410.150) (-410.531) * (-411.480) (-412.542) (-409.423) [-408.950] -- 0:00:39
358000 -- (-409.809) (-410.315) (-415.260) [-408.785] * (-414.981) (-410.672) [-409.197] (-408.873) -- 0:00:39
358500 -- (-411.185) (-410.307) [-410.471] (-409.165) * (-410.830) (-411.742) (-409.228) [-410.667] -- 0:00:39
359000 -- (-409.906) (-409.318) (-413.697) [-413.543] * (-409.220) (-411.900) (-411.191) [-411.728] -- 0:00:39
359500 -- (-410.089) (-409.452) [-408.955] (-409.937) * (-410.195) (-413.930) (-410.102) [-411.925] -- 0:00:39
360000 -- (-412.731) (-409.586) [-408.925] (-411.553) * (-411.820) [-409.505] (-416.162) (-411.831) -- 0:00:39
Average standard deviation of split frequencies: 0.014958
360500 -- (-415.290) [-413.637] (-410.080) (-410.528) * (-413.090) [-408.937] (-415.009) (-409.718) -- 0:00:39
361000 -- (-410.708) (-409.672) (-410.504) [-410.583] * (-409.777) (-410.336) (-411.360) [-409.467] -- 0:00:38
361500 -- (-411.985) (-411.670) [-413.145] (-410.224) * (-409.529) [-409.358] (-413.183) (-409.745) -- 0:00:38
362000 -- (-409.460) [-411.507] (-408.963) (-411.411) * (-410.000) [-410.088] (-411.958) (-409.200) -- 0:00:38
362500 -- (-408.814) (-411.506) [-408.925] (-414.534) * (-410.706) (-413.118) (-410.490) [-411.045] -- 0:00:38
363000 -- (-410.229) (-408.533) (-408.999) [-412.025] * (-410.826) (-411.330) [-411.697] (-416.413) -- 0:00:38
363500 -- (-410.756) [-410.454] (-413.482) (-409.201) * [-409.488] (-411.390) (-413.777) (-414.170) -- 0:00:38
364000 -- [-409.104] (-412.041) (-409.513) (-408.836) * (-409.421) (-410.787) [-410.071] (-414.092) -- 0:00:38
364500 -- [-408.952] (-410.184) (-411.085) (-410.160) * [-408.555] (-413.336) (-412.116) (-415.006) -- 0:00:38
365000 -- (-409.228) [-409.408] (-411.881) (-411.662) * (-409.201) [-412.833] (-410.174) (-417.775) -- 0:00:38
Average standard deviation of split frequencies: 0.015098
365500 -- [-409.321] (-413.785) (-409.591) (-412.248) * (-411.411) [-409.818] (-410.437) (-412.765) -- 0:00:38
366000 -- (-410.510) [-414.177] (-410.027) (-412.025) * [-409.359] (-410.682) (-410.437) (-410.714) -- 0:00:38
366500 -- (-411.155) (-410.868) [-411.315] (-417.045) * (-410.720) [-409.969] (-411.190) (-410.237) -- 0:00:38
367000 -- (-410.779) [-409.993] (-412.652) (-415.694) * (-415.203) [-410.519] (-409.826) (-410.338) -- 0:00:37
367500 -- [-412.764] (-412.319) (-410.803) (-409.888) * (-416.636) (-408.977) (-408.790) [-408.875] -- 0:00:37
368000 -- (-410.771) (-409.631) [-413.802] (-410.705) * (-410.678) [-409.617] (-409.224) (-408.900) -- 0:00:37
368500 -- (-408.805) [-409.805] (-416.182) (-411.194) * [-409.847] (-410.754) (-409.375) (-412.757) -- 0:00:37
369000 -- (-410.438) (-413.516) [-411.818] (-411.404) * (-409.149) (-414.117) (-410.044) [-409.794] -- 0:00:37
369500 -- (-411.075) [-410.684] (-413.365) (-412.290) * (-408.510) (-419.932) (-410.833) [-409.530] -- 0:00:37
370000 -- (-410.056) (-408.879) (-410.300) [-409.781] * (-412.966) (-412.600) [-409.551] (-411.014) -- 0:00:39
Average standard deviation of split frequencies: 0.015827
370500 -- (-410.029) (-410.379) (-409.864) [-410.308] * [-412.431] (-410.311) (-412.030) (-412.206) -- 0:00:39
371000 -- (-410.877) [-412.577] (-409.344) (-411.245) * [-411.477] (-414.148) (-413.257) (-411.182) -- 0:00:38
371500 -- (-411.366) [-411.801] (-412.308) (-411.348) * [-409.993] (-409.800) (-412.129) (-410.486) -- 0:00:38
372000 -- [-412.920] (-409.694) (-411.586) (-410.948) * (-409.364) (-409.652) [-417.346] (-409.022) -- 0:00:38
372500 -- (-411.488) (-410.434) [-411.065] (-412.224) * (-410.114) (-412.129) (-412.748) [-410.061] -- 0:00:38
373000 -- [-409.635] (-414.163) (-412.450) (-410.216) * [-411.645] (-411.008) (-413.405) (-411.308) -- 0:00:38
373500 -- (-409.099) (-411.090) (-416.325) [-409.778] * [-410.832] (-415.150) (-414.958) (-411.473) -- 0:00:38
374000 -- (-410.406) (-412.548) (-411.394) [-410.102] * (-409.749) (-417.013) (-413.079) [-409.737] -- 0:00:38
374500 -- [-411.824] (-410.125) (-411.840) (-410.322) * (-412.633) (-416.054) [-410.369] (-411.580) -- 0:00:38
375000 -- [-413.586] (-415.460) (-411.019) (-410.659) * [-409.002] (-413.723) (-411.259) (-411.287) -- 0:00:38
Average standard deviation of split frequencies: 0.015254
375500 -- [-409.324] (-413.799) (-411.044) (-412.438) * (-410.903) (-408.800) (-412.983) [-410.113] -- 0:00:38
376000 -- (-410.278) (-412.835) (-414.332) [-412.257] * (-411.806) [-411.234] (-414.197) (-411.749) -- 0:00:38
376500 -- [-410.533] (-412.407) (-411.898) (-411.380) * (-409.723) (-411.373) [-409.688] (-410.787) -- 0:00:38
377000 -- (-411.213) [-411.425] (-410.032) (-411.711) * [-409.157] (-410.366) (-411.249) (-412.932) -- 0:00:38
377500 -- (-412.326) [-411.651] (-410.426) (-412.399) * (-410.466) (-409.637) [-409.995] (-412.921) -- 0:00:37
378000 -- [-409.720] (-410.711) (-413.265) (-409.829) * (-413.593) (-411.307) (-409.525) [-411.241] -- 0:00:37
378500 -- (-409.312) [-410.702] (-411.199) (-410.644) * (-410.045) (-410.351) (-409.943) [-410.477] -- 0:00:37
379000 -- [-409.205] (-416.361) (-409.443) (-413.861) * (-411.777) (-410.334) (-411.793) [-410.670] -- 0:00:37
379500 -- [-411.577] (-412.254) (-411.529) (-410.000) * (-409.918) (-411.273) [-411.956] (-411.264) -- 0:00:37
380000 -- (-409.781) [-410.865] (-410.693) (-412.634) * (-408.971) (-410.680) (-410.903) [-410.648] -- 0:00:37
Average standard deviation of split frequencies: 0.014723
380500 -- (-410.558) [-412.800] (-410.678) (-410.395) * [-411.579] (-412.187) (-410.543) (-410.088) -- 0:00:37
381000 -- (-412.078) (-411.007) [-411.982] (-409.383) * (-414.014) (-408.727) [-411.121] (-412.101) -- 0:00:37
381500 -- (-413.883) (-409.957) (-410.573) [-408.692] * (-416.501) (-411.854) [-412.965] (-414.739) -- 0:00:37
382000 -- (-413.923) [-411.520] (-409.737) (-409.637) * (-410.428) (-409.287) (-409.036) [-409.153] -- 0:00:37
382500 -- (-410.638) (-410.200) (-411.501) [-411.258] * (-414.239) [-409.608] (-410.516) (-413.065) -- 0:00:37
383000 -- (-411.998) (-411.206) [-409.940] (-411.401) * (-413.230) (-410.173) (-413.756) [-410.565] -- 0:00:37
383500 -- [-414.867] (-411.826) (-409.853) (-410.141) * (-415.121) [-410.654] (-409.920) (-416.015) -- 0:00:36
384000 -- (-410.498) (-411.733) [-410.673] (-410.744) * (-416.846) (-413.951) [-408.903] (-412.196) -- 0:00:36
384500 -- (-410.205) [-409.583] (-411.287) (-410.703) * [-414.712] (-411.333) (-409.131) (-411.949) -- 0:00:36
385000 -- (-409.902) (-412.314) [-413.686] (-416.823) * (-413.682) [-409.378] (-409.577) (-412.596) -- 0:00:36
Average standard deviation of split frequencies: 0.014248
385500 -- (-409.293) [-413.150] (-412.507) (-412.623) * (-412.511) [-409.520] (-411.933) (-410.983) -- 0:00:36
386000 -- (-411.580) (-413.829) [-412.118] (-411.182) * [-410.947] (-412.241) (-409.695) (-411.391) -- 0:00:38
386500 -- [-409.491] (-414.106) (-411.851) (-408.649) * (-416.680) [-411.004] (-417.935) (-409.902) -- 0:00:38
387000 -- [-409.246] (-413.384) (-410.361) (-412.485) * (-414.357) (-412.643) [-409.912] (-411.139) -- 0:00:38
387500 -- (-409.806) (-409.697) [-409.091] (-411.678) * (-411.691) (-410.727) (-410.053) [-410.729] -- 0:00:37
388000 -- (-411.054) (-413.354) [-410.253] (-413.850) * (-409.879) [-411.154] (-409.266) (-409.790) -- 0:00:37
388500 -- (-411.879) (-409.972) (-414.879) [-410.754] * (-409.844) [-412.347] (-409.068) (-410.011) -- 0:00:37
389000 -- [-409.334] (-418.714) (-410.964) (-409.211) * (-414.260) (-414.956) (-410.206) [-409.907] -- 0:00:37
389500 -- (-409.368) (-415.768) (-409.623) [-412.029] * (-411.215) (-415.853) [-408.905] (-410.996) -- 0:00:37
390000 -- (-413.464) (-409.756) (-410.324) [-410.765] * (-413.225) (-414.968) [-412.641] (-411.467) -- 0:00:37
Average standard deviation of split frequencies: 0.014279
390500 -- (-412.807) (-411.166) (-412.056) [-409.451] * (-411.710) (-412.167) (-409.818) [-409.793] -- 0:00:37
391000 -- (-410.459) (-409.687) [-410.801] (-410.570) * [-410.009] (-414.638) (-411.109) (-411.203) -- 0:00:37
391500 -- (-409.702) [-412.499] (-414.393) (-411.423) * (-411.529) (-410.830) (-410.972) [-409.988] -- 0:00:37
392000 -- (-410.049) [-411.260] (-409.187) (-411.478) * (-409.112) (-410.096) [-409.445] (-409.862) -- 0:00:37
392500 -- (-411.415) [-411.119] (-409.840) (-409.689) * (-411.211) [-410.282] (-409.945) (-411.477) -- 0:00:37
393000 -- [-411.834] (-410.218) (-409.948) (-410.966) * (-409.664) (-409.432) (-412.861) [-410.014] -- 0:00:37
393500 -- (-409.456) [-409.247] (-412.156) (-409.833) * (-415.739) [-410.295] (-413.404) (-409.065) -- 0:00:36
394000 -- [-412.861] (-409.149) (-415.903) (-409.964) * (-412.379) (-412.026) [-409.418] (-416.680) -- 0:00:36
394500 -- (-412.564) (-409.904) (-423.264) [-409.631] * (-416.754) (-412.944) (-408.698) [-411.539] -- 0:00:36
395000 -- [-410.972] (-413.177) (-410.299) (-414.069) * (-410.429) (-412.230) [-409.625] (-408.730) -- 0:00:36
Average standard deviation of split frequencies: 0.014417
395500 -- (-411.676) (-409.812) (-409.155) [-413.283] * (-412.017) (-410.052) [-409.128] (-410.345) -- 0:00:36
396000 -- [-414.452] (-412.331) (-408.993) (-416.375) * (-414.159) (-409.597) (-412.149) [-409.928] -- 0:00:36
396500 -- (-409.979) (-408.941) [-409.117] (-410.462) * (-411.197) (-410.387) (-413.167) [-412.151] -- 0:00:36
397000 -- [-411.339] (-412.353) (-413.170) (-414.859) * [-412.611] (-411.025) (-409.650) (-413.869) -- 0:00:36
397500 -- [-409.921] (-408.606) (-410.985) (-410.054) * [-411.376] (-412.851) (-411.336) (-414.763) -- 0:00:36
398000 -- (-412.263) (-410.491) [-409.324] (-410.918) * [-411.286] (-411.401) (-413.563) (-412.497) -- 0:00:36
398500 -- (-410.726) (-411.319) (-409.537) [-414.155] * [-411.158] (-410.566) (-411.090) (-408.962) -- 0:00:36
399000 -- (-412.078) (-409.809) [-411.309] (-409.259) * (-411.086) (-410.912) [-409.892] (-409.507) -- 0:00:36
399500 -- [-413.722] (-409.304) (-409.664) (-411.870) * (-409.602) (-412.943) [-417.199] (-410.492) -- 0:00:36
400000 -- (-413.543) (-410.930) [-409.730] (-409.946) * (-410.173) (-411.975) [-410.251] (-414.776) -- 0:00:36
Average standard deviation of split frequencies: 0.014053
400500 -- [-412.440] (-409.580) (-411.505) (-412.509) * (-410.626) [-410.727] (-410.248) (-409.783) -- 0:00:35
401000 -- (-411.003) [-408.716] (-411.310) (-409.063) * (-411.912) [-412.012] (-412.532) (-411.022) -- 0:00:35
401500 -- (-410.411) [-410.762] (-411.294) (-409.014) * [-415.671] (-412.197) (-413.136) (-413.013) -- 0:00:35
402000 -- (-411.617) [-415.253] (-409.791) (-410.486) * (-409.525) [-410.506] (-409.915) (-411.382) -- 0:00:35
402500 -- (-409.083) (-419.649) (-409.943) [-409.744] * (-409.219) [-409.345] (-410.614) (-409.504) -- 0:00:37
403000 -- [-411.192] (-413.598) (-409.847) (-409.587) * (-409.706) (-413.828) (-410.910) [-409.877] -- 0:00:37
403500 -- [-410.147] (-408.885) (-409.346) (-412.236) * (-409.936) [-414.360] (-409.783) (-414.764) -- 0:00:36
404000 -- (-408.933) (-413.248) [-410.363] (-412.566) * [-409.509] (-408.707) (-411.360) (-410.158) -- 0:00:36
404500 -- (-411.903) (-416.461) [-409.725] (-409.569) * (-408.894) (-409.150) (-408.803) [-410.639] -- 0:00:36
405000 -- [-411.813] (-409.458) (-410.003) (-411.647) * [-409.603] (-410.413) (-409.445) (-410.876) -- 0:00:36
Average standard deviation of split frequencies: 0.014062
405500 -- (-408.866) (-409.824) (-410.098) [-409.122] * (-411.813) (-410.897) (-410.418) [-411.557] -- 0:00:36
406000 -- (-408.930) (-409.930) [-413.062] (-409.728) * (-411.802) (-411.157) (-411.379) [-410.772] -- 0:00:36
406500 -- [-411.405] (-409.450) (-413.111) (-409.244) * (-416.366) (-410.764) [-409.049] (-412.291) -- 0:00:36
407000 -- [-409.407] (-409.744) (-410.166) (-411.156) * (-411.434) [-412.576] (-410.376) (-412.875) -- 0:00:36
407500 -- (-410.846) (-413.437) [-411.952] (-410.695) * (-411.522) (-410.781) (-414.412) [-410.178] -- 0:00:36
408000 -- [-408.748] (-413.855) (-409.472) (-409.958) * (-413.413) [-411.992] (-415.898) (-410.092) -- 0:00:36
408500 -- [-412.512] (-409.666) (-409.611) (-409.983) * [-411.311] (-410.424) (-416.951) (-410.070) -- 0:00:36
409000 -- (-412.610) (-410.624) (-410.526) [-410.649] * (-408.821) (-415.357) [-413.834] (-408.829) -- 0:00:36
409500 -- (-410.927) [-411.017] (-409.406) (-411.977) * [-412.066] (-411.525) (-412.469) (-409.557) -- 0:00:36
410000 -- (-413.910) [-411.579] (-414.633) (-411.400) * (-413.145) (-417.742) (-408.926) [-410.595] -- 0:00:35
Average standard deviation of split frequencies: 0.013839
410500 -- (-410.890) (-411.618) (-409.129) [-410.939] * (-414.099) (-410.368) (-411.668) [-410.010] -- 0:00:35
411000 -- (-412.623) (-412.132) [-411.322] (-412.078) * (-409.603) (-414.075) (-410.689) [-409.189] -- 0:00:35
411500 -- [-412.826] (-411.820) (-411.269) (-410.476) * [-409.549] (-409.787) (-411.645) (-410.100) -- 0:00:35
412000 -- (-410.116) [-409.314] (-409.588) (-411.562) * [-409.083] (-414.297) (-409.458) (-411.976) -- 0:00:35
412500 -- (-410.164) (-410.239) (-408.721) [-410.802] * (-410.802) (-411.844) (-409.829) [-410.032] -- 0:00:35
413000 -- (-410.509) (-410.081) (-410.466) [-411.163] * (-410.082) (-409.224) (-409.159) [-409.928] -- 0:00:35
413500 -- [-409.001] (-416.931) (-411.191) (-409.198) * (-410.503) (-413.607) [-413.468] (-409.835) -- 0:00:35
414000 -- (-410.980) (-410.872) (-408.900) [-409.690] * (-416.337) (-409.556) [-412.364] (-411.438) -- 0:00:35
414500 -- (-409.578) (-413.239) (-408.717) [-411.120] * (-410.425) (-409.711) [-416.413] (-410.286) -- 0:00:35
415000 -- [-409.090] (-413.061) (-413.372) (-410.379) * (-410.674) (-412.788) [-410.985] (-414.179) -- 0:00:35
Average standard deviation of split frequencies: 0.014165
415500 -- (-408.951) [-410.984] (-410.104) (-409.860) * (-411.305) (-409.604) [-411.187] (-416.383) -- 0:00:35
416000 -- [-411.416] (-412.012) (-410.766) (-409.704) * (-410.589) (-411.283) (-410.455) [-409.140] -- 0:00:35
416500 -- (-410.083) (-410.738) [-409.634] (-410.048) * (-419.820) (-411.224) [-414.608] (-410.887) -- 0:00:35
417000 -- (-408.891) (-410.215) (-412.630) [-410.864] * [-412.341] (-410.172) (-408.908) (-410.454) -- 0:00:34
417500 -- (-409.123) [-411.117] (-412.111) (-411.388) * (-417.396) [-412.904] (-415.951) (-411.309) -- 0:00:34
418000 -- (-410.354) (-414.327) [-411.699] (-412.490) * (-411.416) [-414.428] (-415.959) (-411.865) -- 0:00:34
418500 -- [-410.412] (-410.778) (-411.700) (-412.072) * (-411.289) [-414.061] (-410.749) (-412.507) -- 0:00:34
419000 -- (-412.488) [-411.137] (-412.781) (-411.787) * [-410.472] (-411.101) (-413.022) (-418.002) -- 0:00:34
419500 -- (-410.718) (-411.429) (-411.893) [-411.213] * (-410.943) (-412.429) (-409.892) [-413.435] -- 0:00:34
420000 -- [-411.957] (-410.673) (-411.690) (-411.541) * (-409.783) [-409.370] (-410.886) (-411.871) -- 0:00:35
Average standard deviation of split frequencies: 0.014506
420500 -- (-411.133) (-409.754) (-411.575) [-411.557] * [-411.254] (-409.104) (-410.213) (-410.334) -- 0:00:35
421000 -- (-411.313) (-411.338) [-412.908] (-411.233) * (-412.759) (-409.104) (-412.440) [-412.004] -- 0:00:35
421500 -- (-412.591) (-410.296) [-413.899] (-414.081) * (-412.284) [-409.710] (-411.423) (-413.265) -- 0:00:35
422000 -- (-410.532) [-414.670] (-410.768) (-410.842) * (-411.544) (-411.657) (-411.171) [-410.728] -- 0:00:35
422500 -- (-410.910) [-410.238] (-409.772) (-409.042) * (-412.904) (-409.717) [-412.030] (-411.998) -- 0:00:35
423000 -- (-409.249) (-409.887) (-410.492) [-409.842] * (-411.952) [-410.586] (-410.183) (-410.366) -- 0:00:35
423500 -- [-409.457] (-409.876) (-411.042) (-409.510) * (-409.424) (-410.336) [-411.460] (-413.687) -- 0:00:35
424000 -- (-408.947) [-410.439] (-410.885) (-412.587) * (-410.569) [-409.770] (-409.877) (-411.745) -- 0:00:35
424500 -- (-409.695) (-408.462) (-411.759) [-409.730] * [-410.084] (-409.926) (-409.321) (-412.071) -- 0:00:35
425000 -- (-409.153) (-408.540) [-412.533] (-415.117) * (-415.153) (-414.359) [-415.324] (-408.888) -- 0:00:35
Average standard deviation of split frequencies: 0.013525
425500 -- (-410.662) (-413.219) (-411.498) [-413.022] * (-410.982) (-413.489) [-413.155] (-411.272) -- 0:00:35
426000 -- [-410.041] (-410.738) (-410.841) (-411.158) * (-411.925) [-413.276] (-413.354) (-410.739) -- 0:00:35
426500 -- [-411.606] (-410.395) (-411.692) (-413.344) * (-410.462) (-412.996) [-413.052] (-414.759) -- 0:00:34
427000 -- (-409.441) (-411.261) [-408.906] (-411.245) * (-412.965) (-412.757) [-412.934] (-415.226) -- 0:00:34
427500 -- [-410.253] (-409.826) (-412.522) (-415.246) * (-408.724) (-416.161) [-410.699] (-410.946) -- 0:00:34
428000 -- [-410.137] (-409.096) (-410.205) (-409.394) * (-408.866) (-413.468) (-411.376) [-412.499] -- 0:00:34
428500 -- [-409.971] (-413.800) (-413.192) (-413.065) * (-410.090) (-412.655) [-412.209] (-411.391) -- 0:00:34
429000 -- (-413.196) [-411.983] (-409.550) (-409.777) * (-409.458) (-412.897) [-408.802] (-411.908) -- 0:00:34
429500 -- (-409.576) (-413.142) [-410.147] (-409.318) * (-411.227) (-410.331) [-410.357] (-411.640) -- 0:00:34
430000 -- (-411.208) (-410.875) [-410.582] (-416.899) * (-409.014) (-414.016) [-410.244] (-418.352) -- 0:00:34
Average standard deviation of split frequencies: 0.013318
430500 -- [-411.592] (-413.056) (-409.393) (-413.969) * [-410.658] (-412.962) (-411.391) (-419.672) -- 0:00:34
431000 -- [-411.401] (-408.722) (-411.626) (-413.277) * (-412.013) (-410.893) [-410.458] (-411.503) -- 0:00:34
431500 -- [-411.358] (-409.117) (-419.967) (-410.836) * (-409.240) [-409.745] (-409.148) (-411.317) -- 0:00:34
432000 -- (-412.325) (-409.560) [-412.471] (-410.621) * (-410.300) (-410.369) [-409.797] (-409.647) -- 0:00:34
432500 -- [-408.659] (-411.406) (-410.105) (-412.820) * [-409.466] (-411.983) (-412.908) (-412.542) -- 0:00:34
433000 -- [-410.540] (-411.868) (-409.637) (-411.658) * [-412.075] (-413.642) (-416.652) (-411.396) -- 0:00:34
433500 -- [-408.862] (-410.850) (-414.196) (-411.623) * (-412.224) [-412.748] (-410.415) (-413.480) -- 0:00:33
434000 -- (-411.450) (-411.695) [-414.212] (-412.243) * (-411.385) (-409.215) [-408.960] (-413.080) -- 0:00:33
434500 -- (-411.731) [-409.637] (-412.524) (-412.073) * (-411.473) [-412.170] (-411.899) (-411.820) -- 0:00:33
435000 -- (-410.313) [-410.245] (-409.322) (-408.902) * [-410.967] (-410.596) (-411.900) (-410.199) -- 0:00:33
Average standard deviation of split frequencies: 0.013035
435500 -- (-410.691) [-409.586] (-409.409) (-410.997) * (-413.046) (-409.224) (-409.146) [-410.766] -- 0:00:33
436000 -- (-411.247) (-411.119) (-410.129) [-409.952] * (-411.244) (-413.073) [-409.545] (-408.875) -- 0:00:33
436500 -- [-408.903] (-410.516) (-411.279) (-416.547) * [-409.430] (-409.467) (-411.116) (-412.654) -- 0:00:33
437000 -- (-410.899) (-414.408) [-411.460] (-413.776) * (-414.211) [-410.860] (-408.721) (-413.734) -- 0:00:34
437500 -- (-409.294) [-409.606] (-409.680) (-410.479) * [-415.045] (-410.090) (-408.978) (-410.902) -- 0:00:34
438000 -- [-410.491] (-409.830) (-412.141) (-409.520) * [-413.982] (-412.639) (-411.488) (-414.221) -- 0:00:34
438500 -- (-412.286) (-414.358) [-410.245] (-409.666) * [-410.573] (-411.787) (-408.892) (-412.741) -- 0:00:34
439000 -- (-409.291) (-412.501) (-412.396) [-414.077] * (-412.229) (-417.163) [-411.033] (-413.145) -- 0:00:34
439500 -- (-411.547) (-409.335) (-410.444) [-409.512] * (-411.253) (-413.701) [-409.827] (-413.810) -- 0:00:34
440000 -- (-413.609) (-413.135) (-410.316) [-411.763] * (-410.072) (-412.115) [-410.132] (-409.669) -- 0:00:34
Average standard deviation of split frequencies: 0.013592
440500 -- (-411.657) (-409.390) (-416.760) [-411.955] * (-409.693) (-414.454) (-412.822) [-409.623] -- 0:00:34
441000 -- [-408.910] (-411.663) (-413.472) (-409.511) * (-411.959) (-409.529) (-409.781) [-409.957] -- 0:00:34
441500 -- [-414.963] (-409.699) (-418.675) (-410.763) * (-409.209) (-409.133) (-410.883) [-410.127] -- 0:00:34
442000 -- (-409.066) (-411.524) [-411.461] (-412.106) * [-409.509] (-411.245) (-415.388) (-413.781) -- 0:00:34
442500 -- (-411.487) [-410.744] (-412.268) (-411.285) * (-418.753) [-409.215] (-416.120) (-411.415) -- 0:00:34
443000 -- (-409.594) (-409.734) [-412.522] (-410.386) * [-411.557] (-409.658) (-409.355) (-410.023) -- 0:00:33
443500 -- [-410.810] (-409.223) (-412.745) (-409.241) * (-410.146) (-409.021) [-411.314] (-410.877) -- 0:00:33
444000 -- (-411.756) [-410.089] (-411.060) (-411.558) * (-410.582) (-410.142) (-411.738) [-409.702] -- 0:00:33
444500 -- [-410.159] (-410.078) (-409.478) (-411.982) * [-409.261] (-410.895) (-410.471) (-410.818) -- 0:00:33
445000 -- (-412.362) [-411.408] (-410.106) (-409.787) * (-409.617) (-409.543) [-414.475] (-409.564) -- 0:00:33
Average standard deviation of split frequencies: 0.013367
445500 -- [-413.306] (-413.623) (-409.109) (-410.544) * [-409.772] (-410.407) (-414.362) (-411.196) -- 0:00:33
446000 -- (-409.634) [-409.037] (-413.585) (-412.084) * (-409.904) [-409.829] (-414.187) (-410.384) -- 0:00:33
446500 -- (-416.900) [-412.066] (-412.194) (-409.122) * (-410.566) (-411.852) (-416.057) [-412.310] -- 0:00:33
447000 -- (-409.403) [-411.171] (-410.535) (-411.478) * (-418.037) (-413.560) (-411.953) [-409.066] -- 0:00:33
447500 -- (-409.977) (-414.158) (-410.812) [-411.130] * (-411.490) (-409.228) [-410.939] (-413.061) -- 0:00:33
448000 -- (-410.327) [-410.811] (-412.595) (-409.789) * [-413.334] (-413.814) (-413.346) (-411.421) -- 0:00:33
448500 -- (-414.575) [-412.129] (-411.781) (-413.967) * (-412.673) (-409.319) [-410.516] (-410.518) -- 0:00:33
449000 -- (-415.863) (-409.243) (-413.115) [-409.637] * (-411.811) (-409.891) [-410.747] (-409.926) -- 0:00:33
449500 -- [-409.563] (-408.976) (-411.400) (-409.621) * (-413.347) (-410.354) [-410.262] (-410.540) -- 0:00:33
450000 -- [-410.446] (-409.218) (-411.561) (-409.553) * (-409.938) (-409.683) (-409.640) [-411.295] -- 0:00:33
Average standard deviation of split frequencies: 0.012798
450500 -- (-411.343) [-409.853] (-411.881) (-410.549) * (-410.804) (-409.119) (-411.173) [-411.718] -- 0:00:32
451000 -- (-408.711) (-411.865) [-411.255] (-412.082) * (-411.418) (-410.140) (-413.157) [-412.878] -- 0:00:32
451500 -- [-410.009] (-409.077) (-411.997) (-409.782) * (-412.665) (-412.046) (-415.945) [-412.895] -- 0:00:32
452000 -- [-409.315] (-410.828) (-408.961) (-411.417) * (-410.495) (-409.951) [-410.007] (-409.311) -- 0:00:32
452500 -- (-410.195) (-409.807) [-410.742] (-412.611) * (-409.190) (-410.265) (-410.257) [-408.860] -- 0:00:32
453000 -- (-413.287) (-409.181) (-418.722) [-412.858] * (-411.055) [-408.926] (-411.497) (-409.473) -- 0:00:32
453500 -- (-408.943) (-411.105) (-410.948) [-410.239] * (-411.225) (-409.392) (-410.361) [-409.359] -- 0:00:32
454000 -- (-409.419) [-411.727] (-411.902) (-409.112) * (-411.078) (-409.251) (-412.557) [-413.312] -- 0:00:33
454500 -- [-409.575] (-411.621) (-414.885) (-410.362) * (-412.429) (-410.419) (-410.580) [-409.537] -- 0:00:33
455000 -- (-412.282) (-412.267) (-410.872) [-409.137] * (-410.357) (-409.377) [-411.178] (-412.345) -- 0:00:33
Average standard deviation of split frequencies: 0.012041
455500 -- (-409.685) (-414.103) [-409.256] (-410.771) * (-409.880) [-409.517] (-410.598) (-410.967) -- 0:00:33
456000 -- (-411.348) (-417.784) [-411.300] (-410.644) * [-414.131] (-413.255) (-414.680) (-412.711) -- 0:00:33
456500 -- [-409.457] (-411.097) (-410.995) (-411.949) * (-411.538) (-411.185) [-409.840] (-410.333) -- 0:00:33
457000 -- [-409.332] (-411.215) (-409.921) (-409.809) * [-415.068] (-415.626) (-410.247) (-412.306) -- 0:00:33
457500 -- (-409.645) (-412.156) [-410.266] (-409.771) * (-414.915) [-411.171] (-411.388) (-412.060) -- 0:00:33
458000 -- (-410.060) (-411.151) [-409.338] (-413.782) * [-412.484] (-409.155) (-411.388) (-410.845) -- 0:00:33
458500 -- (-411.443) (-411.087) [-409.325] (-409.459) * (-410.094) (-411.073) [-414.646] (-415.198) -- 0:00:33
459000 -- [-410.779] (-413.551) (-410.183) (-409.611) * (-413.503) (-409.554) (-420.104) [-411.097] -- 0:00:33
459500 -- (-411.626) [-411.693] (-411.250) (-413.076) * (-418.584) [-411.119] (-416.931) (-413.676) -- 0:00:32
460000 -- (-412.198) (-409.929) [-410.811] (-409.758) * [-409.529] (-410.432) (-413.405) (-410.167) -- 0:00:32
Average standard deviation of split frequencies: 0.012408
460500 -- (-409.511) [-412.214] (-410.807) (-410.712) * (-409.111) (-410.162) (-413.875) [-411.253] -- 0:00:32
461000 -- (-412.362) (-410.673) [-411.217] (-414.306) * (-412.751) (-411.915) [-409.203] (-410.550) -- 0:00:32
461500 -- [-410.934] (-411.757) (-413.341) (-411.736) * [-411.107] (-414.213) (-411.096) (-408.953) -- 0:00:32
462000 -- (-412.394) [-409.971] (-410.472) (-409.908) * (-412.055) (-415.704) (-412.012) [-409.525] -- 0:00:32
462500 -- [-411.559] (-413.509) (-411.420) (-410.234) * (-409.480) (-413.445) (-410.496) [-412.235] -- 0:00:32
463000 -- (-413.407) (-410.005) (-411.369) [-410.808] * (-412.570) (-411.460) [-411.801] (-411.698) -- 0:00:32
463500 -- (-410.267) [-409.047] (-410.002) (-411.307) * (-411.527) (-408.966) [-411.185] (-412.425) -- 0:00:32
464000 -- (-410.643) [-410.175] (-411.850) (-416.815) * (-411.524) [-413.852] (-409.767) (-410.698) -- 0:00:32
464500 -- (-410.417) [-411.253] (-409.898) (-413.376) * (-409.961) (-412.408) [-409.631] (-410.158) -- 0:00:32
465000 -- (-412.912) (-410.716) [-409.441] (-410.024) * [-411.276] (-413.560) (-411.993) (-410.184) -- 0:00:32
Average standard deviation of split frequencies: 0.012392
465500 -- (-409.645) (-410.768) (-416.168) [-409.791] * (-409.620) (-411.298) [-409.338] (-414.742) -- 0:00:32
466000 -- (-410.045) (-414.156) [-410.426] (-411.429) * [-409.867] (-410.266) (-410.480) (-414.290) -- 0:00:32
466500 -- (-410.092) [-411.518] (-410.398) (-409.683) * (-412.221) (-410.886) (-409.611) [-413.914] -- 0:00:32
467000 -- (-415.934) (-412.274) [-409.290] (-410.786) * [-409.493] (-413.371) (-410.155) (-412.430) -- 0:00:31
467500 -- [-409.626] (-409.495) (-410.031) (-413.641) * (-414.651) [-412.881] (-410.250) (-414.413) -- 0:00:31
468000 -- (-410.787) [-410.278] (-409.055) (-408.967) * (-413.826) [-413.184] (-409.905) (-411.138) -- 0:00:31
468500 -- [-409.618] (-409.498) (-410.572) (-413.436) * [-409.968] (-414.891) (-410.569) (-415.627) -- 0:00:31
469000 -- (-411.533) (-409.494) (-411.477) [-409.702] * (-409.621) (-411.055) (-410.169) [-410.315] -- 0:00:31
469500 -- (-413.460) [-410.784] (-410.979) (-414.744) * (-412.447) (-412.445) [-410.987] (-412.279) -- 0:00:31
470000 -- [-412.383] (-408.833) (-410.506) (-413.611) * (-410.652) (-412.924) (-412.162) [-409.955] -- 0:00:31
Average standard deviation of split frequencies: 0.011643
470500 -- (-412.302) (-410.967) (-412.540) [-412.773] * (-412.207) [-410.004] (-411.605) (-412.095) -- 0:00:31
471000 -- (-411.671) (-409.328) (-410.360) [-411.325] * (-410.137) [-410.623] (-414.840) (-410.007) -- 0:00:32
471500 -- (-409.954) (-409.915) [-408.930] (-414.017) * (-416.912) (-413.674) [-410.132] (-409.378) -- 0:00:32
472000 -- [-409.306] (-411.278) (-413.906) (-411.285) * (-415.095) [-410.658] (-409.307) (-411.864) -- 0:00:32
472500 -- [-411.426] (-410.658) (-416.256) (-411.597) * (-413.418) [-415.883] (-413.823) (-410.704) -- 0:00:32
473000 -- [-412.695] (-410.538) (-409.282) (-411.764) * (-413.933) (-410.810) [-411.467] (-412.214) -- 0:00:32
473500 -- (-408.881) (-410.549) (-408.810) [-411.108] * (-413.338) (-409.336) (-409.183) [-410.921] -- 0:00:32
474000 -- (-412.323) (-410.453) [-412.511] (-411.799) * (-410.162) (-413.575) [-409.940] (-411.020) -- 0:00:32
474500 -- [-410.080] (-412.111) (-410.014) (-411.151) * (-410.615) (-414.315) [-411.055] (-416.285) -- 0:00:32
475000 -- [-409.493] (-410.679) (-411.979) (-412.685) * (-410.792) (-412.236) (-409.098) [-411.436] -- 0:00:32
Average standard deviation of split frequencies: 0.011637
475500 -- (-410.953) [-411.993] (-413.068) (-411.405) * (-414.853) [-412.863] (-409.989) (-410.957) -- 0:00:31
476000 -- (-412.778) (-410.156) (-409.907) [-411.482] * [-412.232] (-411.281) (-410.426) (-410.780) -- 0:00:31
476500 -- [-409.264] (-409.539) (-411.565) (-415.893) * (-412.246) [-412.457] (-410.147) (-408.955) -- 0:00:31
477000 -- [-411.266] (-411.265) (-415.089) (-413.156) * (-411.130) (-417.018) (-410.659) [-411.366] -- 0:00:31
477500 -- (-413.545) (-411.820) (-409.047) [-410.992] * [-410.647] (-412.250) (-409.456) (-410.297) -- 0:00:31
478000 -- (-411.995) (-411.587) (-409.077) [-411.459] * (-409.365) [-412.927] (-414.164) (-412.405) -- 0:00:31
478500 -- (-411.066) (-410.832) (-409.078) [-409.856] * (-409.908) (-411.258) (-410.193) [-410.374] -- 0:00:31
479000 -- (-409.950) (-410.433) [-412.089] (-412.709) * (-411.951) (-409.963) (-411.962) [-411.023] -- 0:00:31
479500 -- (-413.813) [-410.254] (-412.275) (-411.250) * (-411.617) (-411.441) [-410.517] (-413.478) -- 0:00:31
480000 -- (-416.846) (-410.970) (-409.680) [-412.322] * (-411.312) (-411.274) (-409.091) [-409.759] -- 0:00:31
Average standard deviation of split frequencies: 0.011462
480500 -- (-414.362) (-411.412) (-410.734) [-409.587] * (-410.283) (-412.330) (-410.085) [-409.778] -- 0:00:31
481000 -- (-412.893) (-410.677) (-411.313) [-410.011] * (-410.895) (-413.970) [-408.703] (-409.293) -- 0:00:31
481500 -- (-410.336) [-410.582] (-413.108) (-409.496) * [-410.536] (-412.312) (-409.644) (-410.871) -- 0:00:31
482000 -- [-409.524] (-411.624) (-410.842) (-411.558) * (-412.133) (-409.713) (-413.250) [-409.213] -- 0:00:31
482500 -- (-411.573) [-410.158] (-410.995) (-409.692) * (-409.797) [-408.785] (-413.460) (-410.682) -- 0:00:31
483000 -- (-410.472) (-409.374) (-412.544) [-413.692] * (-411.574) (-409.357) (-411.210) [-411.307] -- 0:00:31
483500 -- (-410.806) (-410.497) [-412.500] (-413.036) * (-412.978) (-409.853) (-411.704) [-410.091] -- 0:00:30
484000 -- (-411.608) (-413.618) [-410.050] (-409.808) * [-411.156] (-413.990) (-411.532) (-412.781) -- 0:00:30
484500 -- (-410.297) [-413.435] (-413.144) (-410.255) * (-412.109) (-413.494) (-417.160) [-409.341] -- 0:00:30
485000 -- [-409.451] (-410.256) (-412.780) (-411.414) * (-411.093) (-410.301) (-410.241) [-411.769] -- 0:00:30
Average standard deviation of split frequencies: 0.011094
485500 -- (-413.451) (-409.572) [-411.717] (-409.590) * (-409.426) (-410.248) [-410.748] (-410.408) -- 0:00:30
486000 -- (-411.140) [-411.596] (-410.683) (-410.212) * (-408.949) [-410.707] (-412.186) (-410.238) -- 0:00:30
486500 -- (-410.599) (-410.306) (-410.308) [-409.540] * (-414.033) (-409.078) [-411.147] (-412.364) -- 0:00:30
487000 -- (-409.421) (-409.244) [-412.301] (-409.253) * (-412.975) [-410.156] (-412.632) (-413.297) -- 0:00:30
487500 -- (-414.334) [-409.617] (-412.519) (-409.554) * [-412.412] (-412.508) (-412.350) (-410.141) -- 0:00:30
488000 -- (-412.727) (-409.959) [-411.493] (-412.450) * (-412.539) (-410.722) [-414.860] (-412.705) -- 0:00:31
488500 -- (-416.709) (-413.431) (-411.769) [-410.031] * (-410.121) (-409.855) [-410.083] (-409.874) -- 0:00:31
489000 -- (-412.130) [-409.840] (-409.968) (-408.974) * [-409.299] (-408.652) (-409.266) (-411.808) -- 0:00:31
489500 -- [-410.080] (-410.895) (-410.068) (-410.146) * (-410.773) (-408.819) [-411.368] (-410.257) -- 0:00:31
490000 -- (-415.953) (-408.906) (-412.958) [-410.597] * [-411.537] (-411.022) (-411.679) (-411.406) -- 0:00:31
Average standard deviation of split frequencies: 0.010748
490500 -- [-416.717] (-411.701) (-414.019) (-409.212) * (-408.531) (-411.999) [-409.017] (-412.665) -- 0:00:31
491000 -- (-410.887) (-410.248) [-409.135] (-409.351) * (-408.824) (-410.876) [-409.809] (-410.471) -- 0:00:31
491500 -- [-409.891] (-412.495) (-410.631) (-412.074) * [-410.301] (-412.240) (-410.428) (-411.178) -- 0:00:31
492000 -- (-411.057) [-412.763] (-409.351) (-411.060) * (-409.735) (-412.517) (-412.681) [-412.654] -- 0:00:30
492500 -- (-411.228) (-410.597) [-410.610] (-411.125) * [-409.805] (-412.792) (-410.701) (-412.459) -- 0:00:30
493000 -- [-410.123] (-412.662) (-410.121) (-412.120) * (-413.652) (-410.434) (-411.270) [-411.922] -- 0:00:30
493500 -- (-409.910) (-411.209) (-409.832) [-409.983] * [-410.715] (-413.740) (-409.848) (-412.118) -- 0:00:30
494000 -- (-410.477) (-410.384) (-409.073) [-410.224] * (-410.182) [-409.300] (-412.725) (-409.964) -- 0:00:30
494500 -- (-409.687) (-412.545) [-409.444] (-408.932) * (-411.554) [-416.157] (-410.162) (-410.737) -- 0:00:30
495000 -- (-408.881) (-411.635) (-411.606) [-414.604] * (-409.625) (-412.017) (-408.953) [-412.851] -- 0:00:30
Average standard deviation of split frequencies: 0.009979
495500 -- (-410.117) [-410.519] (-409.849) (-411.694) * (-412.187) (-416.071) (-409.050) [-413.790] -- 0:00:30
496000 -- (-409.970) (-409.730) [-410.900] (-411.242) * (-413.762) (-414.693) (-418.397) [-411.020] -- 0:00:30
496500 -- [-410.232] (-411.160) (-410.589) (-409.479) * [-409.446] (-409.268) (-413.387) (-410.897) -- 0:00:30
497000 -- (-412.983) (-409.764) (-410.132) [-409.131] * (-409.592) [-408.965] (-413.055) (-410.628) -- 0:00:30
497500 -- (-410.745) [-411.535] (-411.783) (-409.662) * (-413.874) (-409.566) [-410.603] (-411.487) -- 0:00:30
498000 -- (-410.039) [-409.873] (-409.897) (-412.703) * (-410.070) (-410.859) (-410.300) [-409.361] -- 0:00:30
498500 -- (-410.711) [-408.841] (-409.011) (-412.079) * (-410.130) (-409.772) [-410.066] (-410.109) -- 0:00:30
499000 -- (-410.644) (-409.445) [-408.976] (-412.329) * (-411.088) (-419.533) [-409.467] (-409.077) -- 0:00:30
499500 -- [-410.689] (-412.627) (-413.500) (-410.441) * (-410.722) (-414.837) [-410.562] (-411.545) -- 0:00:30
500000 -- (-414.759) (-415.703) (-409.691) [-414.888] * [-410.928] (-410.773) (-409.067) (-409.326) -- 0:00:30
Average standard deviation of split frequencies: 0.009298
500500 -- [-414.721] (-417.249) (-409.559) (-409.065) * (-408.925) (-412.846) [-409.577] (-414.953) -- 0:00:29
501000 -- [-410.670] (-414.330) (-409.917) (-409.989) * (-410.744) (-413.789) [-410.124] (-411.871) -- 0:00:29
501500 -- (-409.543) [-411.286] (-408.941) (-412.654) * (-410.554) (-411.560) (-410.777) [-410.985] -- 0:00:29
502000 -- (-409.615) (-410.019) [-410.995] (-411.187) * [-410.697] (-411.083) (-416.812) (-409.655) -- 0:00:29
502500 -- (-410.714) [-409.680] (-412.170) (-409.364) * (-411.018) [-410.444] (-410.806) (-412.400) -- 0:00:29
503000 -- (-408.823) (-409.886) (-410.904) [-410.135] * [-410.434] (-411.102) (-411.469) (-411.381) -- 0:00:29
503500 -- (-410.608) (-409.649) (-409.655) [-410.292] * [-412.390] (-411.306) (-410.347) (-409.075) -- 0:00:29
504000 -- (-410.425) (-409.674) (-410.613) [-409.013] * (-409.004) (-409.136) (-412.412) [-408.916] -- 0:00:29
504500 -- (-409.931) [-409.572] (-411.681) (-409.253) * [-409.834] (-410.399) (-410.299) (-413.424) -- 0:00:30
505000 -- [-411.018] (-412.342) (-410.087) (-410.247) * (-410.170) (-409.745) [-411.648] (-410.220) -- 0:00:30
Average standard deviation of split frequencies: 0.009491
505500 -- (-411.664) [-412.112] (-410.465) (-410.096) * (-409.516) (-409.511) (-412.520) [-409.060] -- 0:00:30
506000 -- [-411.624] (-412.577) (-409.044) (-410.948) * (-411.649) (-412.588) [-411.216] (-409.231) -- 0:00:30
506500 -- (-412.563) (-412.839) (-408.941) [-410.138] * [-410.754] (-413.410) (-418.245) (-411.182) -- 0:00:30
507000 -- (-411.291) [-411.204] (-412.469) (-412.763) * (-414.317) (-412.254) [-414.941] (-411.560) -- 0:00:30
507500 -- (-411.456) (-411.894) (-412.213) [-410.741] * (-410.570) (-410.882) (-413.226) [-412.942] -- 0:00:30
508000 -- (-409.055) (-416.569) (-409.233) [-411.763] * (-409.202) [-410.400] (-413.205) (-409.564) -- 0:00:30
508500 -- (-413.650) (-410.245) (-412.781) [-409.806] * [-408.986] (-411.263) (-412.344) (-414.380) -- 0:00:29
509000 -- (-411.733) [-412.080] (-413.018) (-411.569) * (-409.237) [-412.547] (-415.566) (-408.831) -- 0:00:29
509500 -- (-412.149) [-411.280] (-412.826) (-417.507) * [-409.013] (-411.552) (-411.906) (-412.429) -- 0:00:29
510000 -- (-412.770) (-408.906) (-412.425) [-413.603] * [-408.939] (-411.559) (-410.068) (-410.163) -- 0:00:29
Average standard deviation of split frequencies: 0.009404
510500 -- (-413.410) (-409.564) (-412.010) [-410.893] * [-416.867] (-410.378) (-410.387) (-410.552) -- 0:00:29
511000 -- (-412.057) (-412.527) (-412.764) [-409.942] * [-415.018] (-410.351) (-415.413) (-414.761) -- 0:00:29
511500 -- (-411.189) [-412.998] (-413.423) (-410.045) * [-409.979] (-410.042) (-410.696) (-409.262) -- 0:00:29
512000 -- (-409.584) (-410.590) (-409.876) [-409.941] * [-411.154] (-412.806) (-409.512) (-412.072) -- 0:00:29
512500 -- (-410.112) (-411.176) (-411.412) [-413.230] * (-409.328) (-409.388) (-414.395) [-409.728] -- 0:00:29
513000 -- [-410.885] (-409.580) (-411.132) (-416.655) * (-409.264) [-409.115] (-415.350) (-410.844) -- 0:00:29
513500 -- (-417.054) (-409.329) [-411.996] (-412.858) * (-410.804) [-412.148] (-415.094) (-414.914) -- 0:00:29
514000 -- (-424.597) (-410.821) [-410.565] (-409.685) * (-423.530) (-411.940) (-415.317) [-414.023] -- 0:00:29
514500 -- [-409.884] (-412.447) (-410.037) (-410.760) * (-412.992) [-412.798] (-408.848) (-413.707) -- 0:00:29
515000 -- (-410.350) (-410.566) (-411.659) [-410.291] * (-410.756) (-416.789) (-412.080) [-409.628] -- 0:00:29
Average standard deviation of split frequencies: 0.009764
515500 -- (-411.396) (-411.652) [-410.272] (-410.065) * [-411.306] (-409.935) (-412.986) (-409.946) -- 0:00:29
516000 -- (-411.642) [-408.868] (-410.806) (-412.587) * (-412.314) (-411.597) (-414.872) [-408.689] -- 0:00:29
516500 -- (-412.418) (-413.008) [-409.371] (-409.625) * (-414.373) (-411.385) (-413.928) [-412.511] -- 0:00:29
517000 -- (-410.247) (-413.826) [-412.059] (-410.295) * (-409.421) (-409.768) (-410.714) [-412.442] -- 0:00:28
517500 -- (-409.750) (-416.916) [-409.542] (-412.039) * [-412.192] (-411.571) (-410.250) (-411.254) -- 0:00:28
518000 -- (-413.978) [-409.395] (-408.958) (-410.043) * (-413.244) [-409.128] (-413.426) (-413.054) -- 0:00:28
518500 -- [-409.177] (-410.970) (-409.537) (-410.351) * (-416.776) (-409.983) [-409.404] (-411.640) -- 0:00:28
519000 -- (-412.834) (-413.141) (-410.665) [-411.737] * (-409.660) (-411.439) [-408.939] (-410.020) -- 0:00:28
519500 -- (-412.968) (-412.481) [-410.778] (-411.234) * (-410.844) (-409.076) [-408.823] (-410.628) -- 0:00:28
520000 -- [-409.821] (-411.564) (-408.828) (-410.244) * [-413.197] (-409.656) (-409.061) (-412.254) -- 0:00:28
Average standard deviation of split frequencies: 0.009450
520500 -- (-412.099) [-411.394] (-409.042) (-411.436) * (-411.019) (-412.351) [-409.935] (-414.322) -- 0:00:28
521000 -- (-411.987) [-409.466] (-414.663) (-414.109) * (-410.572) [-409.898] (-410.394) (-413.572) -- 0:00:28
521500 -- [-409.700] (-410.389) (-411.997) (-408.870) * (-409.220) [-410.107] (-413.028) (-409.359) -- 0:00:29
522000 -- (-409.155) (-411.415) (-412.170) [-409.624] * (-411.577) (-410.435) [-410.105] (-410.760) -- 0:00:29
522500 -- [-409.942] (-411.379) (-409.685) (-413.703) * [-408.833] (-412.471) (-409.949) (-409.325) -- 0:00:29
523000 -- (-410.658) (-411.068) (-408.896) [-412.177] * (-408.959) (-412.946) (-411.278) [-410.280] -- 0:00:29
523500 -- (-409.808) (-410.433) [-412.192] (-413.926) * [-413.449] (-412.315) (-414.450) (-409.395) -- 0:00:29
524000 -- (-412.176) (-410.740) (-411.093) [-410.618] * (-410.196) (-409.241) (-411.329) [-411.485] -- 0:00:29
524500 -- [-408.973] (-411.026) (-412.590) (-411.436) * (-411.287) (-410.364) (-411.732) [-414.065] -- 0:00:29
525000 -- (-411.285) (-409.762) [-410.051] (-409.770) * [-411.148] (-411.253) (-411.497) (-412.413) -- 0:00:28
Average standard deviation of split frequencies: 0.009634
525500 -- [-413.849] (-412.727) (-409.481) (-411.079) * (-410.578) [-413.964] (-410.965) (-409.656) -- 0:00:28
526000 -- (-411.416) [-411.510] (-411.210) (-412.412) * (-412.485) [-410.520] (-411.949) (-408.537) -- 0:00:28
526500 -- (-411.652) [-409.695] (-414.004) (-409.916) * (-413.875) (-410.552) [-410.419] (-409.498) -- 0:00:28
527000 -- (-410.775) [-410.178] (-410.797) (-412.106) * (-410.943) [-411.082] (-410.795) (-412.157) -- 0:00:28
527500 -- (-411.168) [-410.964] (-410.522) (-415.514) * (-410.167) (-410.106) [-409.612] (-411.924) -- 0:00:28
528000 -- (-410.415) (-414.036) (-409.681) [-410.939] * (-412.463) (-410.493) [-409.189] (-414.465) -- 0:00:28
528500 -- (-409.705) [-410.191] (-411.040) (-411.643) * (-409.852) [-410.857] (-411.871) (-410.634) -- 0:00:28
529000 -- (-409.953) (-410.065) [-411.824] (-409.889) * [-409.787] (-410.887) (-410.408) (-411.847) -- 0:00:28
529500 -- (-419.524) (-409.389) [-411.365] (-412.848) * (-411.684) (-410.392) [-410.628] (-410.027) -- 0:00:28
530000 -- (-413.687) (-412.607) [-410.497] (-411.913) * (-409.890) [-415.489] (-411.029) (-410.099) -- 0:00:28
Average standard deviation of split frequencies: 0.009605
530500 -- (-409.302) [-408.812] (-410.989) (-408.975) * [-411.272] (-409.524) (-410.252) (-412.700) -- 0:00:28
531000 -- (-412.671) (-412.220) [-411.727] (-409.951) * (-412.908) (-409.283) [-410.003] (-413.499) -- 0:00:28
531500 -- [-412.144] (-413.904) (-409.149) (-412.404) * [-409.311] (-410.387) (-409.851) (-410.589) -- 0:00:28
532000 -- (-411.750) (-408.993) [-413.606] (-409.963) * (-410.750) (-410.027) (-413.558) [-409.955] -- 0:00:28
532500 -- (-410.049) [-410.284] (-415.301) (-409.219) * (-411.563) (-411.630) [-409.232] (-408.991) -- 0:00:28
533000 -- (-410.740) (-410.556) (-415.991) [-410.996] * (-411.368) (-411.456) [-410.169] (-415.257) -- 0:00:28
533500 -- (-409.301) [-411.650] (-410.082) (-410.821) * (-411.139) (-411.161) (-410.788) [-409.999] -- 0:00:27
534000 -- [-410.991] (-410.636) (-411.213) (-412.460) * (-410.479) (-413.102) (-411.028) [-409.630] -- 0:00:27
534500 -- [-409.846] (-410.036) (-410.011) (-413.311) * (-409.634) (-409.489) (-412.850) [-411.000] -- 0:00:27
535000 -- (-413.555) [-409.906] (-412.523) (-411.843) * (-411.475) (-411.637) [-410.210] (-412.185) -- 0:00:27
Average standard deviation of split frequencies: 0.010389
535500 -- [-411.331] (-409.696) (-413.833) (-413.253) * (-414.259) [-409.625] (-409.649) (-414.746) -- 0:00:27
536000 -- (-411.973) (-411.274) [-408.619] (-413.151) * (-414.724) [-409.586] (-410.072) (-411.197) -- 0:00:27
536500 -- (-419.628) [-411.445] (-409.773) (-411.390) * [-412.107] (-410.675) (-411.316) (-410.068) -- 0:00:27
537000 -- [-410.516] (-409.313) (-416.402) (-411.510) * (-409.172) [-410.925] (-410.540) (-412.265) -- 0:00:27
537500 -- (-409.830) (-413.265) [-410.787] (-408.930) * (-412.630) (-410.493) [-409.199] (-412.416) -- 0:00:27
538000 -- (-409.171) (-410.263) (-414.761) [-412.523] * (-409.577) (-412.024) (-411.414) [-411.730] -- 0:00:28
538500 -- (-410.606) [-409.482] (-415.120) (-410.979) * (-409.435) [-411.443] (-409.594) (-410.520) -- 0:00:28
539000 -- (-409.322) (-409.383) (-412.471) [-409.283] * (-410.972) [-412.042] (-414.281) (-409.271) -- 0:00:28
539500 -- (-411.207) (-409.370) (-411.979) [-409.825] * [-410.617] (-409.841) (-413.592) (-409.057) -- 0:00:28
540000 -- (-409.234) (-412.629) [-413.189] (-410.332) * (-409.609) (-413.850) (-411.741) [-410.520] -- 0:00:28
Average standard deviation of split frequencies: 0.010299
540500 -- (-412.044) (-412.048) (-413.611) [-409.106] * (-412.849) [-408.906] (-411.051) (-409.946) -- 0:00:28
541000 -- (-410.708) (-412.664) (-413.673) [-412.691] * (-409.646) (-410.980) (-410.880) [-411.234] -- 0:00:27
541500 -- (-411.759) (-412.913) [-412.341] (-413.250) * [-409.998] (-412.568) (-414.671) (-412.720) -- 0:00:27
542000 -- (-415.518) [-410.136] (-411.253) (-409.370) * (-412.375) (-409.921) (-413.744) [-413.378] -- 0:00:27
542500 -- (-419.410) (-414.576) [-413.233] (-409.998) * (-408.783) (-410.037) (-415.551) [-410.766] -- 0:00:27
543000 -- (-411.275) (-413.618) [-412.944] (-412.798) * (-414.773) (-409.550) [-417.490] (-410.710) -- 0:00:27
543500 -- (-411.293) (-411.054) [-412.902] (-410.197) * (-409.955) [-409.709] (-410.576) (-409.037) -- 0:00:27
544000 -- (-413.489) (-413.802) (-410.409) [-411.733] * (-409.465) [-409.891] (-411.750) (-409.213) -- 0:00:27
544500 -- (-411.215) (-410.901) (-412.393) [-410.997] * [-411.660] (-412.008) (-410.324) (-412.694) -- 0:00:27
545000 -- (-410.226) (-408.738) [-409.874] (-409.696) * (-410.172) [-411.747] (-410.638) (-413.668) -- 0:00:27
Average standard deviation of split frequencies: 0.009875
545500 -- (-412.876) (-415.570) (-409.892) [-411.317] * (-411.931) (-413.597) (-409.745) [-408.652] -- 0:00:27
546000 -- (-409.376) [-411.711] (-410.034) (-412.168) * [-412.233] (-412.072) (-411.193) (-411.902) -- 0:00:27
546500 -- (-409.554) (-414.229) (-412.426) [-410.291] * (-413.989) [-412.897] (-411.657) (-411.409) -- 0:00:27
547000 -- (-412.081) [-409.907] (-409.808) (-412.693) * (-413.109) (-409.644) [-409.645] (-410.691) -- 0:00:27
547500 -- (-411.092) [-409.660] (-413.464) (-410.791) * (-410.799) (-411.916) [-409.560] (-412.354) -- 0:00:27
548000 -- (-410.535) (-409.464) [-416.122] (-409.784) * (-411.398) (-413.280) [-412.889] (-411.501) -- 0:00:27
548500 -- [-410.503] (-412.168) (-413.535) (-411.573) * (-410.448) (-409.223) [-410.845] (-412.709) -- 0:00:27
549000 -- [-410.659] (-411.013) (-411.506) (-409.305) * [-412.297] (-411.283) (-413.425) (-410.725) -- 0:00:27
549500 -- (-411.634) (-408.974) [-412.165] (-409.842) * (-414.794) (-412.064) (-411.342) [-410.933] -- 0:00:27
550000 -- (-410.022) (-408.813) (-412.752) [-409.803] * (-410.088) (-412.382) [-411.275] (-410.215) -- 0:00:27
Average standard deviation of split frequencies: 0.010219
550500 -- (-412.316) (-409.155) (-409.518) [-410.039] * [-409.735] (-410.672) (-410.394) (-411.423) -- 0:00:26
551000 -- (-411.476) (-412.509) [-410.993] (-410.196) * (-409.400) (-409.798) [-410.667] (-409.584) -- 0:00:26
551500 -- [-409.284] (-410.315) (-412.687) (-411.496) * (-409.166) [-410.986] (-410.199) (-417.806) -- 0:00:26
552000 -- [-412.177] (-410.258) (-417.161) (-411.436) * (-409.103) [-409.721] (-411.887) (-416.520) -- 0:00:26
552500 -- (-409.597) (-409.871) [-414.004] (-414.549) * (-409.340) (-409.317) [-411.891] (-412.689) -- 0:00:26
553000 -- (-409.404) (-410.668) [-414.307] (-408.906) * (-413.421) (-413.393) (-410.934) [-412.724] -- 0:00:26
553500 -- (-410.055) [-415.956] (-413.393) (-409.577) * (-412.452) [-409.154] (-411.249) (-420.773) -- 0:00:26
554000 -- (-412.242) (-410.292) [-414.814] (-409.595) * (-411.266) [-408.964] (-413.706) (-410.070) -- 0:00:26
554500 -- (-409.603) [-410.262] (-411.059) (-416.560) * [-409.098] (-409.407) (-411.937) (-411.382) -- 0:00:27
555000 -- (-411.496) [-408.946] (-411.043) (-410.850) * (-410.669) (-414.094) [-413.127] (-414.057) -- 0:00:27
Average standard deviation of split frequencies: 0.009803
555500 -- (-411.571) (-413.703) (-410.488) [-413.455] * (-408.869) (-411.006) [-409.645] (-410.739) -- 0:00:27
556000 -- (-408.830) (-409.557) (-410.820) [-414.774] * (-408.711) (-411.132) [-409.390] (-410.389) -- 0:00:27
556500 -- [-409.507] (-411.357) (-408.757) (-409.890) * (-409.964) [-414.445] (-410.567) (-411.464) -- 0:00:27
557000 -- (-411.938) (-411.149) (-410.416) [-411.291] * (-411.035) (-414.057) (-408.585) [-410.468] -- 0:00:27
557500 -- (-415.234) (-411.229) [-412.107] (-409.511) * [-410.493] (-409.926) (-411.171) (-410.400) -- 0:00:26
558000 -- (-410.538) (-411.979) [-409.642] (-410.622) * [-409.991] (-409.988) (-414.447) (-412.747) -- 0:00:26
558500 -- (-411.196) (-410.691) [-410.449] (-408.615) * (-410.623) [-411.160] (-413.255) (-416.885) -- 0:00:26
559000 -- [-416.008] (-411.193) (-411.181) (-412.875) * (-409.198) (-412.007) (-410.606) [-413.309] -- 0:00:26
559500 -- (-413.480) (-411.457) (-416.635) [-410.346] * (-410.054) (-409.035) (-414.844) [-412.559] -- 0:00:26
560000 -- (-417.069) (-409.930) (-410.305) [-409.654] * (-411.632) [-409.693] (-409.600) (-410.642) -- 0:00:26
Average standard deviation of split frequencies: 0.010352
560500 -- (-412.226) [-408.646] (-411.631) (-409.021) * (-408.802) (-409.700) [-411.311] (-410.252) -- 0:00:26
561000 -- [-410.761] (-408.665) (-412.168) (-409.020) * (-410.736) [-413.903] (-413.230) (-412.064) -- 0:00:26
561500 -- [-408.866] (-409.421) (-420.203) (-411.417) * (-410.559) [-411.427] (-412.158) (-409.392) -- 0:00:26
562000 -- [-409.779] (-410.467) (-414.098) (-410.463) * (-412.009) [-409.728] (-410.772) (-414.978) -- 0:00:26
562500 -- (-412.933) (-409.706) [-415.945] (-415.598) * (-410.620) (-415.421) [-414.637] (-410.816) -- 0:00:26
563000 -- (-413.939) (-412.496) [-411.596] (-413.940) * (-410.994) (-412.774) [-410.867] (-411.930) -- 0:00:26
563500 -- (-410.523) [-411.857] (-412.470) (-409.943) * [-409.679] (-413.251) (-411.586) (-409.794) -- 0:00:26
564000 -- (-409.610) (-410.338) (-410.680) [-409.856] * (-410.023) [-411.412] (-410.668) (-411.153) -- 0:00:26
564500 -- (-413.022) (-412.531) (-409.984) [-410.983] * (-409.848) [-410.622] (-409.721) (-411.848) -- 0:00:26
565000 -- (-412.967) (-410.844) (-409.976) [-410.344] * [-411.319] (-414.000) (-410.755) (-409.534) -- 0:00:26
Average standard deviation of split frequencies: 0.010775
565500 -- (-409.790) [-411.443] (-410.833) (-409.468) * [-412.207] (-413.412) (-411.565) (-408.854) -- 0:00:26
566000 -- (-411.089) (-413.846) (-410.769) [-411.118] * (-410.596) (-414.013) (-413.383) [-409.538] -- 0:00:26
566500 -- (-412.690) (-410.805) (-412.127) [-410.586] * [-410.759] (-412.325) (-410.343) (-410.041) -- 0:00:26
567000 -- (-412.305) [-410.147] (-414.853) (-415.120) * (-410.440) (-410.467) (-410.789) [-412.517] -- 0:00:25
567500 -- (-411.043) [-409.712] (-416.978) (-413.334) * (-416.910) [-411.457] (-408.857) (-418.174) -- 0:00:25
568000 -- (-410.789) (-408.757) (-413.947) [-409.435] * (-410.864) (-411.460) [-408.986] (-410.677) -- 0:00:25
568500 -- (-409.655) [-409.231] (-410.166) (-408.882) * [-409.584] (-411.987) (-409.647) (-416.854) -- 0:00:25
569000 -- (-417.548) (-411.796) (-409.915) [-409.509] * (-410.348) (-409.905) [-410.696] (-412.411) -- 0:00:25
569500 -- [-409.613] (-411.812) (-410.525) (-412.935) * (-409.255) (-410.054) (-409.531) [-409.274] -- 0:00:25
570000 -- (-409.916) (-411.264) [-412.532] (-415.276) * [-409.507] (-412.520) (-410.254) (-411.856) -- 0:00:25
Average standard deviation of split frequencies: 0.010842
570500 -- (-412.525) [-410.655] (-409.215) (-411.250) * (-410.106) [-410.015] (-409.611) (-412.862) -- 0:00:25
571000 -- (-409.413) (-409.543) [-409.329] (-411.635) * (-411.740) (-409.417) [-413.005] (-410.811) -- 0:00:25
571500 -- (-411.448) (-409.697) [-410.085] (-412.220) * [-415.831] (-409.941) (-410.217) (-411.709) -- 0:00:26
572000 -- (-410.810) (-409.828) (-410.740) [-410.249] * (-413.640) [-414.143] (-410.618) (-410.277) -- 0:00:26
572500 -- (-411.654) [-410.854] (-409.955) (-412.716) * (-415.899) (-415.356) (-410.519) [-409.301] -- 0:00:26
573000 -- (-414.249) (-411.418) [-410.230] (-412.649) * [-410.837] (-410.980) (-409.124) (-412.491) -- 0:00:26
573500 -- (-413.091) (-411.262) [-410.834] (-410.994) * [-412.801] (-410.023) (-411.942) (-409.208) -- 0:00:26
574000 -- [-410.163] (-409.830) (-410.850) (-413.310) * (-414.244) (-412.589) [-410.391] (-410.766) -- 0:00:25
574500 -- [-413.094] (-411.383) (-411.170) (-415.694) * (-409.978) (-408.771) [-414.513] (-410.523) -- 0:00:25
575000 -- [-408.872] (-410.495) (-412.764) (-413.369) * (-409.966) (-409.876) (-412.235) [-411.478] -- 0:00:25
Average standard deviation of split frequencies: 0.010384
575500 -- [-409.251] (-409.570) (-411.451) (-412.183) * (-413.556) (-409.401) (-409.972) [-408.850] -- 0:00:25
576000 -- (-409.878) (-409.326) [-412.808] (-416.322) * [-410.017] (-411.403) (-411.511) (-412.475) -- 0:00:25
576500 -- [-409.910] (-415.657) (-415.990) (-410.712) * [-410.842] (-411.484) (-411.742) (-410.730) -- 0:00:25
577000 -- (-409.401) (-410.021) (-415.662) [-410.992] * (-410.544) (-413.728) [-411.129] (-411.464) -- 0:00:25
577500 -- (-412.263) [-409.178] (-413.440) (-415.239) * (-412.978) [-411.630] (-411.226) (-411.962) -- 0:00:25
578000 -- (-415.929) (-415.789) (-410.228) [-412.820] * (-408.870) (-409.780) (-410.195) [-411.822] -- 0:00:25
578500 -- (-412.990) [-412.290] (-412.343) (-409.611) * (-408.925) (-408.952) [-410.504] (-410.019) -- 0:00:25
579000 -- (-419.196) (-409.588) (-412.203) [-411.623] * (-409.489) [-412.210] (-409.187) (-415.942) -- 0:00:25
579500 -- (-411.947) [-410.272] (-411.558) (-416.286) * (-415.896) (-410.323) [-410.560] (-409.360) -- 0:00:25
580000 -- [-413.961] (-414.936) (-410.140) (-409.812) * [-414.228] (-409.523) (-411.105) (-411.964) -- 0:00:25
Average standard deviation of split frequencies: 0.010351
580500 -- (-410.616) [-412.257] (-412.670) (-409.303) * [-411.855] (-413.192) (-411.697) (-409.999) -- 0:00:25
581000 -- (-410.022) (-410.182) (-411.835) [-410.803] * [-412.166] (-411.432) (-409.953) (-409.038) -- 0:00:25
581500 -- (-410.682) (-410.053) (-412.728) [-410.805] * [-408.805] (-409.575) (-410.839) (-411.889) -- 0:00:25
582000 -- [-412.672] (-409.407) (-418.307) (-414.307) * (-409.128) (-412.293) (-413.813) [-410.266] -- 0:00:25
582500 -- (-410.867) (-414.385) [-411.907] (-411.445) * [-410.187] (-411.574) (-409.701) (-409.047) -- 0:00:25
583000 -- (-409.746) (-416.157) [-408.935] (-415.764) * (-412.798) [-412.474] (-410.406) (-410.107) -- 0:00:25
583500 -- (-409.478) (-409.974) (-413.156) [-412.828] * (-411.712) (-412.971) [-411.757] (-409.641) -- 0:00:24
584000 -- [-409.712] (-414.196) (-416.964) (-412.032) * [-409.748] (-414.463) (-411.570) (-408.656) -- 0:00:24
584500 -- (-410.403) (-410.160) [-411.775] (-409.538) * (-409.891) (-409.944) (-410.434) [-410.983] -- 0:00:24
585000 -- [-411.238] (-413.127) (-410.191) (-409.041) * (-413.802) (-411.895) (-409.415) [-409.659] -- 0:00:24
Average standard deviation of split frequencies: 0.010759
585500 -- (-412.825) [-410.627] (-409.485) (-409.249) * (-412.179) (-411.486) [-411.604] (-411.483) -- 0:00:24
586000 -- [-412.330] (-410.007) (-409.513) (-409.518) * [-410.653] (-414.186) (-410.818) (-411.812) -- 0:00:24
586500 -- [-410.959] (-412.569) (-410.056) (-416.444) * (-409.561) (-411.369) (-411.874) [-408.854] -- 0:00:24
587000 -- (-411.099) (-411.190) (-411.964) [-410.030] * (-413.420) [-411.431] (-409.803) (-408.940) -- 0:00:24
587500 -- (-411.103) (-411.472) (-409.833) [-411.637] * [-411.384] (-408.612) (-413.568) (-408.710) -- 0:00:24
588000 -- [-410.172] (-411.054) (-410.427) (-410.286) * (-412.430) (-409.164) [-410.849] (-413.273) -- 0:00:25
588500 -- [-408.729] (-409.794) (-409.358) (-411.064) * [-412.763] (-409.765) (-409.545) (-410.690) -- 0:00:25
589000 -- [-411.044] (-412.036) (-412.460) (-418.349) * (-409.756) [-408.705] (-411.834) (-413.460) -- 0:00:25
589500 -- (-412.586) [-409.246] (-410.805) (-409.582) * (-411.691) (-408.674) [-410.737] (-410.276) -- 0:00:25
590000 -- [-409.816] (-410.094) (-411.530) (-411.500) * [-411.681] (-410.192) (-412.143) (-411.033) -- 0:00:25
Average standard deviation of split frequencies: 0.011173
590500 -- [-410.016] (-409.192) (-410.814) (-410.476) * (-409.297) (-410.944) (-416.215) [-411.139] -- 0:00:24
591000 -- [-410.054] (-411.578) (-409.829) (-412.704) * (-409.937) (-411.477) [-415.425] (-410.852) -- 0:00:24
591500 -- (-409.522) (-411.591) [-410.173] (-412.149) * [-410.311] (-411.940) (-413.877) (-410.915) -- 0:00:24
592000 -- (-409.806) [-409.485] (-411.130) (-409.999) * (-410.139) (-411.518) [-409.834] (-411.534) -- 0:00:24
592500 -- (-412.222) [-409.110] (-410.704) (-414.167) * [-410.753] (-409.786) (-409.259) (-413.168) -- 0:00:24
593000 -- (-413.086) (-409.173) (-411.713) [-410.785] * (-410.654) [-411.134] (-409.579) (-410.453) -- 0:00:24
593500 -- [-409.310] (-412.780) (-410.766) (-416.646) * (-410.585) (-420.936) [-409.579] (-410.608) -- 0:00:24
594000 -- (-413.587) [-410.022] (-411.577) (-412.619) * (-410.033) [-412.145] (-409.466) (-410.244) -- 0:00:24
594500 -- [-411.090] (-411.283) (-410.571) (-409.775) * (-410.602) (-409.771) [-411.532] (-415.566) -- 0:00:24
595000 -- (-413.142) [-410.713] (-410.038) (-411.787) * (-410.474) (-411.696) [-411.596] (-416.824) -- 0:00:24
Average standard deviation of split frequencies: 0.011073
595500 -- [-412.039] (-409.667) (-410.428) (-413.619) * (-409.224) (-411.587) [-410.051] (-409.615) -- 0:00:24
596000 -- [-410.181] (-413.436) (-409.235) (-413.977) * [-409.671] (-411.302) (-411.331) (-412.230) -- 0:00:24
596500 -- (-410.960) (-410.912) [-412.713] (-413.187) * (-409.399) (-412.469) [-411.520] (-409.619) -- 0:00:24
597000 -- (-411.769) (-411.681) [-412.138] (-411.365) * [-409.311] (-413.299) (-412.431) (-409.309) -- 0:00:24
597500 -- (-414.447) [-409.432] (-411.144) (-411.402) * [-408.887] (-414.194) (-410.611) (-410.574) -- 0:00:24
598000 -- (-410.273) [-411.297] (-410.649) (-411.403) * (-410.124) (-412.363) (-411.772) [-410.634] -- 0:00:24
598500 -- (-408.650) (-409.786) (-412.057) [-412.310] * (-411.164) (-416.178) [-410.059] (-408.698) -- 0:00:24
599000 -- (-409.399) (-410.488) (-415.004) [-409.952] * [-411.177] (-409.706) (-412.732) (-413.235) -- 0:00:24
599500 -- (-409.333) (-409.186) [-409.919] (-412.119) * (-410.795) (-410.402) (-410.109) [-409.650] -- 0:00:24
600000 -- [-410.997] (-410.285) (-409.503) (-412.283) * (-411.278) (-411.645) [-408.929] (-410.708) -- 0:00:24
Average standard deviation of split frequencies: 0.010546
600500 -- [-411.258] (-409.746) (-411.118) (-410.274) * (-411.027) [-410.038] (-408.815) (-408.788) -- 0:00:23
601000 -- (-412.313) (-411.828) [-410.800] (-413.888) * [-409.885] (-412.360) (-408.744) (-410.515) -- 0:00:23
601500 -- (-410.275) [-410.225] (-411.054) (-410.228) * (-409.986) (-411.841) (-412.400) [-409.221] -- 0:00:23
602000 -- (-412.975) (-413.294) (-411.792) [-410.125] * (-409.505) [-410.159] (-409.678) (-409.056) -- 0:00:23
602500 -- (-413.810) (-409.920) [-418.142] (-408.927) * [-409.941] (-415.828) (-411.446) (-410.696) -- 0:00:23
603000 -- (-409.626) (-410.927) [-412.633] (-410.389) * [-409.844] (-408.758) (-411.782) (-411.214) -- 0:00:23
603500 -- (-409.832) (-411.126) (-413.020) [-410.633] * (-409.904) (-409.712) [-412.351] (-411.604) -- 0:00:23
604000 -- (-413.588) [-409.379] (-413.720) (-409.060) * (-413.292) (-412.750) [-409.284] (-413.376) -- 0:00:23
604500 -- (-412.409) (-411.923) (-414.480) [-409.695] * (-414.645) (-412.634) (-409.720) [-412.229] -- 0:00:23
605000 -- (-412.137) (-413.444) [-410.523] (-411.958) * [-412.830] (-414.846) (-409.909) (-411.700) -- 0:00:24
Average standard deviation of split frequencies: 0.010502
605500 -- (-411.780) (-413.464) (-411.880) [-410.814] * (-410.141) (-415.061) (-412.802) [-409.759] -- 0:00:24
606000 -- (-413.446) [-411.588] (-409.298) (-411.267) * [-409.922] (-409.232) (-413.471) (-410.984) -- 0:00:24
606500 -- [-411.996] (-409.793) (-409.522) (-411.401) * (-409.746) (-409.773) [-414.058] (-410.779) -- 0:00:24
607000 -- (-410.711) [-413.099] (-410.448) (-413.632) * (-411.066) [-408.823] (-412.248) (-414.371) -- 0:00:23
607500 -- (-413.746) (-410.788) (-411.614) [-411.307] * (-411.841) [-409.300] (-413.192) (-414.359) -- 0:00:23
608000 -- (-410.758) [-410.797] (-415.280) (-413.639) * (-411.526) [-413.407] (-411.862) (-411.664) -- 0:00:23
608500 -- [-411.006] (-411.744) (-409.496) (-410.926) * (-414.637) [-413.021] (-415.302) (-410.749) -- 0:00:23
609000 -- (-411.588) (-408.813) (-409.769) [-409.850] * [-409.216] (-413.265) (-414.452) (-409.902) -- 0:00:23
609500 -- (-409.002) (-409.001) (-410.316) [-411.462] * (-414.703) [-410.396] (-412.140) (-412.794) -- 0:00:23
610000 -- (-408.579) (-410.001) (-419.243) [-413.007] * (-412.737) (-412.887) (-410.889) [-410.169] -- 0:00:23
Average standard deviation of split frequencies: 0.010614
610500 -- (-410.143) (-409.827) (-409.226) [-413.715] * [-411.418] (-411.782) (-410.715) (-412.836) -- 0:00:23
611000 -- (-410.831) [-410.112] (-410.821) (-414.322) * (-412.788) [-412.681] (-411.917) (-409.574) -- 0:00:23
611500 -- (-411.249) (-409.499) [-408.616] (-410.487) * (-409.420) [-412.806] (-410.630) (-410.864) -- 0:00:23
612000 -- (-411.472) (-410.887) [-408.977] (-409.843) * (-410.091) (-415.097) (-410.304) [-409.918] -- 0:00:23
612500 -- (-414.693) [-409.319] (-410.642) (-414.001) * (-410.262) [-409.116] (-408.761) (-409.328) -- 0:00:23
613000 -- [-411.655] (-409.822) (-413.451) (-409.908) * (-410.769) (-411.547) [-410.251] (-409.080) -- 0:00:23
613500 -- (-414.141) [-409.398] (-410.488) (-411.337) * (-413.043) (-408.980) (-414.860) [-411.269] -- 0:00:23
614000 -- (-414.736) (-409.887) [-409.267] (-409.681) * (-411.536) (-410.407) [-409.886] (-413.208) -- 0:00:23
614500 -- (-413.221) (-410.389) (-418.619) [-409.255] * (-409.785) [-409.117] (-409.310) (-410.816) -- 0:00:23
615000 -- (-416.347) (-410.376) (-411.358) [-409.441] * (-411.583) (-409.188) [-408.915] (-410.095) -- 0:00:23
Average standard deviation of split frequencies: 0.010331
615500 -- (-411.359) (-410.450) [-410.033] (-409.670) * (-412.802) (-409.036) [-411.459] (-409.334) -- 0:00:23
616000 -- (-416.196) [-408.756] (-412.393) (-410.545) * (-410.487) (-410.088) (-409.423) [-411.233] -- 0:00:23
616500 -- [-414.178] (-411.397) (-409.924) (-410.699) * (-413.978) [-409.314] (-413.146) (-410.897) -- 0:00:23
617000 -- (-408.935) [-409.802] (-409.936) (-413.680) * (-410.422) [-409.440] (-413.633) (-410.550) -- 0:00:22
617500 -- (-409.352) (-412.876) (-409.777) [-410.270] * [-411.960] (-410.765) (-410.883) (-413.216) -- 0:00:22
618000 -- [-409.155] (-410.507) (-413.345) (-412.633) * (-412.504) (-410.562) [-410.057] (-413.953) -- 0:00:22
618500 -- (-411.490) (-415.088) [-409.918] (-410.974) * (-412.951) [-409.664] (-409.033) (-414.424) -- 0:00:22
619000 -- (-412.582) [-415.013] (-408.826) (-412.012) * [-409.929] (-409.978) (-409.848) (-409.340) -- 0:00:22
619500 -- (-411.481) (-408.944) (-413.174) [-410.790] * (-411.237) (-412.581) [-410.702] (-410.302) -- 0:00:22
620000 -- [-410.398] (-412.731) (-408.819) (-408.796) * (-414.480) (-409.111) (-410.746) [-410.889] -- 0:00:22
Average standard deviation of split frequencies: 0.009969
620500 -- (-413.201) (-413.947) (-411.471) [-413.257] * (-411.532) [-411.522] (-409.582) (-410.711) -- 0:00:22
621000 -- (-412.694) (-412.465) [-409.369] (-412.279) * [-409.875] (-411.885) (-410.214) (-411.332) -- 0:00:22
621500 -- (-412.308) [-412.106] (-411.127) (-409.215) * [-410.779] (-411.307) (-413.541) (-409.525) -- 0:00:23
622000 -- (-412.777) (-409.898) [-409.011] (-410.750) * (-413.482) (-408.913) (-408.768) [-410.535] -- 0:00:23
622500 -- (-411.519) (-410.414) (-410.206) [-410.664] * (-417.659) (-409.572) (-410.454) [-414.398] -- 0:00:23
623000 -- [-411.194] (-415.419) (-410.196) (-410.757) * (-415.732) (-410.560) (-409.417) [-411.287] -- 0:00:22
623500 -- (-411.689) [-410.572] (-409.551) (-412.487) * [-409.741] (-410.870) (-412.223) (-412.019) -- 0:00:22
624000 -- [-413.146] (-409.200) (-410.750) (-410.421) * (-411.821) (-413.215) [-410.581] (-410.063) -- 0:00:22
624500 -- [-411.529] (-412.083) (-410.938) (-409.068) * (-408.800) [-410.160] (-411.670) (-413.109) -- 0:00:22
625000 -- (-410.209) [-411.356] (-412.905) (-413.511) * [-411.315] (-411.583) (-410.480) (-408.838) -- 0:00:22
Average standard deviation of split frequencies: 0.009884
625500 -- [-409.451] (-410.895) (-413.315) (-409.775) * (-410.625) (-413.048) (-409.046) [-409.878] -- 0:00:22
626000 -- (-411.064) (-410.397) (-409.616) [-411.744] * [-410.511] (-413.495) (-408.991) (-412.713) -- 0:00:22
626500 -- (-415.623) (-409.312) [-411.072] (-413.762) * (-408.783) (-409.551) [-409.934] (-415.135) -- 0:00:22
627000 -- (-413.485) [-410.673] (-412.481) (-411.079) * (-409.493) [-409.817] (-409.883) (-412.921) -- 0:00:22
627500 -- (-410.921) (-410.078) [-409.625] (-410.892) * [-409.022] (-411.090) (-411.046) (-410.080) -- 0:00:22
628000 -- [-409.769] (-412.095) (-408.812) (-414.752) * (-408.824) [-411.776] (-409.402) (-411.984) -- 0:00:22
628500 -- (-408.911) (-411.459) (-411.964) [-410.234] * (-409.994) [-410.275] (-412.246) (-410.247) -- 0:00:22
629000 -- (-410.998) (-411.124) (-414.118) [-409.977] * (-414.107) (-411.143) [-411.032] (-410.215) -- 0:00:22
629500 -- (-410.692) (-412.684) [-415.833] (-411.358) * (-410.127) (-412.572) [-409.783] (-415.811) -- 0:00:22
630000 -- (-411.722) [-415.635] (-409.335) (-415.412) * (-411.474) (-412.564) [-412.083] (-412.792) -- 0:00:22
Average standard deviation of split frequencies: 0.010184
630500 -- (-413.952) [-413.398] (-411.577) (-413.385) * (-411.782) [-409.357] (-411.178) (-410.381) -- 0:00:22
631000 -- (-412.009) (-414.857) [-410.163] (-410.194) * (-409.099) (-411.540) (-412.000) [-410.909] -- 0:00:22
631500 -- (-411.589) (-411.237) (-413.547) [-409.579] * (-412.577) (-409.236) [-408.646] (-413.545) -- 0:00:22
632000 -- (-412.414) [-410.175] (-410.615) (-408.686) * (-413.124) (-409.592) (-409.505) [-411.854] -- 0:00:22
632500 -- (-417.277) [-415.097] (-411.486) (-411.368) * (-412.713) (-410.936) [-411.246] (-412.918) -- 0:00:22
633000 -- (-412.319) (-410.460) [-410.268] (-410.117) * [-412.860] (-411.589) (-410.412) (-410.367) -- 0:00:22
633500 -- [-409.690] (-410.908) (-410.454) (-410.686) * (-411.168) (-412.459) [-409.878] (-409.980) -- 0:00:21
634000 -- [-410.551] (-409.772) (-414.034) (-411.454) * (-412.481) (-415.119) [-409.480] (-411.996) -- 0:00:21
634500 -- (-410.572) [-409.511] (-411.034) (-410.647) * (-413.088) [-409.663] (-411.503) (-412.853) -- 0:00:21
635000 -- [-409.463] (-409.381) (-409.927) (-411.981) * (-410.439) [-409.294] (-409.159) (-414.897) -- 0:00:21
Average standard deviation of split frequencies: 0.010192
635500 -- [-409.292] (-410.231) (-410.191) (-410.216) * (-409.743) [-411.542] (-410.333) (-409.091) -- 0:00:21
636000 -- (-409.009) [-411.266] (-413.046) (-413.739) * (-411.536) (-410.824) [-411.307] (-410.046) -- 0:00:21
636500 -- (-410.292) [-410.202] (-411.837) (-416.093) * [-415.308] (-410.668) (-410.186) (-414.798) -- 0:00:21
637000 -- (-410.812) [-409.344] (-411.447) (-411.982) * (-414.645) (-410.128) [-410.099] (-413.007) -- 0:00:21
637500 -- (-409.549) (-412.411) [-410.589] (-409.746) * (-411.529) (-409.253) [-411.014] (-411.839) -- 0:00:21
638000 -- [-412.051] (-409.976) (-415.007) (-410.226) * (-415.673) [-410.065] (-414.235) (-410.332) -- 0:00:22
638500 -- (-413.519) (-411.931) (-409.526) [-409.736] * [-412.860] (-414.188) (-409.576) (-411.463) -- 0:00:22
639000 -- (-411.110) (-411.251) (-412.618) [-409.847] * (-408.630) [-409.453] (-410.746) (-411.889) -- 0:00:22
639500 -- (-413.547) [-410.807] (-411.560) (-414.346) * (-409.672) (-409.897) (-409.677) [-411.688] -- 0:00:21
640000 -- [-413.661] (-411.450) (-410.558) (-411.159) * (-409.314) [-409.575] (-414.538) (-410.680) -- 0:00:21
Average standard deviation of split frequencies: 0.009933
640500 -- [-411.749] (-412.149) (-412.576) (-413.815) * (-408.617) (-410.985) (-416.055) [-414.314] -- 0:00:21
641000 -- (-410.161) [-410.189] (-411.144) (-410.640) * [-409.151] (-410.779) (-413.154) (-411.385) -- 0:00:21
641500 -- [-410.290] (-409.426) (-414.378) (-411.969) * (-409.514) [-410.126] (-409.975) (-409.610) -- 0:00:21
642000 -- (-410.231) (-410.713) [-412.595] (-412.713) * (-412.382) (-411.839) (-409.061) [-408.913] -- 0:00:21
642500 -- (-412.291) (-409.882) [-410.039] (-411.414) * (-411.247) [-410.586] (-412.267) (-409.974) -- 0:00:21
643000 -- (-412.989) [-410.522] (-410.065) (-410.458) * (-409.674) (-409.590) [-410.738] (-411.130) -- 0:00:21
643500 -- (-410.901) (-412.583) [-408.587] (-412.002) * (-410.975) (-410.050) (-413.638) [-409.793] -- 0:00:21
644000 -- (-410.772) [-415.458] (-410.119) (-410.729) * (-413.405) [-409.544] (-410.400) (-410.332) -- 0:00:21
644500 -- (-410.680) (-410.782) [-409.569] (-411.968) * (-409.382) [-409.908] (-410.759) (-411.339) -- 0:00:21
645000 -- [-409.258] (-412.214) (-416.193) (-409.097) * (-412.241) [-411.740] (-410.836) (-412.014) -- 0:00:21
Average standard deviation of split frequencies: 0.010216
645500 -- [-412.496] (-410.585) (-412.192) (-409.615) * (-410.540) (-415.736) [-409.016] (-411.834) -- 0:00:21
646000 -- (-410.286) (-410.500) (-411.754) [-409.826] * (-409.560) (-408.653) [-411.853] (-410.580) -- 0:00:21
646500 -- (-410.934) (-411.618) (-411.434) [-410.778] * (-411.625) [-408.767] (-410.973) (-410.708) -- 0:00:21
647000 -- (-410.061) (-410.442) (-416.025) [-409.696] * (-412.190) (-412.818) [-412.540] (-410.905) -- 0:00:21
647500 -- (-409.865) (-410.250) [-409.273] (-411.032) * (-410.884) (-411.349) (-418.276) [-411.422] -- 0:00:21
648000 -- (-410.151) [-409.068] (-410.528) (-409.910) * (-410.409) [-409.364] (-410.760) (-411.856) -- 0:00:21
648500 -- (-410.536) [-412.139] (-414.251) (-409.481) * (-409.413) [-411.164] (-409.933) (-413.013) -- 0:00:21
649000 -- (-410.375) (-409.003) (-416.618) [-411.225] * (-409.840) (-411.085) (-411.925) [-413.387] -- 0:00:21
649500 -- (-411.807) [-410.011] (-413.221) (-409.159) * [-409.277] (-412.501) (-412.799) (-408.921) -- 0:00:21
650000 -- (-412.546) [-412.515] (-410.224) (-410.256) * [-409.502] (-409.461) (-410.480) (-408.965) -- 0:00:21
Average standard deviation of split frequencies: 0.009373
650500 -- [-410.737] (-409.856) (-408.827) (-411.408) * (-409.235) (-412.663) [-409.213] (-408.928) -- 0:00:20
651000 -- (-410.594) (-410.041) [-409.925] (-410.055) * (-408.930) [-409.929] (-409.329) (-408.584) -- 0:00:20
651500 -- [-409.364] (-411.033) (-412.026) (-409.692) * [-408.695] (-411.412) (-415.205) (-411.850) -- 0:00:20
652000 -- (-410.074) (-417.628) (-410.267) [-409.545] * (-414.620) [-410.422] (-409.018) (-412.415) -- 0:00:20
652500 -- (-412.074) (-410.710) (-410.740) [-411.414] * (-413.165) (-408.981) [-411.214] (-410.298) -- 0:00:20
653000 -- (-410.312) [-410.497] (-409.256) (-414.211) * [-410.177] (-408.593) (-410.105) (-411.563) -- 0:00:20
653500 -- (-409.751) (-410.280) (-410.841) [-411.512] * [-414.814] (-409.423) (-412.536) (-410.771) -- 0:00:20
654000 -- [-411.061] (-411.330) (-410.240) (-412.170) * [-410.906] (-411.742) (-409.859) (-410.008) -- 0:00:20
654500 -- (-411.781) (-409.365) [-409.794] (-410.574) * (-410.485) [-409.835] (-409.731) (-412.044) -- 0:00:21
655000 -- [-411.384] (-410.782) (-409.994) (-410.632) * (-410.405) (-410.493) (-412.376) [-411.293] -- 0:00:21
Average standard deviation of split frequencies: 0.009387
655500 -- (-411.754) (-411.889) [-410.530] (-410.578) * [-410.142] (-412.833) (-411.540) (-412.523) -- 0:00:21
656000 -- (-412.383) (-412.378) [-412.300] (-410.111) * (-410.076) (-411.444) [-411.217] (-411.294) -- 0:00:20
656500 -- (-410.862) [-409.540] (-411.097) (-409.291) * [-411.688] (-412.644) (-409.754) (-409.813) -- 0:00:20
657000 -- (-412.879) (-412.005) (-408.693) [-412.238] * (-409.458) (-412.136) (-410.017) [-409.574] -- 0:00:20
657500 -- [-410.264] (-411.078) (-408.688) (-410.782) * [-410.412] (-409.835) (-410.162) (-409.983) -- 0:00:20
658000 -- (-411.031) (-412.187) (-414.020) [-409.187] * (-410.227) (-415.432) (-411.307) [-409.773] -- 0:00:20
658500 -- (-411.120) (-410.404) [-409.771] (-412.230) * (-410.582) (-412.496) (-412.713) [-409.487] -- 0:00:20
659000 -- (-417.276) (-413.341) (-409.631) [-408.938] * (-410.434) (-415.489) [-415.031] (-409.626) -- 0:00:20
659500 -- (-412.539) [-410.455] (-409.519) (-410.300) * (-413.272) [-410.159] (-413.586) (-410.455) -- 0:00:20
660000 -- [-409.675] (-409.764) (-410.828) (-409.868) * [-409.485] (-410.662) (-413.860) (-411.744) -- 0:00:20
Average standard deviation of split frequencies: 0.009276
660500 -- (-410.003) [-411.624] (-414.133) (-410.825) * [-410.269] (-410.453) (-410.192) (-409.928) -- 0:00:20
661000 -- [-409.370] (-410.871) (-413.085) (-410.071) * (-412.674) [-411.029] (-412.363) (-411.680) -- 0:00:20
661500 -- (-411.024) (-411.339) (-411.856) [-408.888] * (-410.073) (-410.312) (-411.454) [-409.510] -- 0:00:20
662000 -- (-409.578) [-409.596] (-410.804) (-410.384) * (-409.087) (-412.829) [-408.685] (-411.170) -- 0:00:20
662500 -- (-421.391) [-409.829] (-409.609) (-410.059) * (-410.120) (-410.328) (-415.414) [-410.909] -- 0:00:20
663000 -- (-418.712) (-415.179) (-411.018) [-410.252] * (-411.228) (-409.807) [-414.561] (-410.247) -- 0:00:20
663500 -- [-411.449] (-410.676) (-409.660) (-411.054) * (-409.366) (-408.636) [-409.812] (-410.204) -- 0:00:20
664000 -- [-411.064] (-411.637) (-411.398) (-409.066) * (-409.452) (-410.480) [-411.620] (-411.149) -- 0:00:20
664500 -- (-412.807) (-414.777) [-409.558] (-409.294) * [-413.365] (-412.008) (-411.381) (-413.104) -- 0:00:20
665000 -- (-411.622) (-412.243) (-411.291) [-410.057] * (-410.794) [-413.116] (-413.426) (-416.623) -- 0:00:20
Average standard deviation of split frequencies: 0.009600
665500 -- (-411.696) [-408.886] (-412.181) (-416.507) * [-411.377] (-413.648) (-413.760) (-410.156) -- 0:00:20
666000 -- (-412.041) (-410.048) [-409.923] (-412.270) * (-410.877) (-409.810) (-411.688) [-412.539] -- 0:00:20
666500 -- (-410.399) (-412.351) [-409.604] (-414.163) * (-411.130) [-414.056] (-410.892) (-412.779) -- 0:00:20
667000 -- (-411.901) [-410.831] (-409.163) (-410.113) * (-412.172) (-410.339) [-409.366] (-412.043) -- 0:00:19
667500 -- [-410.396] (-411.017) (-408.580) (-411.352) * (-409.280) (-411.427) (-412.050) [-410.630] -- 0:00:19
668000 -- [-410.807] (-408.675) (-409.020) (-413.295) * [-408.719] (-412.861) (-412.301) (-411.653) -- 0:00:19
668500 -- (-411.536) (-414.649) [-413.648] (-410.419) * [-409.502] (-415.234) (-409.197) (-412.036) -- 0:00:19
669000 -- (-410.247) [-411.320] (-411.737) (-409.147) * (-409.269) (-411.200) [-410.319] (-411.974) -- 0:00:19
669500 -- (-412.898) [-416.935] (-410.008) (-410.756) * [-412.118] (-414.267) (-409.381) (-409.289) -- 0:00:19
670000 -- [-410.353] (-410.225) (-412.304) (-413.415) * [-410.942] (-410.789) (-409.294) (-414.579) -- 0:00:19
Average standard deviation of split frequencies: 0.009533
670500 -- (-412.040) (-411.202) (-410.036) [-409.430] * (-410.762) (-410.429) (-410.993) [-409.740] -- 0:00:19
671000 -- [-412.118] (-410.235) (-410.442) (-412.690) * [-411.521] (-410.641) (-411.560) (-409.405) -- 0:00:19
671500 -- (-411.577) (-409.542) [-410.567] (-412.308) * [-411.442] (-413.099) (-412.159) (-410.730) -- 0:00:20
672000 -- (-411.738) [-410.216] (-410.928) (-411.877) * [-410.885] (-411.004) (-411.274) (-418.553) -- 0:00:20
672500 -- (-409.328) (-413.028) (-409.888) [-409.588] * (-411.911) [-408.733] (-411.653) (-409.161) -- 0:00:19
673000 -- (-410.477) [-412.044] (-409.780) (-411.502) * (-408.851) [-411.368] (-410.022) (-409.430) -- 0:00:19
673500 -- (-409.495) (-412.453) [-408.518] (-413.479) * (-413.657) (-412.027) [-414.221] (-413.824) -- 0:00:19
674000 -- (-412.183) (-413.263) (-408.420) [-409.782] * [-408.825] (-410.309) (-411.368) (-413.599) -- 0:00:19
674500 -- [-413.446] (-409.654) (-409.382) (-408.800) * [-408.752] (-411.149) (-411.803) (-411.633) -- 0:00:19
675000 -- (-412.609) (-413.637) [-410.320] (-411.527) * (-412.739) (-410.600) [-411.411] (-410.166) -- 0:00:19
Average standard deviation of split frequencies: 0.009894
675500 -- (-414.438) [-414.511] (-411.464) (-409.441) * [-410.094] (-410.730) (-415.144) (-409.103) -- 0:00:19
676000 -- (-410.667) [-412.156] (-409.864) (-410.928) * (-409.576) [-412.650] (-409.612) (-412.453) -- 0:00:19
676500 -- (-412.502) [-412.415] (-409.741) (-411.680) * [-410.493] (-415.878) (-410.264) (-414.738) -- 0:00:19
677000 -- [-412.119] (-410.992) (-411.375) (-409.846) * (-410.577) [-409.620] (-411.330) (-408.587) -- 0:00:19
677500 -- [-410.515] (-412.214) (-411.924) (-413.166) * [-408.866] (-412.126) (-410.145) (-411.761) -- 0:00:19
678000 -- (-409.389) (-414.575) (-410.606) [-409.384] * [-409.406] (-413.196) (-412.521) (-413.093) -- 0:00:19
678500 -- (-409.247) [-417.100] (-411.455) (-410.584) * (-410.358) (-410.973) (-408.788) [-410.657] -- 0:00:19
679000 -- (-410.750) (-411.641) [-411.547] (-414.737) * (-410.306) (-416.327) [-409.420] (-409.671) -- 0:00:19
679500 -- [-410.411] (-411.941) (-409.207) (-413.430) * [-408.882] (-409.386) (-409.341) (-411.171) -- 0:00:19
680000 -- (-410.748) (-410.366) (-408.894) [-411.915] * [-410.426] (-411.871) (-409.574) (-409.503) -- 0:00:19
Average standard deviation of split frequencies: 0.009912
680500 -- (-409.590) [-413.045] (-412.019) (-410.360) * (-418.868) (-408.719) (-409.875) [-409.894] -- 0:00:19
681000 -- (-414.142) [-408.776] (-410.194) (-409.583) * [-414.641] (-409.829) (-409.647) (-411.351) -- 0:00:19
681500 -- (-414.355) (-409.929) [-409.522] (-412.288) * (-418.949) [-412.406] (-410.414) (-410.185) -- 0:00:19
682000 -- [-410.748] (-411.037) (-409.803) (-409.697) * (-409.173) (-411.902) (-410.352) [-410.895] -- 0:00:19
682500 -- (-410.514) (-412.354) (-409.383) [-410.311] * (-408.790) (-409.677) [-410.505] (-411.147) -- 0:00:19
683000 -- [-411.318] (-410.953) (-409.723) (-410.277) * [-410.244] (-409.537) (-410.835) (-409.890) -- 0:00:19
683500 -- (-409.427) (-412.253) [-409.422] (-416.698) * (-413.469) (-410.065) [-409.469] (-410.506) -- 0:00:18
684000 -- (-416.331) (-410.818) (-410.749) [-409.831] * [-414.045] (-419.433) (-409.101) (-414.129) -- 0:00:18
684500 -- [-411.251] (-413.110) (-411.258) (-412.883) * (-409.533) (-415.337) [-408.958] (-413.334) -- 0:00:18
685000 -- [-409.941] (-409.820) (-408.966) (-410.323) * [-410.510] (-412.435) (-414.781) (-412.844) -- 0:00:18
Average standard deviation of split frequencies: 0.009878
685500 -- (-411.575) [-412.488] (-410.744) (-409.950) * (-412.513) [-411.198] (-411.820) (-410.375) -- 0:00:18
686000 -- (-412.304) [-411.049] (-411.071) (-410.065) * (-416.445) [-410.102] (-410.753) (-409.967) -- 0:00:18
686500 -- (-411.273) [-410.178] (-409.887) (-411.029) * [-409.126] (-410.653) (-409.834) (-416.959) -- 0:00:18
687000 -- [-408.789] (-410.344) (-408.747) (-413.963) * (-412.157) (-411.094) (-409.615) [-412.937] -- 0:00:18
687500 -- [-408.648] (-410.638) (-415.284) (-415.118) * (-409.882) (-409.974) [-411.589] (-412.297) -- 0:00:18
688000 -- (-410.281) (-408.822) [-410.712] (-409.856) * (-412.799) [-411.835] (-413.738) (-409.710) -- 0:00:19
688500 -- [-408.673] (-409.599) (-414.094) (-409.739) * (-409.675) (-410.279) [-409.156] (-411.123) -- 0:00:19
689000 -- (-413.434) (-410.023) (-410.500) [-409.259] * (-411.090) (-413.945) [-410.960] (-409.285) -- 0:00:18
689500 -- (-409.969) (-408.689) (-414.487) [-414.931] * [-409.654] (-409.754) (-411.779) (-410.558) -- 0:00:18
690000 -- [-409.068] (-411.440) (-412.422) (-411.625) * (-411.963) (-409.792) (-413.434) [-410.423] -- 0:00:18
Average standard deviation of split frequencies: 0.009385
690500 -- [-409.709] (-409.694) (-415.579) (-409.593) * [-409.662] (-410.893) (-414.020) (-411.109) -- 0:00:18
691000 -- (-409.544) [-409.611] (-409.282) (-409.192) * (-409.038) (-410.620) [-410.933] (-415.475) -- 0:00:18
691500 -- [-411.721] (-409.763) (-410.161) (-409.283) * (-409.605) (-412.272) (-410.415) [-414.695] -- 0:00:18
692000 -- (-412.297) [-409.358] (-412.957) (-412.139) * (-410.236) (-410.964) [-409.846] (-412.031) -- 0:00:18
692500 -- (-414.998) [-412.855] (-410.253) (-411.586) * (-410.090) (-411.092) (-411.192) [-410.329] -- 0:00:18
693000 -- (-409.648) [-410.949] (-409.413) (-412.125) * (-408.535) [-415.166] (-410.483) (-411.016) -- 0:00:18
693500 -- [-412.159] (-410.379) (-412.812) (-410.124) * (-411.950) (-415.666) (-408.962) [-410.685] -- 0:00:18
694000 -- (-413.335) (-413.459) [-410.880] (-409.677) * [-412.731] (-412.424) (-410.604) (-412.056) -- 0:00:18
694500 -- (-410.739) [-410.943] (-415.328) (-411.705) * [-412.412] (-411.584) (-410.658) (-411.952) -- 0:00:18
695000 -- (-408.901) [-410.146] (-413.213) (-410.014) * [-411.498] (-412.613) (-413.318) (-410.960) -- 0:00:18
Average standard deviation of split frequencies: 0.008932
695500 -- (-411.147) [-411.675] (-410.778) (-412.714) * (-410.210) (-411.185) (-410.874) [-411.458] -- 0:00:18
696000 -- (-410.759) (-408.930) (-413.023) [-408.547] * (-413.982) (-413.229) [-410.923] (-412.947) -- 0:00:18
696500 -- (-408.989) (-410.918) [-412.354] (-412.489) * (-409.443) (-409.606) (-410.198) [-409.985] -- 0:00:18
697000 -- (-410.841) (-410.726) [-410.661] (-413.791) * (-410.341) (-408.807) (-414.590) [-410.323] -- 0:00:18
697500 -- (-411.081) (-414.865) (-409.486) [-409.900] * (-421.616) (-409.000) (-415.227) [-411.460] -- 0:00:18
698000 -- (-410.728) [-409.914] (-412.505) (-412.587) * (-418.238) (-409.717) (-418.793) [-409.852] -- 0:00:18
698500 -- (-410.030) (-412.472) [-410.298] (-410.160) * (-409.956) (-409.054) (-409.419) [-408.895] -- 0:00:18
699000 -- (-410.286) (-412.889) (-409.202) [-410.418] * (-409.364) [-410.751] (-410.818) (-409.940) -- 0:00:18
699500 -- (-411.769) (-412.298) (-410.094) [-409.860] * (-410.501) (-410.642) (-408.978) [-409.930] -- 0:00:18
700000 -- (-411.508) (-411.673) (-409.321) [-410.099] * (-411.029) (-409.961) [-412.058] (-411.828) -- 0:00:18
Average standard deviation of split frequencies: 0.008830
700500 -- [-410.470] (-411.297) (-409.056) (-410.816) * (-413.966) (-408.581) (-409.740) [-410.545] -- 0:00:17
701000 -- (-409.438) (-412.650) (-410.512) [-410.866] * [-409.797] (-412.794) (-411.239) (-410.434) -- 0:00:17
701500 -- [-410.390] (-409.642) (-412.194) (-408.946) * (-410.771) (-411.469) (-409.592) [-412.229] -- 0:00:17
702000 -- (-408.959) [-410.282] (-409.278) (-410.230) * [-410.833] (-410.771) (-411.143) (-410.175) -- 0:00:17
702500 -- (-408.676) [-408.869] (-410.249) (-424.061) * (-409.798) [-413.151] (-411.223) (-410.286) -- 0:00:17
703000 -- (-409.294) (-411.926) (-409.082) [-410.433] * (-410.013) (-415.929) (-410.741) [-409.484] -- 0:00:17
703500 -- [-412.491] (-410.622) (-411.109) (-411.330) * [-415.927] (-414.036) (-413.316) (-409.484) -- 0:00:17
704000 -- (-414.561) (-409.403) [-414.223] (-409.885) * (-409.145) (-413.794) (-408.718) [-413.404] -- 0:00:17
704500 -- (-411.558) (-409.173) (-410.829) [-409.699] * (-411.731) (-410.069) (-410.637) [-414.386] -- 0:00:17
705000 -- (-415.162) (-410.772) (-409.795) [-410.652] * (-410.665) [-409.425] (-409.158) (-411.660) -- 0:00:17
Average standard deviation of split frequencies: 0.009014
705500 -- [-411.002] (-416.087) (-408.915) (-409.431) * (-412.663) [-412.354] (-409.877) (-417.248) -- 0:00:17
706000 -- (-412.810) [-411.255] (-411.766) (-411.063) * (-412.905) (-409.598) (-410.318) [-410.691] -- 0:00:17
706500 -- (-409.409) [-410.513] (-408.729) (-409.540) * (-412.592) (-410.304) (-410.049) [-410.272] -- 0:00:17
707000 -- [-414.195] (-410.564) (-409.605) (-409.464) * (-410.201) (-411.669) (-411.116) [-410.873] -- 0:00:17
707500 -- (-409.928) (-410.732) [-410.003] (-409.802) * (-410.094) [-411.245] (-411.151) (-410.236) -- 0:00:17
708000 -- (-412.804) [-412.054] (-411.018) (-411.586) * (-409.875) (-410.931) [-411.208] (-409.208) -- 0:00:17
708500 -- (-408.843) (-410.224) [-410.642] (-411.731) * (-414.738) (-410.970) [-411.014] (-409.915) -- 0:00:17
709000 -- (-409.576) [-410.640] (-411.357) (-412.435) * (-413.510) (-410.437) (-411.763) [-410.628] -- 0:00:17
709500 -- (-409.979) [-409.389] (-410.729) (-410.180) * [-409.295] (-410.844) (-411.479) (-410.945) -- 0:00:17
710000 -- (-411.705) (-410.448) (-414.047) [-411.574] * [-409.489] (-412.648) (-410.089) (-412.065) -- 0:00:17
Average standard deviation of split frequencies: 0.008913
710500 -- (-411.446) (-410.152) (-413.493) [-410.407] * (-411.780) (-409.370) (-410.449) [-410.612] -- 0:00:17
711000 -- [-409.058] (-410.518) (-410.455) (-413.330) * [-411.797] (-409.613) (-409.553) (-410.182) -- 0:00:17
711500 -- (-413.039) (-411.912) [-411.963] (-411.497) * (-409.093) [-411.917] (-410.472) (-410.136) -- 0:00:17
712000 -- (-410.239) [-410.356] (-409.718) (-409.545) * (-412.668) [-411.363] (-414.402) (-409.619) -- 0:00:17
712500 -- (-411.950) (-415.637) [-410.701] (-410.402) * (-410.898) [-410.442] (-411.036) (-410.750) -- 0:00:17
713000 -- [-411.705] (-410.225) (-410.624) (-416.349) * (-409.303) (-412.420) (-409.869) [-412.681] -- 0:00:17
713500 -- [-409.325] (-411.062) (-411.532) (-415.011) * (-409.860) [-409.426] (-412.401) (-410.806) -- 0:00:17
714000 -- (-410.573) (-413.673) [-411.203] (-420.513) * [-413.030] (-409.586) (-409.372) (-412.029) -- 0:00:17
714500 -- [-411.819] (-410.409) (-412.068) (-415.212) * [-412.347] (-410.550) (-412.010) (-412.698) -- 0:00:17
715000 -- (-410.289) [-409.902] (-411.700) (-410.904) * (-410.551) (-409.636) (-411.179) [-411.808] -- 0:00:17
Average standard deviation of split frequencies: 0.008929
715500 -- (-412.284) (-412.008) [-410.603] (-413.240) * (-410.794) [-409.310] (-411.674) (-411.890) -- 0:00:17
716000 -- [-412.187] (-412.494) (-411.176) (-411.015) * (-411.507) [-409.746] (-411.109) (-411.907) -- 0:00:17
716500 -- [-412.153] (-408.945) (-412.495) (-409.989) * [-410.815] (-409.776) (-410.125) (-411.328) -- 0:00:17
717000 -- [-408.957] (-411.887) (-410.125) (-413.874) * (-410.543) (-413.987) [-409.525] (-410.781) -- 0:00:16
717500 -- (-412.622) [-409.697] (-410.577) (-411.114) * (-412.834) (-412.853) [-409.359] (-411.202) -- 0:00:16
718000 -- (-410.724) (-410.526) (-412.204) [-412.320] * [-412.892] (-413.836) (-413.605) (-409.783) -- 0:00:16
718500 -- [-411.462] (-412.435) (-410.286) (-411.886) * (-412.736) [-410.063] (-410.376) (-412.405) -- 0:00:16
719000 -- (-409.898) [-414.151] (-411.164) (-411.339) * (-415.703) [-409.865] (-411.169) (-412.707) -- 0:00:16
719500 -- (-409.497) (-412.646) (-413.657) [-410.479] * (-414.085) (-410.258) [-409.012] (-409.341) -- 0:00:16
720000 -- (-408.705) [-410.754] (-410.663) (-411.694) * (-412.097) [-413.538] (-409.592) (-409.155) -- 0:00:16
Average standard deviation of split frequencies: 0.009035
720500 -- (-412.508) (-408.674) [-409.886] (-411.010) * (-410.006) [-410.088] (-410.591) (-411.221) -- 0:00:16
721000 -- (-411.813) [-409.499] (-411.482) (-410.934) * (-409.807) [-409.313] (-408.489) (-409.627) -- 0:00:16
721500 -- (-409.490) (-411.832) [-412.595] (-411.452) * [-410.572] (-408.408) (-413.296) (-410.322) -- 0:00:16
722000 -- [-409.792] (-411.687) (-412.450) (-409.394) * [-408.807] (-409.636) (-410.416) (-411.732) -- 0:00:16
722500 -- [-411.779] (-411.705) (-412.613) (-413.380) * (-411.368) (-410.144) [-410.804] (-409.892) -- 0:00:16
723000 -- (-410.754) (-409.209) [-408.830] (-410.317) * (-411.879) (-409.617) (-415.042) [-409.006] -- 0:00:16
723500 -- (-409.710) (-410.043) (-408.852) [-410.267] * (-409.506) [-409.579] (-411.771) (-410.042) -- 0:00:16
724000 -- (-411.072) [-408.590] (-410.453) (-413.461) * (-409.993) [-412.614] (-409.785) (-410.553) -- 0:00:16
724500 -- (-411.424) (-410.125) [-412.294] (-410.286) * (-409.251) (-409.664) (-412.314) [-411.577] -- 0:00:16
725000 -- (-414.731) (-412.724) (-412.189) [-409.119] * (-409.414) [-410.436] (-409.754) (-411.605) -- 0:00:16
Average standard deviation of split frequencies: 0.009253
725500 -- (-409.500) (-410.893) [-411.951] (-408.730) * (-409.513) [-408.813] (-415.187) (-409.863) -- 0:00:16
726000 -- (-409.762) [-410.885] (-411.017) (-409.500) * [-410.172] (-412.322) (-413.022) (-410.732) -- 0:00:16
726500 -- (-409.059) (-410.950) [-409.631] (-411.803) * (-410.189) (-414.644) [-409.802] (-410.844) -- 0:00:16
727000 -- [-411.043] (-412.729) (-411.111) (-411.557) * [-410.657] (-409.329) (-409.692) (-412.409) -- 0:00:16
727500 -- (-410.633) [-409.965] (-409.459) (-411.050) * (-409.701) (-412.587) (-410.236) [-410.769] -- 0:00:16
728000 -- (-410.619) (-409.927) (-411.010) [-408.833] * [-409.025] (-409.405) (-411.919) (-409.922) -- 0:00:16
728500 -- (-408.761) [-410.198] (-411.017) (-410.602) * (-409.300) [-412.424] (-410.149) (-409.878) -- 0:00:16
729000 -- [-410.375] (-409.976) (-412.312) (-412.048) * (-412.259) [-411.021] (-410.263) (-412.422) -- 0:00:16
729500 -- (-410.311) (-410.545) (-411.553) [-411.078] * (-410.408) (-409.158) [-409.154] (-410.251) -- 0:00:16
730000 -- (-409.999) [-409.568] (-409.948) (-411.314) * (-411.071) (-412.342) (-408.606) [-409.723] -- 0:00:16
Average standard deviation of split frequencies: 0.009194
730500 -- (-412.655) (-414.285) (-409.435) [-414.652] * (-410.349) (-414.254) [-410.860] (-409.160) -- 0:00:16
731000 -- (-411.434) (-409.124) (-410.205) [-412.318] * (-412.355) (-414.607) (-410.968) [-409.269] -- 0:00:16
731500 -- (-411.368) (-414.192) (-411.050) [-409.686] * [-411.732] (-412.463) (-409.639) (-411.262) -- 0:00:16
732000 -- (-411.075) (-413.082) (-410.874) [-409.958] * (-414.260) (-410.295) [-409.637] (-412.202) -- 0:00:16
732500 -- (-410.442) (-409.320) (-415.797) [-410.215] * [-409.955] (-409.508) (-409.145) (-411.393) -- 0:00:16
733000 -- (-411.402) (-412.999) (-415.057) [-408.785] * (-409.723) [-410.409] (-410.349) (-410.984) -- 0:00:16
733500 -- (-410.684) (-409.942) [-409.480] (-409.755) * [-409.308] (-410.663) (-409.887) (-412.534) -- 0:00:15
734000 -- (-409.682) (-412.944) (-410.596) [-408.829] * (-409.015) (-411.010) [-412.349] (-414.696) -- 0:00:15
734500 -- [-408.927] (-410.864) (-411.656) (-409.791) * (-410.409) (-411.668) [-409.464] (-410.809) -- 0:00:15
735000 -- (-411.539) (-411.740) (-409.694) [-414.731] * (-409.915) [-409.996] (-410.016) (-414.935) -- 0:00:15
Average standard deviation of split frequencies: 0.009047
735500 -- (-408.884) (-410.683) [-410.016] (-416.509) * [-409.415] (-410.032) (-411.078) (-411.324) -- 0:00:15
736000 -- (-410.620) (-412.953) (-408.988) [-415.569] * (-409.984) (-408.909) (-415.695) [-413.066] -- 0:00:15
736500 -- (-408.530) (-412.232) (-408.895) [-409.805] * (-412.409) [-411.527] (-411.848) (-410.484) -- 0:00:15
737000 -- (-410.028) (-411.323) [-410.718] (-411.400) * (-411.108) [-409.829] (-410.935) (-408.962) -- 0:00:15
737500 -- [-408.952] (-409.426) (-409.027) (-411.632) * (-411.716) (-409.376) (-410.308) [-410.842] -- 0:00:15
738000 -- (-411.548) [-411.452] (-409.801) (-410.731) * (-410.193) (-410.260) [-413.104] (-411.493) -- 0:00:15
738500 -- [-411.066] (-411.551) (-409.828) (-409.919) * (-409.145) (-412.098) [-412.768] (-412.528) -- 0:00:15
739000 -- (-409.670) (-409.467) [-409.644] (-413.214) * (-414.799) (-410.111) [-409.790] (-411.375) -- 0:00:15
739500 -- (-411.626) (-411.782) [-413.217] (-409.989) * (-412.688) (-414.824) [-411.296] (-412.110) -- 0:00:15
740000 -- [-412.782] (-412.573) (-412.209) (-409.690) * (-414.337) (-413.225) [-412.654] (-412.354) -- 0:00:15
Average standard deviation of split frequencies: 0.008871
740500 -- (-410.180) [-409.202] (-410.310) (-412.090) * [-411.867] (-411.602) (-414.295) (-409.766) -- 0:00:15
741000 -- (-413.664) (-410.078) [-409.465] (-411.113) * (-409.404) (-410.825) (-412.464) [-411.627] -- 0:00:15
741500 -- (-410.789) [-409.659] (-410.055) (-412.064) * (-411.281) (-410.671) [-410.262] (-411.500) -- 0:00:15
742000 -- (-409.872) [-409.311] (-410.926) (-409.852) * [-408.781] (-409.790) (-410.485) (-410.694) -- 0:00:15
742500 -- [-413.354] (-411.792) (-411.699) (-410.295) * (-410.531) (-411.879) (-409.663) [-413.361] -- 0:00:15
743000 -- (-416.648) (-410.891) (-413.477) [-409.811] * (-409.510) [-410.082] (-411.209) (-409.767) -- 0:00:15
743500 -- (-411.396) [-411.042] (-410.363) (-412.189) * (-412.471) [-410.399] (-409.110) (-411.268) -- 0:00:15
744000 -- (-415.304) (-414.426) [-409.408] (-410.142) * (-413.939) (-408.972) [-410.976] (-410.260) -- 0:00:15
744500 -- (-408.600) (-414.249) (-410.752) [-409.865] * (-413.467) (-410.469) [-409.923] (-410.683) -- 0:00:15
745000 -- (-411.093) (-411.284) (-408.788) [-408.519] * (-410.072) (-412.546) (-410.134) [-410.987] -- 0:00:15
Average standard deviation of split frequencies: 0.008333
745500 -- (-411.432) (-411.715) (-409.595) [-408.523] * [-410.080] (-410.490) (-409.308) (-414.491) -- 0:00:15
746000 -- (-412.856) (-409.073) (-410.891) [-410.754] * (-412.372) [-409.860] (-408.835) (-410.770) -- 0:00:15
746500 -- (-410.490) (-413.186) [-409.585] (-412.151) * (-413.716) [-411.091] (-409.116) (-412.618) -- 0:00:15
747000 -- (-413.109) [-412.957] (-408.862) (-412.005) * (-413.009) [-410.264] (-409.185) (-409.914) -- 0:00:15
747500 -- (-415.264) [-412.931] (-408.638) (-409.913) * (-411.127) [-412.089] (-409.865) (-409.562) -- 0:00:15
748000 -- (-415.641) (-411.340) (-409.330) [-409.973] * (-409.129) (-417.436) [-410.061] (-412.744) -- 0:00:15
748500 -- (-410.600) (-411.209) [-411.298] (-409.962) * (-409.504) (-411.117) (-409.745) [-410.405] -- 0:00:15
749000 -- (-410.680) (-409.822) (-409.975) [-408.939] * (-411.390) [-413.532] (-409.442) (-410.842) -- 0:00:15
749500 -- [-410.289] (-411.339) (-409.638) (-410.355) * (-410.973) (-409.386) (-410.658) [-410.722] -- 0:00:15
750000 -- [-409.892] (-410.670) (-411.578) (-410.205) * [-410.666] (-411.100) (-414.727) (-409.242) -- 0:00:15
Average standard deviation of split frequencies: 0.008399
750500 -- (-411.178) (-411.680) (-410.089) [-409.424] * (-413.712) (-410.974) [-410.460] (-409.183) -- 0:00:14
751000 -- [-408.824] (-410.017) (-410.277) (-411.495) * (-410.028) (-409.740) [-411.214] (-408.863) -- 0:00:14
751500 -- (-411.114) [-410.489] (-410.982) (-411.822) * (-410.618) (-409.716) (-411.663) [-409.272] -- 0:00:14
752000 -- (-411.733) (-408.724) (-411.093) [-409.544] * (-412.720) (-410.338) (-409.937) [-409.171] -- 0:00:14
752500 -- (-412.307) (-412.516) (-411.892) [-408.757] * (-412.507) (-410.135) (-409.429) [-409.061] -- 0:00:14
753000 -- (-409.833) (-410.358) (-410.789) [-409.978] * (-411.131) (-410.729) (-414.096) [-410.730] -- 0:00:14
753500 -- [-410.576] (-413.915) (-412.690) (-411.487) * (-410.554) (-409.532) [-412.110] (-414.557) -- 0:00:14
754000 -- (-409.543) [-409.763] (-416.726) (-411.387) * (-415.724) [-409.266] (-411.833) (-412.966) -- 0:00:14
754500 -- (-409.194) (-409.523) (-415.340) [-410.943] * (-412.961) (-409.457) (-413.581) [-409.062] -- 0:00:14
755000 -- (-412.108) [-408.705] (-417.021) (-410.420) * (-415.821) (-414.078) (-409.965) [-411.316] -- 0:00:14
Average standard deviation of split frequencies: 0.007989
755500 -- (-411.594) [-409.756] (-412.091) (-411.047) * (-415.272) [-412.198] (-409.823) (-412.329) -- 0:00:14
756000 -- (-411.385) (-410.547) (-414.297) [-411.073] * (-410.792) (-411.507) [-410.073] (-410.755) -- 0:00:14
756500 -- [-409.989] (-409.743) (-412.977) (-413.720) * (-410.531) [-410.206] (-417.436) (-409.061) -- 0:00:14
757000 -- (-410.917) (-409.391) (-411.942) [-412.077] * (-410.464) [-412.449] (-414.808) (-411.564) -- 0:00:14
757500 -- (-410.007) (-411.516) (-410.547) [-410.006] * (-410.292) (-413.238) [-412.216] (-415.940) -- 0:00:14
758000 -- (-410.359) (-410.394) (-410.106) [-412.781] * [-409.612] (-411.671) (-415.683) (-418.430) -- 0:00:14
758500 -- (-412.601) [-412.532] (-409.785) (-409.697) * (-412.415) (-410.706) [-409.176] (-410.236) -- 0:00:14
759000 -- (-415.038) (-410.081) [-412.157] (-410.440) * (-417.563) [-413.579] (-412.731) (-410.587) -- 0:00:14
759500 -- (-414.134) [-408.795] (-412.767) (-411.118) * (-411.479) (-410.683) [-410.574] (-412.039) -- 0:00:14
760000 -- (-413.433) [-409.090] (-415.853) (-410.184) * [-412.302] (-410.776) (-411.046) (-414.131) -- 0:00:14
Average standard deviation of split frequencies: 0.008173
760500 -- (-413.003) [-412.251] (-412.808) (-417.679) * (-412.800) [-412.238] (-411.270) (-413.364) -- 0:00:14
761000 -- (-411.100) [-410.756] (-414.156) (-416.564) * (-410.634) [-410.756] (-413.991) (-410.915) -- 0:00:14
761500 -- [-410.116] (-410.513) (-413.762) (-412.386) * (-411.035) (-409.513) [-411.128] (-411.912) -- 0:00:14
762000 -- (-410.840) [-412.151] (-412.116) (-411.285) * (-411.539) (-409.260) (-411.217) [-410.860] -- 0:00:14
762500 -- (-408.844) [-410.650] (-414.378) (-410.443) * (-412.075) (-414.605) [-409.474] (-410.423) -- 0:00:14
763000 -- [-411.738] (-412.025) (-410.720) (-411.205) * [-409.897] (-415.604) (-409.032) (-409.451) -- 0:00:14
763500 -- (-411.441) [-410.684] (-411.404) (-413.860) * (-410.083) [-409.387] (-411.261) (-409.947) -- 0:00:14
764000 -- (-409.060) [-410.944] (-411.790) (-412.829) * (-412.870) (-412.384) (-409.820) [-414.891] -- 0:00:14
764500 -- [-409.210] (-409.503) (-410.455) (-412.703) * [-408.897] (-413.974) (-413.050) (-409.500) -- 0:00:14
765000 -- (-411.064) (-413.494) [-417.217] (-411.919) * (-412.336) (-412.797) (-411.102) [-409.593] -- 0:00:14
Average standard deviation of split frequencies: 0.007885
765500 -- (-409.479) [-410.034] (-412.639) (-411.232) * (-411.890) (-409.381) (-411.656) [-411.253] -- 0:00:14
766000 -- (-411.221) [-410.981] (-414.720) (-413.660) * (-410.142) (-412.509) [-415.630] (-413.264) -- 0:00:14
766500 -- (-411.843) [-410.742] (-414.899) (-409.241) * (-409.795) (-410.803) (-415.482) [-411.586] -- 0:00:14
767000 -- (-411.110) [-411.729] (-410.996) (-410.913) * [-409.030] (-411.979) (-412.927) (-409.480) -- 0:00:13
767500 -- (-409.909) (-410.532) [-410.017] (-409.513) * [-409.846] (-411.264) (-411.169) (-409.263) -- 0:00:13
768000 -- (-410.067) [-413.413] (-412.340) (-410.960) * (-411.385) (-409.131) [-410.133] (-409.593) -- 0:00:13
768500 -- [-410.264] (-410.875) (-410.256) (-413.599) * (-410.869) (-420.983) [-409.264] (-410.543) -- 0:00:13
769000 -- [-409.432] (-409.994) (-413.456) (-409.849) * (-412.733) (-414.490) [-410.342] (-411.091) -- 0:00:13
769500 -- (-410.621) (-409.829) [-410.000] (-413.798) * [-412.554] (-412.147) (-410.734) (-411.544) -- 0:00:13
770000 -- (-410.951) (-409.141) (-411.529) [-414.962] * (-416.503) (-411.265) (-410.078) [-409.709] -- 0:00:13
Average standard deviation of split frequencies: 0.007531
770500 -- (-410.354) (-412.311) (-412.043) [-409.824] * (-410.779) (-413.000) (-413.475) [-409.217] -- 0:00:13
771000 -- [-410.679] (-414.119) (-411.144) (-413.762) * [-409.851] (-412.696) (-409.366) (-410.285) -- 0:00:13
771500 -- (-410.410) (-412.572) (-409.036) [-410.119] * (-412.161) (-410.314) (-410.880) [-408.834] -- 0:00:13
772000 -- [-410.253] (-415.106) (-409.509) (-410.536) * [-412.223] (-414.977) (-411.264) (-410.494) -- 0:00:13
772500 -- (-413.007) [-410.986] (-409.608) (-412.445) * [-412.139] (-415.796) (-412.261) (-411.271) -- 0:00:13
773000 -- (-412.027) (-409.542) [-410.105] (-411.065) * (-415.165) (-411.018) [-410.749] (-414.122) -- 0:00:13
773500 -- (-411.632) (-409.829) (-409.550) [-411.607] * [-413.195] (-411.182) (-411.766) (-413.391) -- 0:00:13
774000 -- [-413.227] (-410.184) (-409.662) (-410.495) * (-410.719) (-411.569) (-411.342) [-414.543] -- 0:00:13
774500 -- (-411.162) (-410.815) (-409.356) [-408.666] * (-413.113) [-409.274] (-409.786) (-414.877) -- 0:00:13
775000 -- [-411.244] (-410.602) (-409.305) (-409.422) * [-410.689] (-414.194) (-411.271) (-411.372) -- 0:00:13
Average standard deviation of split frequencies: 0.007404
775500 -- (-411.225) (-408.997) (-409.035) [-411.591] * (-411.433) (-415.316) [-413.163] (-411.484) -- 0:00:13
776000 -- (-408.879) (-408.777) (-411.989) [-411.225] * (-411.266) [-410.312] (-412.124) (-410.828) -- 0:00:13
776500 -- (-411.211) (-409.469) (-411.737) [-409.821] * (-409.719) (-410.587) (-410.934) [-409.117] -- 0:00:13
777000 -- (-409.405) (-410.982) (-410.686) [-408.899] * (-412.700) (-409.698) [-411.920] (-411.843) -- 0:00:13
777500 -- [-410.490] (-408.822) (-408.862) (-412.087) * (-412.391) [-411.253] (-413.245) (-411.945) -- 0:00:13
778000 -- (-410.271) (-411.465) (-409.391) [-411.571] * (-411.373) (-413.899) (-411.022) [-410.069] -- 0:00:13
778500 -- (-409.942) [-409.502] (-410.019) (-410.311) * (-410.611) (-412.807) [-410.870] (-410.511) -- 0:00:13
779000 -- (-411.026) (-412.419) [-413.526] (-409.590) * (-410.521) [-410.015] (-411.879) (-410.765) -- 0:00:13
779500 -- (-411.958) [-409.625] (-411.268) (-411.497) * [-409.359] (-414.064) (-409.601) (-414.508) -- 0:00:13
780000 -- (-415.558) (-409.957) (-410.254) [-409.187] * (-411.413) (-409.772) (-410.523) [-410.471] -- 0:00:13
Average standard deviation of split frequencies: 0.006982
780500 -- (-412.289) (-410.271) [-409.449] (-409.957) * (-412.034) (-411.119) [-409.463] (-411.043) -- 0:00:13
781000 -- (-411.582) (-410.689) (-414.209) [-412.682] * [-409.154] (-411.131) (-414.065) (-415.588) -- 0:00:13
781500 -- [-410.095] (-412.252) (-409.622) (-413.056) * [-411.540] (-412.853) (-413.078) (-413.535) -- 0:00:13
782000 -- (-411.266) (-411.978) [-410.298] (-414.026) * (-410.332) (-411.500) [-410.178] (-409.878) -- 0:00:13
782500 -- (-411.438) [-411.312] (-411.515) (-409.689) * (-410.097) (-411.020) [-412.738] (-409.936) -- 0:00:13
783000 -- (-410.119) (-411.709) [-408.710] (-410.086) * (-410.956) (-410.966) [-411.518] (-411.678) -- 0:00:13
783500 -- (-410.218) (-410.478) (-408.468) [-409.301] * [-409.908] (-409.849) (-419.811) (-413.216) -- 0:00:12
784000 -- [-410.482] (-413.396) (-409.524) (-411.668) * [-409.633] (-410.670) (-411.604) (-410.564) -- 0:00:12
784500 -- [-410.322] (-409.192) (-410.565) (-410.179) * (-409.511) (-414.615) (-411.552) [-410.130] -- 0:00:12
785000 -- [-411.339] (-412.757) (-410.313) (-409.646) * [-409.526] (-411.686) (-412.904) (-414.214) -- 0:00:12
Average standard deviation of split frequencies: 0.006972
785500 -- (-408.887) (-411.520) [-412.332] (-409.671) * [-410.129] (-410.258) (-412.921) (-409.845) -- 0:00:12
786000 -- [-410.399] (-413.166) (-409.021) (-413.131) * (-410.307) (-412.947) [-410.311] (-411.883) -- 0:00:12
786500 -- [-410.861] (-414.543) (-409.758) (-409.303) * (-409.948) (-411.279) (-410.149) [-409.049] -- 0:00:12
787000 -- (-409.871) [-413.843] (-411.294) (-410.479) * (-410.986) (-412.058) (-410.042) [-409.271] -- 0:00:12
787500 -- [-411.933] (-409.967) (-410.236) (-409.849) * (-411.194) [-409.874] (-409.649) (-411.216) -- 0:00:12
788000 -- (-413.430) (-410.310) [-412.328] (-408.976) * (-411.263) (-418.288) [-412.012] (-416.575) -- 0:00:12
788500 -- (-411.273) (-409.625) (-410.914) [-409.635] * [-410.749] (-411.548) (-410.350) (-412.353) -- 0:00:12
789000 -- (-411.792) (-413.374) (-411.127) [-409.436] * (-410.286) [-410.350] (-413.278) (-411.484) -- 0:00:12
789500 -- (-414.801) [-409.676] (-408.698) (-411.752) * (-410.523) [-411.000] (-410.732) (-410.619) -- 0:00:12
790000 -- (-411.263) (-410.654) [-411.073] (-413.334) * (-410.309) (-410.207) (-410.200) [-411.826] -- 0:00:12
Average standard deviation of split frequencies: 0.006745
790500 -- (-411.345) (-412.623) (-412.612) [-413.074] * (-409.597) (-411.008) [-411.929] (-413.062) -- 0:00:12
791000 -- (-409.712) (-411.048) (-411.634) [-415.287] * (-410.162) (-409.291) [-408.766] (-412.803) -- 0:00:12
791500 -- (-413.034) (-409.609) (-412.668) [-411.576] * [-410.662] (-409.161) (-415.631) (-411.974) -- 0:00:12
792000 -- [-411.035] (-409.680) (-413.552) (-411.620) * (-411.807) (-410.617) [-413.124] (-411.527) -- 0:00:12
792500 -- (-415.036) [-412.553] (-414.228) (-410.666) * [-411.419] (-410.441) (-410.194) (-409.725) -- 0:00:12
793000 -- (-413.482) [-413.842] (-409.527) (-412.012) * [-410.082] (-409.097) (-410.207) (-409.675) -- 0:00:12
793500 -- (-413.208) (-410.584) (-409.605) [-409.151] * (-413.027) (-413.693) [-409.424] (-411.563) -- 0:00:12
794000 -- (-409.916) (-412.519) (-410.045) [-411.052] * [-412.940] (-410.427) (-413.095) (-408.809) -- 0:00:12
794500 -- (-412.437) [-409.812] (-411.204) (-412.789) * (-412.725) (-413.824) (-410.952) [-409.157] -- 0:00:12
795000 -- [-411.820] (-414.628) (-409.477) (-415.672) * (-408.740) [-410.798] (-412.680) (-411.394) -- 0:00:12
Average standard deviation of split frequencies: 0.006699
795500 -- (-413.875) [-413.016] (-413.127) (-413.333) * (-408.980) (-411.868) [-410.639] (-411.602) -- 0:00:12
796000 -- (-409.788) [-409.368] (-411.739) (-411.289) * (-415.266) (-414.727) (-413.503) [-408.921] -- 0:00:12
796500 -- (-409.827) (-411.697) [-409.388] (-410.182) * (-413.673) (-409.393) (-412.544) [-409.796] -- 0:00:12
797000 -- (-410.500) (-412.179) [-410.046] (-411.936) * (-413.127) [-410.224] (-415.569) (-412.815) -- 0:00:12
797500 -- (-409.561) [-411.323] (-414.734) (-410.919) * (-412.426) (-410.302) (-411.251) [-409.812] -- 0:00:12
798000 -- (-410.389) (-410.202) [-411.660] (-411.804) * (-414.288) (-411.454) [-411.504] (-413.240) -- 0:00:12
798500 -- [-416.173] (-408.864) (-410.805) (-412.709) * [-411.609] (-410.239) (-411.161) (-412.575) -- 0:00:12
799000 -- (-418.409) (-409.866) (-409.079) [-410.766] * [-412.708] (-410.281) (-410.207) (-414.324) -- 0:00:12
799500 -- (-410.665) (-409.001) [-411.686] (-412.435) * [-411.575] (-410.035) (-411.418) (-415.074) -- 0:00:12
800000 -- (-411.418) (-410.473) [-409.922] (-410.790) * [-410.309] (-410.202) (-411.706) (-415.121) -- 0:00:12
Average standard deviation of split frequencies: 0.006844
800500 -- (-410.323) (-412.480) [-410.872] (-409.380) * [-409.676] (-410.314) (-411.057) (-415.406) -- 0:00:11
801000 -- (-409.787) [-410.644] (-410.180) (-411.721) * (-408.744) (-413.293) (-409.893) [-410.472] -- 0:00:11
801500 -- (-409.127) [-410.244] (-408.958) (-409.769) * (-408.804) (-410.291) (-411.821) [-411.021] -- 0:00:11
802000 -- (-413.936) (-410.570) (-409.277) [-409.427] * [-409.724] (-411.777) (-409.348) (-411.161) -- 0:00:11
802500 -- (-413.194) (-409.586) [-410.761] (-409.767) * [-413.978] (-413.426) (-414.136) (-410.640) -- 0:00:11
803000 -- (-413.149) (-411.218) (-413.241) [-414.022] * (-413.911) [-409.066] (-412.205) (-410.693) -- 0:00:11
803500 -- (-409.560) (-411.533) (-414.307) [-412.221] * (-410.134) (-411.199) [-410.232] (-408.935) -- 0:00:11
804000 -- [-408.643] (-412.095) (-409.450) (-411.868) * (-408.779) [-410.583] (-409.307) (-410.599) -- 0:00:11
804500 -- (-408.695) (-410.243) (-409.426) [-409.413] * [-411.683] (-410.618) (-410.053) (-414.914) -- 0:00:11
805000 -- (-411.418) (-409.897) [-410.343] (-415.262) * (-410.080) [-410.004] (-411.938) (-412.600) -- 0:00:11
Average standard deviation of split frequencies: 0.006945
805500 -- (-409.640) (-413.774) (-411.645) [-414.137] * (-409.568) [-412.497] (-412.388) (-414.816) -- 0:00:11
806000 -- [-411.352] (-412.515) (-410.622) (-411.278) * (-412.373) (-410.869) (-409.813) [-409.269] -- 0:00:11
806500 -- (-412.912) [-410.660] (-409.445) (-409.774) * (-411.348) (-409.314) [-409.880] (-410.015) -- 0:00:11
807000 -- (-413.293) (-409.908) [-409.177] (-411.363) * [-411.170] (-409.922) (-413.309) (-411.974) -- 0:00:11
807500 -- (-412.813) [-411.373] (-411.193) (-409.253) * (-410.590) (-414.128) [-409.036] (-410.972) -- 0:00:11
808000 -- (-412.595) (-411.060) [-410.459] (-415.661) * (-412.019) [-409.460] (-409.082) (-411.687) -- 0:00:11
808500 -- (-411.302) (-412.428) [-414.280] (-413.591) * [-413.381] (-411.603) (-412.209) (-412.467) -- 0:00:11
809000 -- (-411.052) (-411.752) (-410.369) [-413.234] * (-415.113) (-409.693) (-412.695) [-410.818] -- 0:00:11
809500 -- [-409.408] (-411.064) (-409.366) (-409.877) * [-410.403] (-409.367) (-412.448) (-410.219) -- 0:00:11
810000 -- (-409.036) (-410.813) [-409.378] (-409.308) * [-409.872] (-412.727) (-418.633) (-410.298) -- 0:00:11
Average standard deviation of split frequencies: 0.007196
810500 -- (-410.968) (-412.934) [-411.541] (-410.264) * (-413.956) (-409.347) (-412.679) [-409.545] -- 0:00:11
811000 -- [-409.706] (-409.868) (-412.088) (-410.358) * [-411.188] (-412.649) (-411.935) (-409.394) -- 0:00:11
811500 -- (-410.545) (-414.461) [-411.846] (-410.711) * (-409.523) (-411.392) [-411.509] (-409.492) -- 0:00:11
812000 -- (-412.332) [-413.105] (-410.173) (-409.972) * [-408.909] (-411.249) (-411.024) (-409.858) -- 0:00:11
812500 -- (-410.099) (-411.150) [-409.871] (-410.162) * [-408.795] (-408.837) (-410.840) (-412.956) -- 0:00:11
813000 -- (-410.322) (-410.907) (-412.716) [-411.805] * (-409.909) (-411.101) [-411.644] (-412.242) -- 0:00:11
813500 -- (-410.395) (-413.054) [-409.717] (-411.594) * (-408.804) (-411.650) [-411.553] (-411.507) -- 0:00:11
814000 -- (-410.320) [-409.701] (-410.110) (-409.127) * (-411.335) (-414.168) (-412.963) [-409.643] -- 0:00:11
814500 -- [-411.045] (-409.969) (-409.142) (-410.908) * [-410.195] (-415.349) (-410.943) (-408.873) -- 0:00:11
815000 -- (-412.620) [-410.884] (-408.910) (-412.892) * [-411.850] (-410.410) (-410.825) (-409.756) -- 0:00:11
Average standard deviation of split frequencies: 0.007113
815500 -- (-410.253) (-417.270) [-409.591] (-408.965) * [-410.025] (-412.494) (-409.646) (-411.188) -- 0:00:11
816000 -- [-409.016] (-411.955) (-414.641) (-409.355) * (-410.208) [-409.505] (-412.464) (-410.735) -- 0:00:11
816500 -- (-410.288) (-414.626) [-414.024] (-410.672) * (-410.365) (-409.438) [-415.250] (-409.171) -- 0:00:11
817000 -- [-410.608] (-412.159) (-409.373) (-412.085) * [-410.759] (-411.963) (-409.884) (-414.485) -- 0:00:10
817500 -- (-409.900) (-409.084) [-412.363] (-413.861) * (-408.830) (-411.754) (-409.130) [-409.670] -- 0:00:10
818000 -- (-409.866) (-409.121) (-410.356) [-410.859] * (-409.063) [-412.287] (-412.229) (-409.329) -- 0:00:10
818500 -- (-408.937) [-410.242] (-410.991) (-413.270) * (-410.884) [-410.116] (-413.308) (-412.334) -- 0:00:10
819000 -- (-408.789) [-408.474] (-411.014) (-410.546) * (-413.095) (-410.692) [-410.293] (-410.604) -- 0:00:10
819500 -- [-409.498] (-408.964) (-411.731) (-412.394) * [-411.445] (-410.651) (-410.024) (-410.981) -- 0:00:10
820000 -- [-409.300] (-415.819) (-411.607) (-412.845) * (-409.149) [-409.454] (-412.773) (-408.834) -- 0:00:10
Average standard deviation of split frequencies: 0.007216
820500 -- (-409.893) (-410.158) (-416.948) [-408.784] * (-409.368) [-413.548] (-409.988) (-410.768) -- 0:00:10
821000 -- [-410.777] (-413.078) (-409.790) (-410.217) * (-410.631) [-412.798] (-409.831) (-409.474) -- 0:00:10
821500 -- [-411.569] (-409.751) (-410.487) (-409.473) * (-411.257) (-409.836) [-409.250] (-410.685) -- 0:00:10
822000 -- (-409.839) (-410.821) [-411.913] (-409.979) * (-415.828) (-409.123) [-410.267] (-411.205) -- 0:00:10
822500 -- (-409.751) (-408.658) [-409.903] (-410.005) * (-413.178) (-412.730) [-411.289] (-409.694) -- 0:00:10
823000 -- (-410.153) (-409.862) [-413.579] (-408.991) * [-409.963] (-413.561) (-410.666) (-409.597) -- 0:00:10
823500 -- [-410.817] (-411.905) (-409.923) (-411.954) * (-412.438) (-411.271) (-411.249) [-409.200] -- 0:00:10
824000 -- [-411.763] (-410.772) (-412.301) (-409.021) * (-417.166) (-411.607) (-410.131) [-409.959] -- 0:00:10
824500 -- (-410.327) (-413.155) [-411.512] (-413.008) * (-413.495) [-412.023] (-411.662) (-412.676) -- 0:00:10
825000 -- (-411.787) (-413.648) [-409.506] (-412.324) * [-410.328] (-416.185) (-415.975) (-411.673) -- 0:00:10
Average standard deviation of split frequencies: 0.007455
825500 -- (-410.105) (-410.687) [-414.665] (-413.559) * (-412.454) (-412.740) (-410.264) [-410.700] -- 0:00:10
826000 -- (-408.636) (-415.509) [-412.933] (-414.681) * (-414.485) (-413.066) (-411.462) [-409.792] -- 0:00:10
826500 -- [-410.916] (-409.851) (-414.978) (-410.737) * (-410.311) [-415.890] (-412.454) (-411.434) -- 0:00:10
827000 -- (-409.499) (-412.120) [-410.247] (-409.526) * (-412.029) [-416.980] (-409.152) (-411.113) -- 0:00:10
827500 -- [-410.195] (-409.998) (-409.794) (-411.963) * (-410.913) (-409.392) (-411.272) [-410.540] -- 0:00:10
828000 -- [-409.511] (-412.253) (-409.445) (-412.297) * (-410.176) [-409.899] (-410.847) (-411.951) -- 0:00:10
828500 -- (-414.668) (-408.828) [-411.740] (-409.966) * (-409.108) (-409.135) (-411.196) [-410.790] -- 0:00:10
829000 -- (-414.975) (-409.815) [-410.867] (-408.889) * (-410.715) (-412.347) [-409.439] (-409.826) -- 0:00:10
829500 -- [-410.593] (-411.515) (-411.790) (-408.726) * (-411.205) [-410.393] (-415.359) (-409.808) -- 0:00:10
830000 -- (-411.042) [-413.797] (-411.233) (-409.461) * [-410.249] (-414.844) (-411.494) (-409.579) -- 0:00:10
Average standard deviation of split frequencies: 0.007378
830500 -- (-409.221) (-408.909) [-409.562] (-411.910) * [-411.107] (-411.148) (-410.912) (-410.252) -- 0:00:10
831000 -- (-412.788) [-411.173] (-413.233) (-412.776) * (-411.834) (-412.659) [-411.285] (-413.204) -- 0:00:10
831500 -- (-410.053) (-409.942) [-416.438] (-411.026) * (-411.021) (-410.871) (-413.168) [-409.968] -- 0:00:10
832000 -- [-409.166] (-409.079) (-411.260) (-412.407) * (-411.205) [-411.180] (-409.916) (-410.605) -- 0:00:10
832500 -- [-409.671] (-408.975) (-408.854) (-411.924) * (-412.829) (-414.542) [-408.936] (-409.672) -- 0:00:10
833000 -- [-411.324] (-409.582) (-411.496) (-413.774) * (-409.753) (-411.561) (-409.460) [-410.737] -- 0:00:10
833500 -- (-411.398) (-411.517) (-410.125) [-409.171] * (-410.261) (-411.952) (-412.958) [-410.008] -- 0:00:09
834000 -- (-409.961) (-412.458) [-409.987] (-410.639) * (-410.344) (-414.733) [-412.030] (-409.801) -- 0:00:09
834500 -- (-412.865) (-411.327) [-411.190] (-410.271) * [-409.491] (-412.118) (-410.044) (-408.737) -- 0:00:09
835000 -- [-410.860] (-413.876) (-412.756) (-414.015) * (-410.721) (-410.761) [-411.929] (-409.221) -- 0:00:09
Average standard deviation of split frequencies: 0.007718
835500 -- (-408.922) (-415.480) [-414.258] (-412.871) * (-411.806) (-409.584) [-410.027] (-414.319) -- 0:00:09
836000 -- (-410.259) [-410.302] (-411.587) (-414.294) * (-410.866) [-411.141] (-410.700) (-409.094) -- 0:00:09
836500 -- (-411.018) (-409.484) (-411.340) [-410.436] * [-409.880] (-409.179) (-410.158) (-409.423) -- 0:00:09
837000 -- (-411.392) (-412.069) (-411.787) [-414.051] * [-409.765] (-409.618) (-411.034) (-408.958) -- 0:00:09
837500 -- [-408.588] (-412.175) (-411.586) (-409.537) * (-411.345) (-411.031) [-411.125] (-411.486) -- 0:00:09
838000 -- (-410.305) (-412.997) [-410.654] (-411.970) * (-412.605) (-415.545) [-410.076] (-409.812) -- 0:00:09
838500 -- (-409.815) [-409.844] (-411.919) (-412.454) * (-411.835) (-409.539) [-410.266] (-411.875) -- 0:00:09
839000 -- [-409.715] (-411.052) (-413.850) (-414.030) * (-410.392) (-410.974) [-410.436] (-411.547) -- 0:00:09
839500 -- (-409.798) [-409.309] (-410.305) (-414.302) * (-410.543) [-409.285] (-409.413) (-412.561) -- 0:00:09
840000 -- [-410.705] (-414.863) (-410.013) (-412.458) * (-416.261) [-408.638] (-412.974) (-414.144) -- 0:00:09
Average standard deviation of split frequencies: 0.007745
840500 -- (-412.009) (-409.973) (-412.689) [-412.772] * [-411.910] (-408.835) (-410.469) (-410.429) -- 0:00:09
841000 -- [-410.419] (-409.735) (-410.165) (-411.197) * (-412.127) (-408.962) [-411.510] (-413.164) -- 0:00:09
841500 -- (-410.505) [-408.552] (-413.797) (-412.037) * [-414.443] (-410.561) (-411.912) (-411.988) -- 0:00:09
842000 -- (-412.734) (-410.894) (-413.371) [-410.472] * (-415.542) (-410.246) (-411.987) [-410.253] -- 0:00:09
842500 -- (-411.762) (-411.825) [-410.186] (-409.706) * (-412.241) (-411.246) [-408.671] (-412.219) -- 0:00:09
843000 -- (-409.941) (-411.074) (-409.906) [-409.550] * (-411.405) [-414.554] (-408.906) (-412.499) -- 0:00:09
843500 -- [-410.210] (-410.988) (-413.251) (-410.370) * (-410.569) (-412.023) [-409.697] (-411.053) -- 0:00:09
844000 -- (-409.655) [-416.626] (-410.672) (-409.668) * (-409.207) (-409.403) (-409.677) [-410.987] -- 0:00:09
844500 -- [-410.436] (-408.930) (-409.710) (-409.995) * [-410.057] (-409.421) (-408.881) (-414.470) -- 0:00:09
845000 -- [-409.707] (-409.398) (-412.579) (-411.318) * (-410.737) (-412.883) [-409.441] (-409.454) -- 0:00:09
Average standard deviation of split frequencies: 0.007836
845500 -- (-409.370) (-412.275) (-413.944) [-410.819] * [-411.057] (-410.774) (-410.145) (-412.848) -- 0:00:09
846000 -- [-409.720] (-410.321) (-416.357) (-412.111) * [-411.546] (-410.376) (-413.342) (-412.038) -- 0:00:09
846500 -- [-409.213] (-411.359) (-413.568) (-410.993) * [-413.639] (-411.613) (-410.455) (-412.041) -- 0:00:09
847000 -- (-409.601) [-410.350] (-411.307) (-410.030) * [-411.881] (-409.732) (-409.066) (-409.372) -- 0:00:09
847500 -- [-409.801] (-411.430) (-410.957) (-412.895) * (-410.323) [-408.829] (-412.016) (-415.388) -- 0:00:09
848000 -- (-409.321) (-420.315) [-409.818] (-412.471) * (-409.754) (-413.740) (-411.617) [-411.919] -- 0:00:09
848500 -- [-410.192] (-408.932) (-409.758) (-409.162) * (-410.452) (-411.095) [-413.576] (-412.909) -- 0:00:09
849000 -- (-412.868) (-415.074) [-411.104] (-412.372) * (-411.656) [-412.021] (-413.013) (-410.094) -- 0:00:09
849500 -- [-409.739] (-415.257) (-411.485) (-412.676) * (-410.699) [-410.390] (-410.688) (-412.156) -- 0:00:09
850000 -- (-411.338) [-410.537] (-410.408) (-411.970) * (-411.751) (-410.619) (-410.952) [-410.842] -- 0:00:09
Average standard deviation of split frequencies: 0.007100
850500 -- [-413.820] (-412.378) (-408.897) (-411.030) * (-409.841) (-411.093) [-411.346] (-410.023) -- 0:00:08
851000 -- (-414.311) (-410.055) [-408.492] (-411.054) * [-411.596] (-410.376) (-412.003) (-411.050) -- 0:00:08
851500 -- (-410.894) (-414.437) (-411.252) [-411.034] * (-412.730) (-409.541) (-414.794) [-409.978] -- 0:00:08
852000 -- (-409.660) (-412.810) (-411.127) [-412.046] * [-411.784] (-415.853) (-411.797) (-415.164) -- 0:00:08
852500 -- (-411.966) [-411.393] (-413.626) (-411.560) * (-409.365) [-413.456] (-412.884) (-414.881) -- 0:00:08
853000 -- (-412.628) (-411.301) [-410.695] (-412.078) * (-409.724) [-411.551] (-409.461) (-411.464) -- 0:00:08
853500 -- (-411.829) (-413.136) [-413.175] (-413.120) * (-410.835) (-411.511) [-410.038] (-411.952) -- 0:00:08
854000 -- (-414.382) (-410.706) (-414.481) [-414.305] * (-409.497) (-412.831) [-412.533] (-412.480) -- 0:00:08
854500 -- (-410.526) (-411.242) (-414.197) [-409.222] * [-408.607] (-410.775) (-412.349) (-416.410) -- 0:00:08
855000 -- (-409.604) [-409.204] (-409.735) (-411.686) * (-410.996) [-409.753] (-410.381) (-409.560) -- 0:00:08
Average standard deviation of split frequencies: 0.007056
855500 -- (-409.706) (-409.596) [-415.621] (-410.218) * (-409.209) [-409.569] (-410.057) (-414.752) -- 0:00:08
856000 -- (-415.357) [-409.172] (-410.909) (-410.613) * (-412.872) [-409.657] (-411.988) (-411.946) -- 0:00:08
856500 -- (-415.082) (-410.025) (-411.195) [-411.370] * [-409.985] (-409.375) (-409.650) (-410.315) -- 0:00:08
857000 -- (-410.484) (-410.105) (-412.062) [-412.639] * [-409.729] (-411.816) (-412.325) (-410.727) -- 0:00:08
857500 -- (-409.741) (-410.410) [-411.548] (-411.195) * (-409.427) (-411.665) [-410.290] (-411.704) -- 0:00:08
858000 -- [-410.011] (-410.238) (-412.430) (-412.453) * (-411.349) (-412.166) [-412.003] (-414.337) -- 0:00:08
858500 -- (-412.425) [-410.552] (-413.917) (-412.671) * (-411.785) (-414.855) (-408.750) [-410.436] -- 0:00:08
859000 -- [-408.967] (-410.977) (-411.573) (-409.063) * [-410.327] (-412.062) (-409.321) (-410.440) -- 0:00:08
859500 -- (-409.270) [-408.712] (-413.333) (-409.165) * [-413.206] (-410.576) (-410.699) (-413.199) -- 0:00:08
860000 -- (-409.998) (-409.725) (-410.533) [-413.127] * [-409.819] (-413.165) (-411.725) (-414.214) -- 0:00:08
Average standard deviation of split frequencies: 0.006881
860500 -- (-410.319) [-409.186] (-416.200) (-412.211) * (-410.055) (-410.591) (-411.139) [-411.021] -- 0:00:08
861000 -- [-408.927] (-410.901) (-411.331) (-412.668) * (-411.380) (-410.708) (-412.186) [-411.789] -- 0:00:08
861500 -- (-409.935) (-413.431) [-410.309] (-413.422) * (-411.516) [-410.111] (-411.880) (-411.614) -- 0:00:08
862000 -- (-409.358) (-413.832) [-408.930] (-412.311) * [-408.943] (-412.997) (-410.530) (-413.018) -- 0:00:08
862500 -- [-409.775] (-411.835) (-409.313) (-417.721) * (-408.750) [-413.116] (-409.233) (-410.884) -- 0:00:08
863000 -- (-410.692) [-410.844] (-410.004) (-411.052) * (-410.046) [-411.198] (-411.825) (-410.015) -- 0:00:08
863500 -- [-414.153] (-411.421) (-409.485) (-411.786) * (-409.776) [-412.286] (-411.055) (-409.997) -- 0:00:08
864000 -- [-409.509] (-411.402) (-410.967) (-409.428) * (-410.568) (-410.789) [-410.400] (-411.146) -- 0:00:08
864500 -- [-409.694] (-411.845) (-409.575) (-409.122) * (-409.557) (-409.557) [-411.366] (-411.360) -- 0:00:08
865000 -- (-413.818) (-411.547) [-409.330] (-409.295) * (-408.884) (-411.255) (-411.686) [-416.245] -- 0:00:08
Average standard deviation of split frequencies: 0.007553
865500 -- (-412.007) [-409.096] (-409.628) (-411.136) * (-410.714) [-410.630] (-413.531) (-413.528) -- 0:00:08
866000 -- (-413.626) (-411.305) [-411.189] (-413.628) * (-409.634) [-409.586] (-412.632) (-409.009) -- 0:00:08
866500 -- (-415.585) (-410.488) (-411.205) [-409.212] * (-412.034) (-411.869) [-412.101] (-409.467) -- 0:00:08
867000 -- (-411.231) (-409.241) [-409.696] (-414.149) * (-411.634) (-411.565) (-412.283) [-412.963] -- 0:00:07
867500 -- (-408.782) (-410.838) [-409.441] (-413.001) * [-409.490] (-410.016) (-411.396) (-410.974) -- 0:00:07
868000 -- (-410.480) (-411.558) [-411.711] (-409.628) * [-409.528] (-410.747) (-411.762) (-410.650) -- 0:00:07
868500 -- (-409.412) (-413.359) (-412.418) [-412.192] * (-410.136) (-413.635) [-410.646] (-410.410) -- 0:00:07
869000 -- (-415.566) (-413.757) (-411.392) [-409.055] * (-413.629) [-409.620] (-419.936) (-412.021) -- 0:00:07
869500 -- (-414.235) (-409.083) (-412.041) [-411.159] * (-410.804) (-411.455) [-418.813] (-410.012) -- 0:00:07
870000 -- (-411.692) (-410.934) [-412.189] (-409.140) * (-408.572) (-412.041) [-414.388] (-410.427) -- 0:00:07
Average standard deviation of split frequencies: 0.007478
870500 -- [-410.388] (-409.084) (-409.902) (-409.735) * (-408.938) (-410.388) (-409.463) [-412.000] -- 0:00:07
871000 -- (-409.601) [-408.996] (-410.375) (-410.750) * (-409.442) (-412.061) [-409.345] (-410.108) -- 0:00:07
871500 -- (-408.905) [-410.278] (-408.823) (-409.482) * [-412.961] (-409.241) (-412.909) (-412.064) -- 0:00:07
872000 -- (-410.764) (-410.514) (-411.334) [-410.226] * (-411.527) [-412.875] (-411.994) (-410.810) -- 0:00:07
872500 -- (-414.067) (-412.522) [-410.011] (-410.651) * (-410.854) [-408.940] (-411.364) (-409.329) -- 0:00:07
873000 -- (-408.648) [-412.049] (-410.155) (-411.965) * [-410.758] (-411.986) (-410.715) (-410.376) -- 0:00:07
873500 -- [-411.904] (-413.590) (-413.126) (-410.781) * (-409.693) (-410.853) [-413.990] (-411.011) -- 0:00:07
874000 -- [-410.519] (-412.201) (-412.650) (-409.304) * (-411.548) (-413.136) [-411.457] (-410.387) -- 0:00:07
874500 -- (-411.032) (-414.987) [-409.732] (-413.267) * (-413.048) (-411.256) (-414.293) [-414.950] -- 0:00:07
875000 -- [-409.473] (-410.794) (-410.599) (-416.177) * (-409.861) (-411.214) (-409.549) [-412.088] -- 0:00:07
Average standard deviation of split frequencies: 0.007332
875500 -- [-413.799] (-411.681) (-409.387) (-411.562) * (-410.525) (-411.779) [-410.026] (-411.315) -- 0:00:07
876000 -- (-410.733) [-409.822] (-412.216) (-411.897) * [-410.686] (-410.009) (-409.569) (-408.982) -- 0:00:07
876500 -- (-417.882) [-408.793] (-412.438) (-410.843) * [-411.174] (-417.548) (-409.198) (-411.959) -- 0:00:07
877000 -- (-414.149) (-410.790) [-411.481] (-410.723) * (-410.453) (-411.514) [-412.269] (-410.478) -- 0:00:07
877500 -- [-410.719] (-409.942) (-411.352) (-409.391) * (-410.568) (-408.865) (-416.043) [-410.263] -- 0:00:07
878000 -- [-410.135] (-411.918) (-408.621) (-409.996) * (-412.630) (-411.602) (-413.415) [-408.855] -- 0:00:07
878500 -- (-411.051) (-409.738) (-409.417) [-410.285] * (-409.689) [-410.793] (-411.778) (-408.730) -- 0:00:07
879000 -- (-410.696) [-409.508] (-413.233) (-410.618) * (-410.751) (-409.666) [-413.576] (-412.186) -- 0:00:07
879500 -- (-411.769) (-411.009) [-412.513] (-409.387) * (-413.148) [-409.335] (-411.144) (-412.569) -- 0:00:07
880000 -- (-410.887) (-411.775) (-410.619) [-410.163] * (-410.357) [-409.462] (-410.441) (-412.140) -- 0:00:07
Average standard deviation of split frequencies: 0.006791
880500 -- (-413.473) (-411.330) [-409.187] (-412.662) * (-409.724) (-410.904) (-414.081) [-411.553] -- 0:00:07
881000 -- (-414.122) [-410.050] (-411.548) (-410.164) * (-412.183) (-410.759) (-413.955) [-412.205] -- 0:00:07
881500 -- (-415.534) [-412.243] (-410.073) (-411.680) * (-415.599) [-410.634] (-412.353) (-413.170) -- 0:00:07
882000 -- [-410.504] (-409.151) (-410.959) (-413.148) * (-409.515) (-411.025) [-411.919] (-409.136) -- 0:00:07
882500 -- (-410.282) (-408.698) [-413.139] (-413.933) * [-408.882] (-413.983) (-410.217) (-410.237) -- 0:00:07
883000 -- (-410.550) (-412.680) (-413.552) [-411.860] * (-410.721) [-410.027] (-411.223) (-413.803) -- 0:00:07
883500 -- (-413.031) [-409.319] (-414.517) (-410.769) * (-412.063) [-410.227] (-408.937) (-412.648) -- 0:00:06
884000 -- [-410.344] (-413.553) (-412.757) (-415.650) * (-411.727) (-412.235) (-413.526) [-411.688] -- 0:00:06
884500 -- (-411.960) (-409.600) (-409.948) [-410.258] * (-414.312) (-411.654) (-411.842) [-410.795] -- 0:00:06
885000 -- [-410.462] (-409.950) (-413.719) (-411.979) * (-410.921) (-409.586) (-412.000) [-414.154] -- 0:00:06
Average standard deviation of split frequencies: 0.006917
885500 -- (-410.340) (-410.243) [-410.970] (-409.707) * [-410.700] (-409.077) (-414.177) (-410.079) -- 0:00:06
886000 -- (-411.516) (-413.649) [-408.934] (-409.293) * [-409.033] (-412.754) (-411.899) (-409.195) -- 0:00:06
886500 -- (-410.932) [-411.526] (-411.425) (-410.133) * (-413.136) (-408.821) [-412.828] (-410.170) -- 0:00:06
887000 -- (-411.371) (-411.109) [-411.193] (-410.031) * (-409.934) [-409.288] (-411.282) (-412.094) -- 0:00:06
887500 -- (-410.065) [-411.124] (-411.954) (-411.517) * [-411.253] (-410.902) (-411.867) (-410.471) -- 0:00:06
888000 -- [-414.465] (-410.842) (-408.910) (-411.035) * (-410.283) [-410.776] (-412.757) (-409.303) -- 0:00:06
888500 -- [-410.590] (-411.592) (-409.202) (-409.526) * (-409.767) (-411.690) [-411.420] (-409.135) -- 0:00:06
889000 -- (-411.565) [-409.652] (-410.750) (-409.853) * [-410.882] (-409.213) (-409.946) (-417.054) -- 0:00:06
889500 -- (-414.457) (-412.781) (-410.142) [-411.381] * (-410.982) (-412.042) [-411.193] (-412.407) -- 0:00:06
890000 -- (-410.271) (-411.465) (-409.248) [-409.259] * (-414.305) (-409.350) [-412.724] (-411.504) -- 0:00:06
Average standard deviation of split frequencies: 0.006881
890500 -- (-410.577) [-412.219] (-410.739) (-411.359) * (-413.493) [-410.529] (-409.720) (-411.101) -- 0:00:06
891000 -- (-411.126) (-413.882) [-410.368] (-408.870) * [-411.550] (-410.646) (-412.149) (-410.625) -- 0:00:06
891500 -- (-410.193) [-409.514] (-411.747) (-408.814) * (-412.507) (-412.537) (-414.080) [-411.677] -- 0:00:06
892000 -- (-409.642) [-413.065] (-410.985) (-410.452) * (-415.659) (-411.613) [-414.238] (-410.446) -- 0:00:06
892500 -- (-409.267) (-411.591) (-410.193) [-409.909] * [-410.522] (-413.302) (-411.132) (-412.958) -- 0:00:06
893000 -- (-409.314) (-413.416) (-409.838) [-411.360] * [-408.926] (-412.670) (-414.071) (-411.630) -- 0:00:06
893500 -- (-411.946) (-410.920) (-414.099) [-410.515] * [-411.820] (-410.461) (-409.615) (-411.256) -- 0:00:06
894000 -- (-411.037) (-410.861) [-410.410] (-409.048) * [-411.904] (-409.912) (-411.483) (-410.261) -- 0:00:06
894500 -- (-410.189) (-408.839) (-409.201) [-411.263] * (-412.944) [-411.140] (-411.484) (-414.794) -- 0:00:06
895000 -- (-409.426) [-410.836] (-411.055) (-420.969) * (-412.664) [-410.324] (-410.150) (-410.720) -- 0:00:06
Average standard deviation of split frequencies: 0.006675
895500 -- (-410.243) (-413.152) (-410.869) [-412.989] * (-411.300) (-411.545) (-409.006) [-409.581] -- 0:00:06
896000 -- [-409.917] (-409.996) (-409.349) (-410.192) * [-411.542] (-417.269) (-412.862) (-410.098) -- 0:00:06
896500 -- [-410.459] (-409.003) (-410.621) (-412.099) * [-409.171] (-409.751) (-413.014) (-410.420) -- 0:00:06
897000 -- [-409.178] (-410.493) (-410.301) (-411.994) * (-412.351) [-411.181] (-409.316) (-413.054) -- 0:00:06
897500 -- (-409.420) (-415.228) [-413.038] (-411.502) * (-410.090) (-412.760) [-412.757] (-409.946) -- 0:00:06
898000 -- (-409.432) [-409.184] (-415.015) (-410.212) * [-411.928] (-411.254) (-410.092) (-414.045) -- 0:00:06
898500 -- (-411.729) [-408.985] (-410.072) (-409.706) * (-410.421) (-413.579) (-411.396) [-410.298] -- 0:00:06
899000 -- (-409.952) [-409.670] (-408.496) (-410.584) * (-411.054) (-423.414) [-411.931] (-411.642) -- 0:00:06
899500 -- (-410.514) (-411.989) [-411.571] (-410.611) * (-410.524) (-421.932) (-411.262) [-410.912] -- 0:00:06
900000 -- (-410.962) [-410.118] (-413.211) (-410.455) * (-409.422) (-414.572) [-411.397] (-409.961) -- 0:00:06
Average standard deviation of split frequencies: 0.007066
900500 -- [-411.729] (-409.654) (-410.940) (-408.921) * (-409.285) (-411.984) [-410.064] (-412.755) -- 0:00:05
901000 -- (-412.327) [-409.457] (-411.755) (-410.078) * (-410.119) [-410.180] (-412.676) (-409.426) -- 0:00:05
901500 -- [-414.975] (-409.712) (-411.274) (-411.344) * (-414.454) (-408.472) (-410.334) [-412.845] -- 0:00:05
902000 -- (-416.721) (-412.350) [-409.448] (-410.285) * [-412.700] (-411.034) (-412.043) (-409.398) -- 0:00:05
902500 -- (-411.882) [-419.724] (-409.254) (-413.375) * [-412.250] (-412.163) (-411.534) (-410.966) -- 0:00:05
903000 -- (-412.392) (-410.641) (-410.216) [-409.470] * (-411.453) (-417.654) (-410.184) [-410.895] -- 0:00:05
903500 -- [-413.614] (-411.317) (-409.461) (-409.833) * [-412.017] (-413.918) (-412.456) (-411.731) -- 0:00:05
904000 -- (-411.684) (-410.567) (-409.321) [-411.284] * [-409.608] (-411.314) (-411.005) (-411.423) -- 0:00:05
904500 -- [-410.682] (-412.407) (-410.406) (-410.420) * (-410.106) [-410.905] (-410.055) (-410.317) -- 0:00:05
905000 -- (-409.024) [-416.347] (-410.168) (-410.210) * (-408.983) (-411.479) (-408.992) [-410.996] -- 0:00:05
Average standard deviation of split frequencies: 0.006406
905500 -- (-410.215) (-411.600) [-413.537] (-410.708) * [-409.380] (-411.812) (-409.635) (-412.452) -- 0:00:05
906000 -- (-410.245) (-412.617) [-410.707] (-409.725) * (-411.937) [-411.713] (-409.388) (-414.143) -- 0:00:05
906500 -- (-412.821) (-415.260) (-409.473) [-409.820] * (-412.126) [-412.903] (-409.950) (-409.789) -- 0:00:05
907000 -- (-409.689) (-409.166) (-409.239) [-409.439] * (-409.577) (-413.408) (-414.847) [-409.604] -- 0:00:05
907500 -- [-409.181] (-415.876) (-410.023) (-409.478) * (-415.577) [-410.923] (-410.703) (-409.154) -- 0:00:05
908000 -- [-410.103] (-411.534) (-411.700) (-412.191) * [-410.341] (-410.675) (-412.253) (-409.217) -- 0:00:05
908500 -- [-414.494] (-411.161) (-412.754) (-411.493) * [-412.836] (-412.791) (-412.118) (-409.862) -- 0:00:05
909000 -- (-411.059) (-414.222) [-412.486] (-413.250) * (-409.204) (-409.068) (-412.363) [-410.092] -- 0:00:05
909500 -- (-411.959) (-410.843) [-410.756] (-412.012) * (-410.899) (-415.027) (-411.249) [-413.275] -- 0:00:05
910000 -- (-411.873) (-412.296) (-411.132) [-409.125] * [-411.901] (-410.683) (-412.872) (-414.278) -- 0:00:05
Average standard deviation of split frequencies: 0.006115
910500 -- (-411.873) [-414.293] (-410.780) (-409.906) * [-409.759] (-411.586) (-411.846) (-412.608) -- 0:00:05
911000 -- (-412.371) (-414.614) (-412.864) [-409.862] * [-409.124] (-413.810) (-411.205) (-412.082) -- 0:00:05
911500 -- (-409.448) (-411.191) [-412.235] (-412.852) * [-410.018] (-414.855) (-412.339) (-410.316) -- 0:00:05
912000 -- (-412.304) [-413.227] (-411.023) (-410.054) * (-412.279) (-414.894) [-410.006] (-409.102) -- 0:00:05
912500 -- (-410.908) (-410.195) (-412.443) [-408.607] * [-409.002] (-411.331) (-409.285) (-409.395) -- 0:00:05
913000 -- (-410.791) (-411.545) [-411.128] (-409.037) * (-408.680) [-409.239] (-408.810) (-411.169) -- 0:00:05
913500 -- (-411.344) (-410.316) [-413.637] (-416.222) * (-409.192) (-409.975) [-409.401] (-411.739) -- 0:00:05
914000 -- (-409.498) (-410.882) [-414.853] (-413.472) * (-415.833) (-411.152) (-409.448) [-410.128] -- 0:00:05
914500 -- (-412.097) (-411.817) (-411.516) [-412.545] * [-410.985] (-409.737) (-408.856) (-409.237) -- 0:00:05
915000 -- (-411.351) (-410.609) [-410.516] (-410.461) * (-409.829) [-410.197] (-408.661) (-409.083) -- 0:00:05
Average standard deviation of split frequencies: 0.006143
915500 -- [-409.970] (-411.625) (-411.110) (-410.359) * (-409.499) (-411.007) (-411.770) [-410.314] -- 0:00:05
916000 -- [-409.171] (-413.916) (-411.398) (-409.927) * (-409.904) (-411.047) (-414.721) [-412.380] -- 0:00:05
916500 -- [-409.848] (-410.103) (-411.725) (-410.835) * (-411.733) (-413.634) (-414.995) [-408.974] -- 0:00:05
917000 -- (-415.315) [-410.398] (-410.934) (-414.293) * (-411.395) (-409.800) (-413.157) [-409.597] -- 0:00:04
917500 -- (-410.605) (-411.963) [-409.894] (-411.640) * (-410.905) [-415.300] (-419.986) (-410.215) -- 0:00:04
918000 -- (-409.979) (-410.341) (-415.359) [-410.530] * (-416.863) (-410.487) (-417.343) [-409.158] -- 0:00:04
918500 -- (-409.116) (-411.592) (-415.790) [-411.762] * (-412.106) (-410.942) [-415.085] (-412.727) -- 0:00:04
919000 -- (-410.695) [-412.995] (-410.321) (-411.793) * [-411.328] (-413.130) (-410.909) (-409.862) -- 0:00:04
919500 -- (-409.219) [-409.856] (-409.617) (-409.137) * (-410.682) (-410.418) [-411.281] (-409.729) -- 0:00:04
920000 -- [-409.097] (-409.412) (-410.747) (-410.862) * (-409.093) (-409.663) [-414.239] (-409.526) -- 0:00:04
Average standard deviation of split frequencies: 0.004847
920500 -- (-412.735) (-412.237) (-409.848) [-409.771] * [-411.119] (-409.469) (-410.799) (-410.970) -- 0:00:04
921000 -- (-416.069) (-415.493) (-410.474) [-410.811] * [-409.446] (-410.323) (-413.034) (-411.982) -- 0:00:04
921500 -- (-410.131) [-414.871] (-413.756) (-411.286) * (-410.246) (-411.175) [-411.022] (-413.827) -- 0:00:04
922000 -- (-409.634) [-409.631] (-412.120) (-409.835) * (-409.433) [-410.413] (-409.976) (-411.800) -- 0:00:04
922500 -- (-417.159) (-410.509) [-409.343] (-411.622) * (-412.220) [-408.583] (-411.587) (-414.263) -- 0:00:04
923000 -- (-411.026) (-409.661) [-408.986] (-409.679) * (-409.394) [-408.759] (-413.465) (-410.601) -- 0:00:04
923500 -- [-411.283] (-409.976) (-409.172) (-410.077) * (-410.299) (-411.845) [-410.577] (-410.624) -- 0:00:04
924000 -- [-408.776] (-409.413) (-409.670) (-408.938) * [-409.224] (-409.225) (-410.179) (-410.524) -- 0:00:04
924500 -- (-408.569) (-409.013) (-411.379) [-409.372] * (-411.765) [-409.322] (-409.365) (-411.213) -- 0:00:04
925000 -- (-413.076) [-412.670] (-410.668) (-409.786) * (-411.363) (-414.985) [-414.240] (-410.743) -- 0:00:04
Average standard deviation of split frequencies: 0.005823
925500 -- (-413.862) (-412.222) (-411.477) [-410.218] * (-412.490) (-413.511) (-411.082) [-408.722] -- 0:00:04
926000 -- [-414.670] (-411.507) (-411.475) (-411.828) * [-413.782] (-411.347) (-414.270) (-408.986) -- 0:00:04
926500 -- (-412.717) (-409.593) (-410.569) [-410.827] * (-410.885) [-410.825] (-414.656) (-409.897) -- 0:00:04
927000 -- [-411.796] (-409.898) (-410.310) (-409.880) * [-410.636] (-412.355) (-414.158) (-409.693) -- 0:00:04
927500 -- (-410.681) (-410.002) (-409.976) [-412.011] * (-411.521) [-410.257] (-410.812) (-409.594) -- 0:00:04
928000 -- (-411.642) (-408.938) (-410.443) [-409.840] * [-408.927] (-409.414) (-413.409) (-409.842) -- 0:00:04
928500 -- (-411.881) [-411.349] (-412.936) (-410.426) * (-412.606) (-413.590) [-410.265] (-411.455) -- 0:00:04
929000 -- (-409.823) [-410.658] (-412.963) (-409.970) * [-411.139] (-412.818) (-410.919) (-410.404) -- 0:00:04
929500 -- (-409.093) (-413.866) (-416.132) [-409.111] * [-413.719] (-414.064) (-412.465) (-411.441) -- 0:00:04
930000 -- [-409.208] (-414.522) (-415.974) (-414.208) * (-412.467) [-411.449] (-410.928) (-410.779) -- 0:00:04
Average standard deviation of split frequencies: 0.005445
930500 -- [-410.492] (-412.514) (-411.841) (-413.144) * (-415.121) (-409.615) [-413.725] (-410.054) -- 0:00:04
931000 -- (-412.422) (-410.810) [-412.609] (-408.931) * (-409.959) [-411.499] (-410.121) (-411.387) -- 0:00:04
931500 -- (-410.689) (-411.403) (-410.794) [-411.241] * (-410.773) [-409.222] (-411.892) (-413.816) -- 0:00:04
932000 -- (-412.057) (-411.167) (-408.915) [-411.186] * (-414.889) (-408.879) [-412.644] (-409.393) -- 0:00:04
932500 -- [-412.491] (-408.922) (-411.833) (-410.034) * (-411.051) (-409.421) [-409.059] (-410.631) -- 0:00:04
933000 -- (-411.211) (-409.321) [-411.252] (-411.831) * (-411.836) [-411.489] (-412.819) (-411.929) -- 0:00:04
933500 -- (-408.862) (-412.077) (-410.599) [-411.810] * (-410.357) (-409.636) [-411.389] (-410.364) -- 0:00:03
934000 -- (-412.426) (-412.565) (-410.573) [-410.844] * (-409.796) (-412.817) (-416.907) [-410.420] -- 0:00:03
934500 -- (-410.651) (-412.852) (-410.289) [-408.850] * (-408.522) (-409.978) [-418.917] (-410.059) -- 0:00:03
935000 -- (-411.092) (-410.428) (-411.323) [-411.639] * (-408.724) (-409.759) (-412.333) [-409.905] -- 0:00:03
Average standard deviation of split frequencies: 0.004768
935500 -- (-409.428) (-409.974) (-413.698) [-409.617] * [-409.495] (-411.981) (-413.808) (-409.685) -- 0:00:03
936000 -- [-410.093] (-410.199) (-411.101) (-411.362) * [-411.739] (-409.947) (-413.897) (-409.044) -- 0:00:03
936500 -- (-410.672) (-416.351) (-413.187) [-411.789] * (-412.705) (-412.337) [-410.347] (-410.613) -- 0:00:03
937000 -- (-409.692) (-414.546) (-413.975) [-410.559] * (-412.418) (-416.214) (-412.869) [-413.732] -- 0:00:03
937500 -- (-411.061) [-409.255] (-411.288) (-410.455) * (-418.211) (-411.793) (-410.123) [-413.535] -- 0:00:03
938000 -- (-410.307) (-409.184) [-411.898] (-408.805) * (-409.355) (-412.301) (-410.556) [-412.706] -- 0:00:03
938500 -- (-409.829) (-410.628) (-411.649) [-409.187] * (-411.805) [-413.776] (-410.434) (-409.761) -- 0:00:03
939000 -- (-411.973) (-412.254) [-412.497] (-411.849) * (-413.908) [-411.706] (-410.444) (-414.556) -- 0:00:03
939500 -- [-413.843] (-418.634) (-416.061) (-412.413) * [-412.275] (-412.031) (-409.987) (-410.933) -- 0:00:03
940000 -- (-412.753) (-415.567) [-412.041] (-410.916) * [-414.023] (-409.414) (-410.563) (-413.686) -- 0:00:03
Average standard deviation of split frequencies: 0.004778
940500 -- [-409.298] (-414.905) (-410.277) (-409.388) * (-409.892) (-410.185) [-412.709] (-409.591) -- 0:00:03
941000 -- (-410.893) (-410.925) [-411.468] (-412.408) * (-414.726) [-411.679] (-412.875) (-409.377) -- 0:00:03
941500 -- (-409.047) (-410.606) [-412.511] (-411.584) * (-411.457) [-409.683] (-415.415) (-411.393) -- 0:00:03
942000 -- (-411.419) [-409.188] (-412.247) (-412.330) * (-412.115) (-412.524) [-409.398] (-411.263) -- 0:00:03
942500 -- (-408.963) (-411.600) [-409.104] (-410.474) * (-413.572) [-410.391] (-412.877) (-413.199) -- 0:00:03
943000 -- (-410.165) (-410.312) (-409.997) [-409.268] * (-413.059) (-410.013) (-411.577) [-410.911] -- 0:00:03
943500 -- [-411.101] (-408.927) (-413.269) (-409.052) * (-410.451) [-409.806] (-411.759) (-409.770) -- 0:00:03
944000 -- (-412.112) (-409.431) [-409.771] (-409.869) * (-412.847) (-415.224) [-411.161] (-411.231) -- 0:00:03
944500 -- [-412.895] (-409.478) (-410.170) (-410.815) * (-411.472) (-414.311) (-412.303) [-412.850] -- 0:00:03
945000 -- (-412.863) [-409.141] (-409.735) (-411.319) * (-413.850) (-416.774) [-408.973] (-409.321) -- 0:00:03
Average standard deviation of split frequencies: 0.004983
945500 -- (-408.993) [-409.077] (-410.272) (-413.716) * (-410.930) [-416.601] (-409.389) (-413.292) -- 0:00:03
946000 -- (-410.990) (-408.908) [-412.153] (-410.012) * (-412.885) (-414.504) (-409.891) [-409.214] -- 0:00:03
946500 -- (-415.414) (-409.286) (-410.336) [-410.317] * (-410.989) (-412.653) (-409.871) [-409.340] -- 0:00:03
947000 -- (-410.448) [-408.838] (-411.197) (-410.235) * [-409.441] (-410.303) (-410.821) (-409.786) -- 0:00:03
947500 -- (-411.180) [-409.865] (-409.368) (-409.751) * (-409.665) (-414.601) (-410.670) [-409.392] -- 0:00:03
948000 -- (-408.605) (-410.052) [-409.664] (-417.179) * [-410.280] (-411.849) (-410.612) (-412.253) -- 0:00:03
948500 -- (-412.561) (-409.280) [-410.371] (-410.427) * (-422.166) (-414.405) [-411.177] (-412.474) -- 0:00:03
949000 -- (-409.912) [-412.129] (-410.358) (-410.559) * (-411.307) (-416.474) [-411.321] (-410.193) -- 0:00:03
949500 -- [-408.993] (-409.823) (-413.354) (-410.427) * (-411.933) (-411.977) (-415.457) [-410.360] -- 0:00:03
950000 -- (-409.896) [-408.579] (-409.477) (-411.740) * [-410.432] (-411.422) (-415.973) (-410.027) -- 0:00:03
Average standard deviation of split frequencies: 0.005058
950500 -- (-412.543) (-412.297) [-413.792] (-410.804) * (-411.909) [-409.394] (-409.539) (-409.350) -- 0:00:02
951000 -- [-409.024] (-410.426) (-412.857) (-410.369) * (-414.593) (-409.515) [-409.625] (-411.172) -- 0:00:02
951500 -- [-409.823] (-412.758) (-411.014) (-411.652) * (-410.834) (-408.892) [-409.258] (-409.807) -- 0:00:02
952000 -- (-413.155) (-410.843) [-409.718] (-410.150) * (-410.481) (-411.049) (-411.940) [-410.390] -- 0:00:02
952500 -- (-414.940) (-413.807) (-411.119) [-410.252] * (-412.895) (-413.236) [-414.735] (-409.300) -- 0:00:02
953000 -- (-418.933) (-416.069) (-412.805) [-410.953] * (-415.419) (-412.837) [-413.635] (-411.579) -- 0:00:02
953500 -- (-408.508) (-410.848) [-411.681] (-413.315) * (-413.186) (-413.510) [-410.180] (-410.359) -- 0:00:02
954000 -- (-410.028) (-409.436) [-411.432] (-411.926) * (-412.248) [-412.028] (-411.223) (-410.974) -- 0:00:02
954500 -- (-411.102) [-410.803] (-408.841) (-412.590) * (-413.114) (-412.382) [-411.751] (-409.752) -- 0:00:02
955000 -- (-409.682) (-411.230) (-409.094) [-410.744] * (-411.826) [-409.345] (-412.189) (-410.182) -- 0:00:02
Average standard deviation of split frequencies: 0.005030
955500 -- (-410.238) (-409.598) [-408.893] (-410.649) * [-409.293] (-409.655) (-410.424) (-408.763) -- 0:00:02
956000 -- (-410.253) (-410.881) (-409.793) [-412.122] * (-412.740) (-410.621) [-414.915] (-408.879) -- 0:00:02
956500 -- [-409.629] (-412.167) (-409.450) (-412.344) * (-410.619) [-408.820] (-409.787) (-413.256) -- 0:00:02
957000 -- (-409.487) (-410.770) [-408.956] (-413.439) * (-412.308) [-409.247] (-414.431) (-411.785) -- 0:00:02
957500 -- [-409.711] (-412.089) (-409.525) (-414.455) * (-408.855) (-409.841) [-412.668] (-417.120) -- 0:00:02
958000 -- (-412.426) (-409.227) [-411.028] (-411.092) * (-410.211) (-411.051) (-409.691) [-413.146] -- 0:00:02
958500 -- (-409.268) [-408.948] (-411.306) (-410.761) * (-408.646) (-416.263) (-410.980) [-411.021] -- 0:00:02
959000 -- (-409.564) (-409.632) (-418.081) [-409.720] * [-412.085] (-411.963) (-409.055) (-413.892) -- 0:00:02
959500 -- (-409.959) (-410.994) [-410.535] (-411.545) * [-411.553] (-414.017) (-412.030) (-411.989) -- 0:00:02
960000 -- (-411.242) (-410.037) (-412.248) [-413.129] * [-411.880] (-414.210) (-415.126) (-409.888) -- 0:00:02
Average standard deviation of split frequencies: 0.005038
960500 -- (-410.226) (-409.304) [-408.910] (-409.496) * (-411.060) (-409.721) [-412.291] (-409.287) -- 0:00:02
961000 -- [-409.107] (-412.004) (-409.482) (-411.195) * (-411.040) (-416.080) (-411.960) [-409.402] -- 0:00:02
961500 -- [-409.377] (-412.499) (-410.339) (-412.595) * [-410.198] (-410.241) (-412.241) (-412.982) -- 0:00:02
962000 -- (-409.945) [-413.787] (-409.915) (-414.444) * (-409.651) (-412.992) [-411.140] (-412.592) -- 0:00:02
962500 -- (-410.145) (-410.224) [-408.551] (-419.306) * (-415.563) (-410.911) (-410.549) [-412.380] -- 0:00:02
963000 -- (-410.493) (-410.441) (-409.392) [-412.768] * (-417.915) [-413.451] (-410.870) (-411.248) -- 0:00:02
963500 -- (-411.227) [-411.389] (-408.835) (-412.669) * [-412.255] (-408.959) (-412.758) (-413.784) -- 0:00:02
964000 -- (-411.865) [-409.398] (-410.915) (-413.892) * (-410.297) [-409.660] (-411.876) (-410.326) -- 0:00:02
964500 -- (-413.154) (-409.478) (-409.549) [-417.563] * (-411.278) [-409.869] (-410.336) (-409.444) -- 0:00:02
965000 -- (-412.638) (-409.270) [-409.187] (-417.075) * (-409.021) (-409.184) (-411.472) [-411.064] -- 0:00:02
Average standard deviation of split frequencies: 0.005270
965500 -- (-411.173) (-409.935) [-409.889] (-412.579) * (-410.708) [-411.357] (-413.630) (-409.404) -- 0:00:02
966000 -- [-412.381] (-409.718) (-411.329) (-410.252) * [-410.756] (-409.672) (-413.124) (-410.717) -- 0:00:02
966500 -- [-409.452] (-411.373) (-413.949) (-409.496) * (-409.653) (-414.321) (-410.064) [-411.637] -- 0:00:02
967000 -- (-411.398) (-412.608) [-413.821] (-408.654) * [-410.127] (-412.586) (-412.853) (-410.283) -- 0:00:01
967500 -- (-410.073) [-412.358] (-409.020) (-411.844) * (-409.477) (-414.195) (-412.158) [-410.460] -- 0:00:01
968000 -- (-411.072) (-410.778) (-410.845) [-410.721] * [-408.848] (-412.537) (-409.883) (-409.915) -- 0:00:01
968500 -- (-411.143) (-415.164) (-414.132) [-410.531] * (-410.900) (-410.368) [-410.150] (-413.510) -- 0:00:01
969000 -- (-409.677) (-413.783) [-410.450] (-410.147) * (-413.178) [-408.572] (-410.689) (-413.034) -- 0:00:01
969500 -- (-412.698) (-412.750) (-410.023) [-410.834] * (-409.745) (-413.125) [-410.320] (-412.560) -- 0:00:01
970000 -- (-410.857) [-410.799] (-409.717) (-409.833) * (-412.028) [-410.015] (-409.985) (-410.673) -- 0:00:01
Average standard deviation of split frequencies: 0.005277
970500 -- [-412.786] (-412.956) (-409.824) (-413.523) * [-410.226] (-410.384) (-409.499) (-412.819) -- 0:00:01
971000 -- (-412.656) (-411.749) (-412.458) [-411.047] * (-410.830) [-408.967] (-409.705) (-415.516) -- 0:00:01
971500 -- [-411.374] (-408.963) (-410.966) (-410.855) * (-410.601) [-410.102] (-410.932) (-411.514) -- 0:00:01
972000 -- (-409.336) (-409.437) (-410.332) [-409.706] * (-410.221) (-409.029) (-411.249) [-410.398] -- 0:00:01
972500 -- (-411.042) (-410.635) [-410.524] (-409.628) * [-409.931] (-412.540) (-413.112) (-412.466) -- 0:00:01
973000 -- [-410.273] (-410.479) (-413.240) (-409.106) * [-409.633] (-414.252) (-409.685) (-414.379) -- 0:00:01
973500 -- (-410.083) (-410.754) [-411.638] (-411.609) * (-411.765) (-410.859) (-413.107) [-410.323] -- 0:00:01
974000 -- (-412.871) (-411.889) [-414.156] (-409.659) * (-416.999) (-412.806) [-412.149] (-411.304) -- 0:00:01
974500 -- (-412.624) (-415.668) (-413.611) [-411.026] * [-413.403] (-408.815) (-413.371) (-409.236) -- 0:00:01
975000 -- (-413.559) [-411.048] (-410.819) (-409.877) * (-409.134) [-409.453] (-410.462) (-410.497) -- 0:00:01
Average standard deviation of split frequencies: 0.005120
975500 -- [-409.991] (-410.344) (-414.156) (-413.639) * (-409.735) (-411.071) (-409.540) [-410.024] -- 0:00:01
976000 -- (-410.659) [-410.663] (-410.668) (-415.884) * (-409.890) [-408.570] (-410.220) (-409.305) -- 0:00:01
976500 -- [-411.779] (-409.127) (-411.647) (-410.231) * (-412.470) (-409.129) [-411.215] (-411.180) -- 0:00:01
977000 -- (-414.000) (-412.669) (-415.695) [-409.464] * [-411.395] (-412.496) (-412.428) (-413.107) -- 0:00:01
977500 -- (-410.271) (-410.748) (-410.401) [-411.562] * (-410.920) [-411.060] (-416.514) (-410.595) -- 0:00:01
978000 -- (-410.233) (-411.146) [-412.820] (-410.093) * (-412.234) [-409.914] (-415.609) (-411.029) -- 0:00:01
978500 -- [-409.804] (-411.766) (-409.321) (-409.110) * (-411.995) (-410.222) (-413.997) [-410.111] -- 0:00:01
979000 -- [-411.865] (-410.015) (-409.629) (-410.419) * (-413.253) [-412.356] (-411.923) (-410.477) -- 0:00:01
979500 -- (-410.435) [-409.675] (-416.961) (-412.397) * (-409.102) (-411.607) (-411.544) [-411.018] -- 0:00:01
980000 -- (-409.152) (-410.127) [-412.263] (-412.410) * (-409.534) (-410.810) (-413.116) [-410.651] -- 0:00:01
Average standard deviation of split frequencies: 0.004903
980500 -- (-410.650) [-410.486] (-413.743) (-411.791) * (-413.914) (-414.131) (-414.875) [-409.723] -- 0:00:01
981000 -- (-410.410) (-411.401) [-409.842] (-412.007) * [-410.664] (-408.779) (-410.008) (-413.745) -- 0:00:01
981500 -- (-408.737) [-410.806] (-409.994) (-410.706) * (-409.170) (-409.778) (-411.254) [-411.385] -- 0:00:01
982000 -- (-408.692) (-410.610) [-412.463] (-409.748) * (-409.457) (-412.251) (-411.938) [-410.784] -- 0:00:01
982500 -- (-408.983) (-417.261) (-410.111) [-409.983] * (-409.569) [-410.616] (-409.231) (-413.597) -- 0:00:01
983000 -- (-412.582) [-410.212] (-409.935) (-410.555) * [-409.503] (-412.203) (-411.920) (-410.953) -- 0:00:01
983500 -- [-411.635] (-411.417) (-409.467) (-411.919) * (-410.149) (-411.290) [-412.458] (-412.797) -- 0:00:00
984000 -- (-411.290) (-411.929) (-411.574) [-411.171] * [-411.111] (-410.779) (-412.670) (-413.424) -- 0:00:00
984500 -- (-412.068) (-409.548) [-409.911] (-411.213) * (-411.415) (-410.499) (-409.157) [-409.565] -- 0:00:00
985000 -- (-410.997) [-410.424] (-409.384) (-412.262) * (-414.012) [-409.912] (-410.286) (-409.763) -- 0:00:00
Average standard deviation of split frequencies: 0.004653
985500 -- (-410.739) (-410.086) [-408.834] (-412.071) * (-409.795) [-411.582] (-410.916) (-412.990) -- 0:00:00
986000 -- [-410.221] (-409.175) (-408.843) (-415.080) * (-409.195) (-413.131) [-410.675] (-412.716) -- 0:00:00
986500 -- (-410.995) [-415.431] (-409.208) (-408.643) * [-410.801] (-411.086) (-411.506) (-410.508) -- 0:00:00
987000 -- (-411.688) (-415.452) [-408.820] (-412.360) * [-409.719] (-414.747) (-412.223) (-409.290) -- 0:00:00
987500 -- (-411.522) (-411.324) [-411.842] (-411.391) * (-410.284) (-410.071) [-409.954] (-409.417) -- 0:00:00
988000 -- (-413.449) [-409.379] (-412.628) (-410.517) * (-411.270) (-411.859) (-410.610) [-410.593] -- 0:00:00
988500 -- (-410.178) [-413.116] (-415.962) (-411.116) * [-410.906] (-413.347) (-411.525) (-412.082) -- 0:00:00
989000 -- (-411.769) (-410.317) [-412.724] (-415.196) * (-413.369) (-410.663) [-409.594] (-410.313) -- 0:00:00
989500 -- [-412.561] (-412.967) (-410.890) (-414.558) * [-411.252] (-410.264) (-408.798) (-412.270) -- 0:00:00
990000 -- (-413.086) (-411.996) (-411.430) [-409.935] * [-409.846] (-409.726) (-410.989) (-410.440) -- 0:00:00
Average standard deviation of split frequencies: 0.004600
990500 -- [-411.079] (-411.761) (-410.329) (-409.782) * (-409.081) [-415.377] (-411.411) (-409.737) -- 0:00:00
991000 -- (-411.687) [-410.243] (-413.932) (-414.796) * (-410.939) (-409.804) [-410.411] (-410.120) -- 0:00:00
991500 -- (-411.803) (-409.291) (-410.506) [-411.070] * (-410.449) (-409.174) [-409.353] (-410.961) -- 0:00:00
992000 -- (-411.305) (-410.999) (-411.240) [-411.335] * (-414.030) [-408.838] (-409.258) (-409.408) -- 0:00:00
992500 -- (-416.283) (-409.545) (-412.550) [-409.188] * (-411.400) (-408.841) [-412.162] (-410.733) -- 0:00:00
993000 -- (-415.753) [-414.711] (-410.658) (-410.492) * (-415.400) [-408.740] (-414.630) (-410.454) -- 0:00:00
993500 -- (-409.163) (-412.538) [-411.607] (-409.369) * (-409.669) [-408.704] (-413.418) (-410.137) -- 0:00:00
994000 -- [-409.636] (-410.097) (-414.387) (-409.651) * (-410.931) (-412.281) (-409.853) [-413.087] -- 0:00:00
994500 -- (-415.743) (-410.650) (-413.599) [-409.253] * [-413.489] (-410.447) (-409.252) (-409.151) -- 0:00:00
995000 -- (-410.515) [-411.236] (-411.313) (-408.987) * (-409.007) (-409.304) (-409.735) [-414.033] -- 0:00:00
Average standard deviation of split frequencies: 0.004733
995500 -- [-412.540] (-413.129) (-410.675) (-409.148) * [-414.865] (-408.855) (-410.068) (-414.199) -- 0:00:00
996000 -- (-409.954) (-410.416) (-412.819) [-409.165] * (-414.263) (-409.372) [-411.029] (-411.461) -- 0:00:00
996500 -- (-417.663) (-412.480) [-410.663] (-414.040) * [-412.380] (-410.126) (-410.620) (-409.488) -- 0:00:00
997000 -- (-415.481) (-413.956) [-411.978] (-410.465) * (-411.434) [-409.896] (-410.624) (-408.599) -- 0:00:00
997500 -- [-415.727] (-409.271) (-412.244) (-418.831) * [-411.050] (-409.769) (-412.648) (-410.708) -- 0:00:00
998000 -- [-411.501] (-411.986) (-411.081) (-417.588) * (-411.652) [-409.208] (-414.894) (-411.101) -- 0:00:00
998500 -- (-416.616) (-417.596) [-409.314] (-409.820) * (-410.807) (-411.459) (-411.597) [-414.219] -- 0:00:00
999000 -- (-409.366) (-412.799) (-411.728) [-412.855] * (-416.411) (-408.886) [-410.234] (-413.469) -- 0:00:00
999500 -- [-410.437] (-417.564) (-410.933) (-411.275) * [-415.541] (-410.221) (-410.553) (-414.261) -- 0:00:00
1000000 -- (-410.897) [-408.842] (-410.794) (-412.800) * (-419.171) (-408.852) [-411.475] (-414.244) -- 0:00:00
Average standard deviation of split frequencies: 0.004931
Analysis completed in 60 seconds
Analysis used 58.42 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -408.40
Likelihood of best state for "cold" chain of run 2 was -408.40
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 63 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.9 % ( 32 %) Dirichlet(Pi{all})
39.6 % ( 25 %) Slider(Pi{all})
79.3 % ( 56 %) Multiplier(Alpha{1,2})
77.8 % ( 58 %) Multiplier(Alpha{3})
25.7 % ( 32 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.0 % ( 22 %) Dirichlet(Pi{all})
37.6 % ( 25 %) Slider(Pi{all})
78.8 % ( 40 %) Multiplier(Alpha{1,2})
78.1 % ( 48 %) Multiplier(Alpha{3})
26.6 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 82 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 35 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166408 0.82 0.67
3 | 166912 166795 0.84
4 | 166335 166629 166921
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166598 0.82 0.67
3 | 167367 166529 0.84
4 | 166709 166283 166514
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -410.34
| 1 1 1 2 1 2 1 1 |
| 2 1 1 2 2 1 1 2 1 1 |
| 1 2 1 22 1 1 2 2 21 1 2 22 |
|2 1 1 2 1 121 2 1 1 2 1 |
| 2 2 2 2 22 1 11 22 2 2 1 1 |
| 1 2 1 *1 1 21 2 2 1 2 1 2 |
|1 2 1 2 2 2 1 1 2 2 1 |
| 11 2 2 * 2 1 21 2 2 |
| 12 11 2 2 1 1 2 1 1|
| 112 2 2|
| 1 2 |
| |
| 2 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -411.99
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.10 -413.45
2 -410.14 -413.29
--------------------------------------
TOTAL -410.12 -413.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895095 0.087463 0.360635 1.490384 0.859947 1375.29 1438.15 1.001
r(A<->C){all} 0.167801 0.018845 0.000010 0.445026 0.130678 291.27 333.54 1.000
r(A<->G){all} 0.166805 0.019338 0.000070 0.452556 0.133687 230.09 260.94 1.001
r(A<->T){all} 0.171284 0.021589 0.000070 0.472499 0.128397 133.16 137.17 1.000
r(C<->G){all} 0.165871 0.021245 0.000036 0.462425 0.125937 145.69 162.21 1.000
r(C<->T){all} 0.165051 0.020054 0.000082 0.456405 0.126017 190.78 254.57 1.000
r(G<->T){all} 0.163187 0.019363 0.000078 0.450036 0.123479 165.88 237.57 1.006
pi(A){all} 0.226618 0.000576 0.178309 0.272107 0.226200 1123.62 1141.95 1.000
pi(C){all} 0.292659 0.000671 0.244063 0.343803 0.292714 1205.53 1326.85 1.000
pi(G){all} 0.278895 0.000680 0.228969 0.329645 0.278459 890.04 1111.67 1.000
pi(T){all} 0.201827 0.000530 0.160026 0.249475 0.201105 1338.95 1400.50 1.000
alpha{1,2} 0.432105 0.260077 0.000235 1.445716 0.249996 1142.28 1210.46 1.001
alpha{3} 0.454820 0.249189 0.000125 1.433755 0.296488 922.57 1146.22 1.000
pinvar{all} 0.994500 0.000044 0.981778 0.999998 0.996637 1218.57 1298.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ..*.*.
9 -- .*..*.
10 -- .**.**
11 -- ....**
12 -- .****.
13 -- ..*..*
14 -- .*.***
15 -- .***.*
16 -- ..****
17 -- .**...
18 -- ...*.*
19 -- ..**..
20 -- .*...*
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 475 0.158228 0.001413 0.157229 0.159227 2
8 449 0.149567 0.000471 0.149234 0.149900 2
9 447 0.148901 0.003298 0.146569 0.151233 2
10 446 0.148568 0.006595 0.143904 0.153231 2
11 442 0.147235 0.000942 0.146569 0.147901 2
12 434 0.144570 0.010364 0.137242 0.151899 2
13 433 0.144237 0.004240 0.141239 0.147235 2
14 433 0.144237 0.007066 0.139241 0.149234 2
15 433 0.144237 0.010835 0.136576 0.151899 2
16 427 0.142239 0.005182 0.138574 0.145903 2
17 420 0.139907 0.001884 0.138574 0.141239 2
18 415 0.138241 0.011777 0.129913 0.146569 2
19 408 0.135909 0.000942 0.135243 0.136576 2
20 402 0.133911 0.004711 0.130580 0.137242 2
21 391 0.130247 0.004240 0.127249 0.133245 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099132 0.009606 0.000018 0.294555 0.069570 1.000 2
length{all}[2] 0.098574 0.010056 0.000021 0.293064 0.066843 1.000 2
length{all}[3] 0.101228 0.010059 0.000079 0.296125 0.071149 1.001 2
length{all}[4] 0.100629 0.009963 0.000029 0.305444 0.070203 1.000 2
length{all}[5] 0.099141 0.010358 0.000002 0.297026 0.069753 1.000 2
length{all}[6] 0.100627 0.009366 0.000019 0.289620 0.071721 1.000 2
length{all}[7] 0.100075 0.009957 0.000042 0.305069 0.067001 0.998 2
length{all}[8] 0.107385 0.012661 0.000165 0.343828 0.071098 1.001 2
length{all}[9] 0.102851 0.010217 0.000013 0.323093 0.070277 1.009 2
length{all}[10] 0.091131 0.009060 0.000109 0.267910 0.068321 0.999 2
length{all}[11] 0.100668 0.011496 0.000211 0.319486 0.067888 1.000 2
length{all}[12] 0.098309 0.011004 0.000100 0.300973 0.065429 1.010 2
length{all}[13] 0.098512 0.008798 0.000418 0.294438 0.066481 1.000 2
length{all}[14] 0.099822 0.009808 0.000046 0.273964 0.069420 0.999 2
length{all}[15] 0.101534 0.010442 0.000415 0.307238 0.070942 0.998 2
length{all}[16] 0.094079 0.008282 0.000254 0.296819 0.066751 0.999 2
length{all}[17] 0.096664 0.008622 0.000195 0.265172 0.072493 0.998 2
length{all}[18] 0.097801 0.010620 0.000202 0.292955 0.066981 0.998 2
length{all}[19] 0.098514 0.007898 0.000142 0.284919 0.076296 1.015 2
length{all}[20] 0.096272 0.009789 0.000495 0.294696 0.060350 0.998 2
length{all}[21] 0.098747 0.009973 0.000017 0.298788 0.067236 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004931
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.015
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 297
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 36 patterns at 99 / 99 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 36 patterns at 99 / 99 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
35136 bytes for conP
3168 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074808 0.035638 0.103620 0.062943 0.056932 0.036603 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -424.844105
Iterating by ming2
Initial: fx= 424.844105
x= 0.07481 0.03564 0.10362 0.06294 0.05693 0.03660 0.30000 1.30000
1 h-m-p 0.0000 0.0004 236.0876 +++ 404.269562 m 0.0004 14 | 1/8
2 h-m-p 0.0015 0.0076 40.1782 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 216.7423 ++ 403.801442 m 0.0000 45 | 2/8
4 h-m-p 0.0001 0.0102 30.3756 ---------.. | 2/8
5 h-m-p 0.0000 0.0002 193.6184 +++ 395.886562 m 0.0002 75 | 3/8
6 h-m-p 0.0015 0.0131 23.9460 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 168.1313 ++ 394.121951 m 0.0001 106 | 4/8
8 h-m-p 0.0005 0.0188 17.1297 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 137.2070 ++ 391.796135 m 0.0001 137 | 5/8
10 h-m-p 0.0010 0.0283 11.5214 -----------.. | 5/8
11 h-m-p 0.0000 0.0003 96.9723 +++ 388.954854 m 0.0003 169 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 388.954854 m 8.0000 180 | 6/8
13 h-m-p 1.0970 8.0000 0.0000 ++ 388.954854 m 8.0000 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0038 --------C 388.954854 0 0.0000 214 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 --C 388.954854 0 0.0003 229 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 -----------Y 388.954854 0 0.0000 253
Out..
lnL = -388.954854
254 lfun, 254 eigenQcodon, 1524 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046292 0.078475 0.031975 0.032194 0.040704 0.071039 0.299797 0.506346 0.497480
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.479642
np = 9
lnL0 = -417.814196
Iterating by ming2
Initial: fx= 417.814196
x= 0.04629 0.07848 0.03198 0.03219 0.04070 0.07104 0.29980 0.50635 0.49748
1 h-m-p 0.0000 0.0003 231.5116 +++ 399.561110 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0000 77.0344 ++ 399.453165 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0000 3338.2934 ++ 396.234134 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 15391.4775 ++ 394.608255 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 104796.8143 ++ 389.716037 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 2414.2013 ++ 388.954857 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 388.954857 m 8.0000 87 | 6/9
8 h-m-p 0.0362 8.0000 0.0245 ++++ 388.954855 m 8.0000 104 | 6/9
9 h-m-p 0.2895 1.4476 0.4567 ++ 388.954851 m 1.4476 119 | 7/9
10 h-m-p 0.1520 0.7602 0.3424 ++ 388.954848 m 0.7602 134 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 Y 388.954848 0 1.6000 148
Out..
lnL = -388.954848
149 lfun, 447 eigenQcodon, 1788 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018409 0.030011 0.022941 0.012741 0.032203 0.054776 0.000100 1.013681 0.450117 0.307588 1.470561
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.186257
np = 11
lnL0 = -405.112580
Iterating by ming2
Initial: fx= 405.112580
x= 0.01841 0.03001 0.02294 0.01274 0.03220 0.05478 0.00011 1.01368 0.45012 0.30759 1.47056
1 h-m-p 0.0000 0.0000 225.1973 ++ 404.488085 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0037 48.3162 ++++ 397.266943 m 0.0037 32 | 2/11
3 h-m-p 0.0000 0.0002 157.1882 ++ 394.952008 m 0.0002 46 | 3/11
4 h-m-p 0.0004 0.0018 52.3688 ++ 393.099975 m 0.0018 60 | 4/11
5 h-m-p 0.0000 0.0000 876.5409 ++ 392.188362 m 0.0000 74 | 5/11
6 h-m-p 0.0014 0.0069 5.4569 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 163.3385 ++ 391.291102 m 0.0000 111 | 6/11
8 h-m-p 0.0160 8.0000 2.3763 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 134.2862 ++ 390.915027 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 1.8014 -------------.. | 7/11
11 h-m-p 0.0000 0.0002 94.9071 +++ 388.954848 m 0.0002 190 | 8/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 388.954848 m 8.0000 204 | 8/11
13 h-m-p 0.2567 8.0000 0.0000 +++ 388.954848 m 8.0000 222 | 8/11
14 h-m-p 0.0160 8.0000 0.0086 +++++ 388.954848 m 8.0000 242 | 8/11
15 h-m-p 0.0515 8.0000 1.3434 ++++ 388.954848 m 8.0000 261 | 8/11
16 h-m-p 1.6000 8.0000 0.7323 Y 388.954848 0 3.7430 275 | 8/11
17 h-m-p 1.6000 8.0000 0.0085 ---Y 388.954848 0 0.0063 295 | 8/11
18 h-m-p 1.2890 8.0000 0.0000 ----------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 ----N 388.954848 0 0.0000 347
Out..
lnL = -388.954848
348 lfun, 1392 eigenQcodon, 6264 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -388.955970 S = -388.952844 -0.001194
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:02
did 20 / 36 patterns 0:02
did 30 / 36 patterns 0:02
did 36 / 36 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.080459 0.038507 0.086800 0.022677 0.016838 0.031569 0.000100 0.895861 1.448599
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.815502
np = 9
lnL0 = -414.795767
Iterating by ming2
Initial: fx= 414.795767
x= 0.08046 0.03851 0.08680 0.02268 0.01684 0.03157 0.00011 0.89586 1.44860
1 h-m-p 0.0000 0.0000 220.6218 ++ 414.579779 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0441 20.2567 +++++ 411.915591 m 0.0441 29 | 2/9
3 h-m-p 0.0000 0.0001 2807.2273 ++ 405.464851 m 0.0001 41 | 3/9
4 h-m-p 0.0002 0.0008 76.0057 ++ 402.908437 m 0.0008 53 | 4/9
5 h-m-p 0.0019 0.0095 7.5560 ------------.. | 4/9
6 h-m-p 0.0000 0.0003 186.3775 +++ 392.121186 m 0.0003 88 | 5/9
7 h-m-p 0.0322 8.0000 1.5275 --------------.. | 5/9
8 h-m-p 0.0000 0.0001 166.3642 ++ 390.657805 m 0.0001 124 | 6/9
9 h-m-p 0.0160 8.0000 1.2227 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 136.1712 ++ 389.383456 m 0.0001 159 | 7/9
11 h-m-p 0.0160 8.0000 0.8636 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 96.7786 ++ 388.954849 m 0.0000 196 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 388.954849 0 1.6000 208 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 388.954849 0 0.0160 221
Out..
lnL = -388.954849
222 lfun, 2442 eigenQcodon, 13320 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041796 0.106312 0.051232 0.033065 0.106957 0.024884 0.000100 0.900000 0.617190 1.902378 1.300062
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.866339
np = 11
lnL0 = -420.953246
Iterating by ming2
Initial: fx= 420.953246
x= 0.04180 0.10631 0.05123 0.03307 0.10696 0.02488 0.00011 0.90000 0.61719 1.90238 1.30006
1 h-m-p 0.0000 0.0000 197.3308 ++ 420.863745 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0014 107.5401 ++++ 407.993487 m 0.0014 32 | 2/11
3 h-m-p 0.0000 0.0001 249.9191 ++ 404.444947 m 0.0001 46 | 3/11
4 h-m-p 0.0009 0.0053 32.7198 ++ 400.938931 m 0.0053 60 | 4/11
5 h-m-p 0.0000 0.0002 262.0375 ++ 398.732663 m 0.0002 74 | 5/11
6 h-m-p 0.0001 0.0014 343.4588 ++ 391.752001 m 0.0014 88 | 6/11
7 h-m-p 0.0152 0.0761 4.4730 -------------.. | 6/11
8 h-m-p 0.0000 0.0002 130.8086 ++ 389.017136 m 0.0002 127 | 7/11
9 h-m-p 0.0037 0.0758 3.8641 ------------.. | 7/11
10 h-m-p 0.0000 0.0000 97.1127 ++ 388.954848 m 0.0000 165 | 8/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 388.954848 m 8.0000 182 | 8/11
12 h-m-p 0.8638 8.0000 0.0000 ++ 388.954848 m 8.0000 199 | 8/11
13 h-m-p 0.0053 2.6514 0.2855 -----C 388.954848 0 0.0000 221 | 8/11
14 h-m-p 0.0160 8.0000 0.0004 ---C 388.954848 0 0.0001 241 | 8/11
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 ------------N 388.954848 0 0.0000 298
Out..
lnL = -388.954848
299 lfun, 3588 eigenQcodon, 19734 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -388.963773 S = -388.953356 -0.004570
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 36 patterns 0:11
did 20 / 36 patterns 0:11
did 30 / 36 patterns 0:11
did 36 / 36 patterns 0:11
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=99
NC_011896_1_WP_010907580_1_186_MLBR_RS00905 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
NC_002677_1_NP_301255_1_127_ML0180 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS
**************************************************
NC_011896_1_WP_010907580_1_186_MLBR_RS00905 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
NC_002677_1_NP_301255_1_127_ML0180 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985 GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
*************************************************
>NC_011896_1_WP_010907580_1_186_MLBR_RS00905 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC >NC_002677_1_NP_301255_1_127_ML0180 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC >NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC >NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC >NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC >NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985 GTGCCGACCTACAGCTACGAGTGTACCGAGTGCACTAACCGCTTCGACGT TGTGCAAGCCTTCACCGATGATGCCCTGACCACTTGCGAAAAGTGCTCCG GTCGGCTGCGGAAACTATTCAACTCCGTCGGCGTGGTGTTCAAGGGCAGT GGCTTCTACCGCACCGATAGCCGCGAATCAGGTGAGAAATCGAACAGTTC AAGCAACGGGTCTTCGAAGAGCGATTCGGGATCGAGTTCGGGATCTAGCG ATAAATCAAACAGCTCCTCTGCGCCTGCCGTCGCGACCGCTCCGAGC
>NC_011896_1_WP_010907580_1_186_MLBR_RS00905 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS >NC_002677_1_NP_301255_1_127_ML0180 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS >NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS >NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS >NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS >NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985 VPTYSYECTECTNRFDVVQAFTDDALTTCEKCSGRLRKLFNSVGVVFKGS GFYRTDSRESGEKSNSSSNGSSKSDSGSSSGSSDKSNSSSAPAVATAPS
#NEXUS
[ID: 0098223599]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907580_1_186_MLBR_RS00905
NC_002677_1_NP_301255_1_127_ML0180
NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080
NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400
NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955
NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907580_1_186_MLBR_RS00905,
2 NC_002677_1_NP_301255_1_127_ML0180,
3 NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080,
4 NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400,
5 NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955,
6 NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06957021,2:0.06684329,3:0.071149,4:0.07020267,5:0.06975261,6:0.07172118);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06957021,2:0.06684329,3:0.071149,4:0.07020267,5:0.06975261,6:0.07172118);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.10 -413.45
2 -410.14 -413.29
--------------------------------------
TOTAL -410.12 -413.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0180/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895095 0.087463 0.360635 1.490384 0.859947 1375.29 1438.15 1.001
r(A<->C){all} 0.167801 0.018845 0.000010 0.445026 0.130678 291.27 333.54 1.000
r(A<->G){all} 0.166805 0.019338 0.000070 0.452556 0.133687 230.09 260.94 1.001
r(A<->T){all} 0.171284 0.021589 0.000070 0.472499 0.128397 133.16 137.17 1.000
r(C<->G){all} 0.165871 0.021245 0.000036 0.462425 0.125937 145.69 162.21 1.000
r(C<->T){all} 0.165051 0.020054 0.000082 0.456405 0.126017 190.78 254.57 1.000
r(G<->T){all} 0.163187 0.019363 0.000078 0.450036 0.123479 165.88 237.57 1.006
pi(A){all} 0.226618 0.000576 0.178309 0.272107 0.226200 1123.62 1141.95 1.000
pi(C){all} 0.292659 0.000671 0.244063 0.343803 0.292714 1205.53 1326.85 1.000
pi(G){all} 0.278895 0.000680 0.228969 0.329645 0.278459 890.04 1111.67 1.000
pi(T){all} 0.201827 0.000530 0.160026 0.249475 0.201105 1338.95 1400.50 1.000
alpha{1,2} 0.432105 0.260077 0.000235 1.445716 0.249996 1142.28 1210.46 1.001
alpha{3} 0.454820 0.249189 0.000125 1.433755 0.296488 922.57 1146.22 1.000
pinvar{all} 0.994500 0.000044 0.981778 0.999998 0.996637 1218.57 1298.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0180/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 99
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 3 3 3 3 3 3 | TAC 3 3 3 3 3 3 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 2 2 2 2 2 2 | CAG 0 0 0 0 0 0 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 3 3 3 3 3 3
ATC 0 0 0 0 0 0 | ACC 6 6 6 6 6 6 | AAC 5 5 5 5 5 5 | AGC 7 7 7 7 7 7
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 1 1 1 1 1 1 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 2 2 2 2 2 2 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907580_1_186_MLBR_RS00905
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
#2: NC_002677_1_NP_301255_1_127_ML0180
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
#3: NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
#4: NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
#5: NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
#6: NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 18 | Tyr Y TAT 0 | Cys C TGT 6
TTC 30 | TCC 18 | TAC 18 | TGC 18
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 0 | CGC 18
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 12 | CCG 12 | CAG 0 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 18
ATC 0 | ACC 36 | AAC 30 | AGC 42
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 0 | ACG 0 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 30 | Gly G GGT 12
GTC 12 | GCC 18 | GAC 6 | GGC 18
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 12
GTG 24 | GCG 12 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.26263 C:0.12121 A:0.29293 G:0.32323
position 2: T:0.15152 C:0.31313 A:0.26263 G:0.27273
position 3: T:0.19192 C:0.44444 A:0.12121 G:0.24242
Average T:0.20202 C:0.29293 A:0.22559 G:0.27946
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -388.954854 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299797 1.300062
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907580_1_186_MLBR_RS00905: 0.000004, NC_002677_1_NP_301255_1_127_ML0180: 0.000004, NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080: 0.000004, NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400: 0.000004, NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955: 0.000004, NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29980
omega (dN/dS) = 1.30006
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 241.3 55.7 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -388.954848 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.143976 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907580_1_186_MLBR_RS00905: 0.000004, NC_002677_1_NP_301255_1_127_ML0180: 0.000004, NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080: 0.000004, NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400: 0.000004, NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955: 0.000004, NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.14398 0.85602
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 245.9 51.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -388.954848 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.012286 0.906629 0.000001 8.788296
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907580_1_186_MLBR_RS00905: 0.000004, NC_002677_1_NP_301255_1_127_ML0180: 0.000004, NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080: 0.000004, NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400: 0.000004, NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955: 0.000004, NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01229 0.90663 0.08109
w: 0.00000 1.00000 8.78830
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
7..2 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
7..3 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
7..4 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
7..5 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
7..6 0.000 245.9 51.1 1.6192 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907580_1_186_MLBR_RS00905)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907580_1_186_MLBR_RS00905)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -388.954849 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.571725
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907580_1_186_MLBR_RS00905: 0.000004, NC_002677_1_NP_301255_1_127_ML0180: 0.000004, NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080: 0.000004, NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400: 0.000004, NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955: 0.000004, NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.57173
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 245.9 51.1 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -388.954848 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.709256 0.005000 2.027996 1.744026
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907580_1_186_MLBR_RS00905: 0.000004, NC_002677_1_NP_301255_1_127_ML0180: 0.000004, NZ_LVXE01000071_1_WP_010907580_1_2590_A3216_RS13080: 0.000004, NZ_LYPH01000058_1_WP_010907580_1_2175_A8144_RS10400: 0.000004, NZ_CP029543_1_WP_010907580_1_185_DIJ64_RS00955: 0.000004, NZ_AP014567_1_WP_010907580_1_191_JK2ML_RS00985: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.70926 p = 0.00500 q = 2.02800
(p1 = 0.29074) w = 1.74403
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07093 0.07093 0.07093 0.07093 0.07093 0.07093 0.07093 0.07093 0.07093 0.07093 0.29074
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.74403
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
7..2 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
7..3 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
7..4 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
7..5 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
7..6 0.000 245.9 51.1 0.5071 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907580_1_186_MLBR_RS00905)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907580_1_186_MLBR_RS00905)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -388.954848 Model 2: PositiveSelection -388.954848 Model 0: one-ratio -388.954854 Model 7: beta -388.954849 Model 8: beta&w>1 -388.954848 Model 0 vs 1 1.1999999969702912E-5 Model 2 vs 1 0.0 Model 8 vs 7 1.9999999949504854E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
