--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:29:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/mihF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -425.04 -428.39
2 -425.07 -427.95
--------------------------------------
TOTAL -425.05 -428.19
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901669 0.089881 0.395678 1.497034 0.865119 1313.17 1326.21 1.000
r(A<->C){all} 0.153739 0.015728 0.000004 0.392968 0.124279 214.09 238.78 1.000
r(A<->G){all} 0.176741 0.018999 0.000008 0.446021 0.146492 178.17 248.36 1.009
r(A<->T){all} 0.168426 0.018659 0.000081 0.444462 0.135526 138.87 180.83 1.001
r(C<->G){all} 0.159379 0.017255 0.000154 0.436599 0.125881 187.98 244.51 1.000
r(C<->T){all} 0.169897 0.018890 0.000027 0.446860 0.134431 259.40 260.42 1.006
r(G<->T){all} 0.171817 0.019473 0.000020 0.437535 0.141044 173.25 177.63 1.000
pi(A){all} 0.225302 0.000567 0.179762 0.271619 0.224961 1195.36 1223.94 1.000
pi(C){all} 0.282571 0.000650 0.231698 0.329833 0.282023 1227.68 1286.29 1.000
pi(G){all} 0.340920 0.000738 0.291221 0.396605 0.340473 1163.59 1267.16 1.000
pi(T){all} 0.151207 0.000402 0.114472 0.191490 0.151234 1278.22 1339.65 1.000
alpha{1,2} 0.409079 0.219884 0.000112 1.372095 0.243418 1129.95 1184.52 1.001
alpha{3} 0.449978 0.222383 0.000198 1.351429 0.295672 1117.19 1309.09 1.000
pinvar{all} 0.994917 0.000039 0.982786 0.999997 0.996922 1133.69 1297.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -405.877907
Model 2: PositiveSelection -405.877781
Model 0: one-ratio -405.877781
Model 7: beta -405.877964
Model 8: beta&w>1 -405.877781
Model 0 vs 1 2.5199999993219535E-4
Model 2 vs 1 2.5199999993219535E-4
Model 8 vs 7 3.6599999998543353E-4
>C1
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C2
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C3
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C4
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C5
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C6
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=105
C1 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C2 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C3 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C4 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C5 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C6 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
**************************************************
C1 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C2 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C3 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C4 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C5 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C6 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
**************************************************
C1 KFGSA
C2 KFGSA
C3 KFGSA
C4 KFGSA
C5 KFGSA
C6 KFGSA
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3150]--->[3150]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.455 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C2 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C3 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C4 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C5 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C6 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
**************************************************
C1 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C2 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C3 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C4 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C5 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C6 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
**************************************************
C1 KFGSA
C2 KFGSA
C3 KFGSA
C4 KFGSA
C5 KFGSA
C6 KFGSA
*****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C2 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C3 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C4 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C5 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C6 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
**************************************************
C1 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C2 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C3 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C4 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C5 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C6 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
**************************************************
C1 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C2 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C3 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C4 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C5 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C6 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
**************************************************
C1 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C2 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C3 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C4 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C5 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C6 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
**************************************************
C1 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C2 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C3 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C4 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C5 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C6 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
**************************************************
C1 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C2 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C3 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C4 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C5 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C6 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
**************************************************
C1 AAGTTCGGCTCCGCT
C2 AAGTTCGGCTCCGCT
C3 AAGTTCGGCTCCGCT
C4 AAGTTCGGCTCCGCT
C5 AAGTTCGGCTCCGCT
C6 AAGTTCGGCTCCGCT
***************
>C1
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C2
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C3
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C4
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C5
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C6
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C1
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C2
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C3
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C4
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C5
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C6
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 315 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579793297
Setting output file names to "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1407008590
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0010583267
Seed = 102108396
Swapseed = 1579793297
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -704.985062 -- -24.965149
Chain 2 -- -704.985102 -- -24.965149
Chain 3 -- -704.984995 -- -24.965149
Chain 4 -- -704.985102 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -704.985102 -- -24.965149
Chain 2 -- -704.985102 -- -24.965149
Chain 3 -- -704.985062 -- -24.965149
Chain 4 -- -704.984995 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-704.985] (-704.985) (-704.985) (-704.985) * [-704.985] (-704.985) (-704.985) (-704.985)
500 -- [-430.189] (-444.597) (-435.498) (-450.390) * [-433.379] (-437.476) (-438.126) (-433.862) -- 0:00:00
1000 -- (-431.087) [-435.407] (-436.839) (-446.981) * (-432.753) (-441.773) [-437.956] (-446.367) -- 0:00:00
1500 -- (-439.218) [-430.685] (-437.724) (-437.704) * (-437.172) (-434.799) (-437.753) [-436.280] -- 0:00:00
2000 -- (-433.963) (-437.440) [-436.641] (-437.187) * (-433.342) [-437.541] (-436.414) (-434.867) -- 0:00:00
2500 -- (-433.962) (-436.302) [-439.990] (-429.649) * (-439.135) [-428.202] (-435.727) (-440.061) -- 0:00:00
3000 -- (-438.914) [-437.777] (-438.907) (-439.306) * [-429.579] (-438.309) (-435.682) (-431.418) -- 0:00:00
3500 -- (-441.618) (-437.690) (-433.374) [-431.564] * (-430.738) (-445.517) [-438.692] (-437.735) -- 0:00:00
4000 -- [-436.167] (-439.249) (-441.047) (-437.124) * [-429.089] (-443.320) (-448.831) (-431.509) -- 0:00:00
4500 -- (-434.317) [-432.947] (-433.890) (-434.394) * [-431.527] (-448.091) (-436.184) (-434.057) -- 0:00:00
5000 -- (-437.490) (-440.417) [-443.312] (-435.189) * [-431.303] (-436.798) (-434.501) (-429.982) -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-435.043) (-441.771) [-432.844] (-435.939) * (-435.020) [-426.878] (-437.007) (-440.896) -- 0:00:00
6000 -- (-439.068) [-435.411] (-429.862) (-429.668) * (-434.220) (-429.829) (-436.340) [-433.957] -- 0:00:00
6500 -- (-436.617) (-434.052) [-436.598] (-436.579) * [-430.893] (-424.538) (-436.674) (-437.094) -- 0:00:00
7000 -- (-436.846) [-431.907] (-434.941) (-439.035) * (-431.713) [-424.670] (-446.539) (-436.538) -- 0:00:00
7500 -- [-433.595] (-444.832) (-433.993) (-442.618) * (-432.722) (-424.530) [-435.536] (-436.207) -- 0:00:00
8000 -- [-434.141] (-432.521) (-432.452) (-435.192) * (-443.877) [-425.669] (-431.076) (-434.203) -- 0:00:00
8500 -- (-435.515) (-439.921) (-434.950) [-433.838] * (-433.695) (-427.650) [-431.939] (-438.423) -- 0:00:00
9000 -- (-435.829) (-457.551) (-443.493) [-432.794] * [-437.237] (-426.976) (-436.852) (-434.036) -- 0:00:00
9500 -- (-437.270) (-447.336) (-432.513) [-437.855] * (-433.769) (-426.567) [-434.466] (-439.037) -- 0:00:00
10000 -- (-436.439) [-436.144] (-428.221) (-436.474) * [-432.955] (-424.862) (-437.710) (-438.424) -- 0:00:00
Average standard deviation of split frequencies: 0.057452
10500 -- (-430.045) (-427.883) [-424.722] (-439.086) * (-434.585) [-425.748] (-438.240) (-436.295) -- 0:00:00
11000 -- (-436.683) [-424.921] (-424.340) (-438.299) * (-430.950) (-425.160) (-431.012) [-431.078] -- 0:00:00
11500 -- (-431.886) (-426.336) [-424.837] (-432.049) * [-431.105] (-423.921) (-429.149) (-431.295) -- 0:00:00
12000 -- (-439.746) [-426.233] (-425.128) (-429.461) * (-438.344) [-424.945] (-434.544) (-439.211) -- 0:00:00
12500 -- [-433.529] (-429.042) (-424.435) (-424.153) * [-429.883] (-432.136) (-436.788) (-440.323) -- 0:00:00
13000 -- [-434.606] (-425.264) (-425.236) (-426.692) * (-434.290) (-424.598) [-431.476] (-436.654) -- 0:00:00
13500 -- (-435.969) (-426.689) (-428.287) [-424.952] * (-437.403) [-426.056] (-436.176) (-436.208) -- 0:01:13
14000 -- (-436.305) (-426.118) (-425.822) [-426.361] * [-438.268] (-427.148) (-435.021) (-439.918) -- 0:01:10
14500 -- (-432.316) (-425.908) (-425.414) [-430.118] * [-427.164] (-428.176) (-440.616) (-437.515) -- 0:01:07
15000 -- (-436.391) (-425.471) [-425.045] (-424.819) * [-432.928] (-425.938) (-441.454) (-430.233) -- 0:01:05
Average standard deviation of split frequencies: 0.060562
15500 -- [-433.815] (-425.310) (-424.687) (-425.876) * (-431.248) [-428.097] (-430.907) (-442.698) -- 0:01:03
16000 -- [-430.699] (-425.586) (-428.050) (-426.502) * (-432.351) (-426.152) (-430.912) [-433.997] -- 0:01:01
16500 -- [-435.836] (-425.137) (-428.700) (-428.494) * (-435.306) (-426.806) (-441.656) [-434.818] -- 0:00:59
17000 -- (-440.192) [-426.539] (-429.457) (-429.277) * (-433.863) (-424.983) [-435.140] (-435.643) -- 0:00:57
17500 -- (-434.957) (-430.874) [-425.357] (-425.436) * (-434.427) (-425.885) (-447.205) [-448.220] -- 0:00:56
18000 -- (-434.931) (-428.961) [-424.356] (-425.100) * [-431.708] (-425.265) (-449.057) (-444.738) -- 0:00:54
18500 -- (-436.440) (-426.718) [-424.382] (-424.302) * (-435.325) (-425.782) (-432.406) [-434.228] -- 0:00:53
19000 -- (-436.383) (-424.548) [-425.110] (-426.134) * (-436.275) (-427.445) (-437.220) [-433.905] -- 0:00:51
19500 -- [-434.040] (-428.519) (-424.751) (-426.748) * (-435.546) [-428.173] (-437.975) (-434.026) -- 0:00:50
20000 -- (-432.568) (-425.354) (-424.746) [-425.519] * (-435.419) [-424.400] (-448.426) (-431.500) -- 0:00:49
Average standard deviation of split frequencies: 0.061721
20500 -- (-436.391) [-425.565] (-424.656) (-427.382) * (-435.138) [-425.891] (-437.661) (-435.888) -- 0:00:47
21000 -- (-435.967) (-424.881) [-423.572] (-428.436) * (-429.990) [-425.187] (-434.120) (-442.348) -- 0:00:46
21500 -- (-432.343) [-424.241] (-427.379) (-427.118) * (-435.027) (-424.749) [-436.115] (-427.573) -- 0:00:45
22000 -- (-443.362) (-423.844) [-425.121] (-424.633) * (-442.478) [-423.422] (-428.639) (-424.483) -- 0:00:44
22500 -- (-434.047) (-426.203) (-426.346) [-426.828] * (-439.869) (-424.109) [-424.284] (-427.268) -- 0:00:43
23000 -- [-437.279] (-426.006) (-427.403) (-426.468) * (-433.635) [-424.797] (-424.892) (-424.138) -- 0:00:42
23500 -- (-432.305) [-427.661] (-430.502) (-424.801) * [-433.117] (-426.403) (-424.236) (-425.082) -- 0:00:41
24000 -- (-431.066) (-428.322) [-424.436] (-425.728) * (-437.965) [-424.789] (-425.512) (-424.771) -- 0:00:40
24500 -- (-433.725) [-425.073] (-425.966) (-423.813) * (-430.950) (-427.492) (-425.124) [-424.704] -- 0:00:39
25000 -- (-436.576) (-425.567) [-429.461] (-424.457) * (-433.344) (-423.430) (-428.251) [-425.852] -- 0:00:39
Average standard deviation of split frequencies: 0.050767
25500 -- (-438.597) (-427.597) [-424.741] (-423.320) * (-438.823) (-426.106) [-424.810] (-423.747) -- 0:00:38
26000 -- (-435.719) (-427.402) [-423.642] (-432.750) * [-434.982] (-425.434) (-424.827) (-426.994) -- 0:00:37
26500 -- (-443.584) (-426.513) [-424.312] (-429.985) * (-435.200) (-424.589) [-427.156] (-424.295) -- 0:00:36
27000 -- (-430.132) [-424.178] (-425.189) (-425.010) * (-432.993) [-424.551] (-424.767) (-424.203) -- 0:00:36
27500 -- (-427.429) (-426.618) [-424.536] (-424.600) * [-435.314] (-424.688) (-424.656) (-426.646) -- 0:00:35
28000 -- (-426.310) (-425.380) [-424.360] (-425.095) * (-434.052) (-423.964) (-425.792) [-425.264] -- 0:00:34
28500 -- (-424.085) (-428.131) [-423.901] (-424.753) * [-435.657] (-427.576) (-427.060) (-424.349) -- 0:00:34
29000 -- (-425.234) (-425.397) (-425.959) [-425.865] * (-439.477) (-426.466) [-427.514] (-428.995) -- 0:00:33
29500 -- (-426.926) (-425.866) [-424.770] (-425.256) * (-434.995) [-427.752] (-427.435) (-424.836) -- 0:01:05
30000 -- (-426.312) [-426.505] (-425.155) (-424.363) * (-433.246) (-425.250) [-427.629] (-429.031) -- 0:01:04
Average standard deviation of split frequencies: 0.054570
30500 -- (-431.102) (-425.038) [-424.559] (-426.309) * (-437.342) (-430.064) [-425.479] (-425.706) -- 0:01:03
31000 -- (-427.742) [-424.182] (-425.235) (-424.918) * (-436.383) (-427.998) (-425.974) [-425.148] -- 0:01:02
31500 -- (-431.745) (-430.572) (-424.053) [-424.723] * (-432.729) (-424.570) [-426.829] (-424.305) -- 0:01:01
32000 -- (-425.193) (-426.328) [-428.353] (-427.958) * (-440.160) [-428.626] (-427.359) (-428.364) -- 0:01:00
32500 -- [-423.647] (-430.112) (-424.786) (-427.746) * (-442.579) (-426.352) [-426.302] (-424.059) -- 0:00:59
33000 -- (-424.679) [-430.446] (-425.435) (-425.494) * (-434.560) [-426.422] (-426.143) (-426.517) -- 0:00:58
33500 -- (-426.520) (-425.049) (-427.032) [-427.009] * [-430.792] (-425.047) (-424.298) (-427.421) -- 0:00:57
34000 -- [-424.886] (-424.001) (-424.383) (-426.158) * [-429.784] (-424.858) (-431.236) (-427.199) -- 0:00:56
34500 -- (-424.339) (-427.384) [-424.660] (-425.124) * (-440.332) [-427.787] (-432.534) (-428.390) -- 0:00:55
35000 -- (-425.187) (-425.787) [-425.364] (-424.829) * (-441.571) (-424.220) (-429.482) [-426.421] -- 0:00:55
Average standard deviation of split frequencies: 0.047795
35500 -- (-424.968) [-428.017] (-423.608) (-426.154) * (-443.183) (-425.368) [-425.055] (-424.300) -- 0:00:54
36000 -- (-424.750) (-425.929) (-424.621) [-426.154] * [-433.147] (-429.551) (-432.656) (-424.851) -- 0:00:53
36500 -- (-424.999) (-427.650) (-424.100) [-424.491] * [-430.286] (-426.082) (-428.601) (-425.354) -- 0:00:52
37000 -- (-426.675) (-428.911) (-425.805) [-427.586] * (-433.994) (-426.267) [-431.946] (-425.500) -- 0:00:52
37500 -- (-424.421) (-432.601) [-424.488] (-426.021) * (-432.741) (-426.507) (-428.818) [-426.566] -- 0:00:51
38000 -- (-425.697) [-425.305] (-425.757) (-425.117) * (-436.558) (-426.034) (-425.642) [-424.521] -- 0:00:50
38500 -- (-424.999) (-426.191) [-426.576] (-423.552) * [-438.116] (-425.346) (-424.396) (-432.774) -- 0:00:49
39000 -- (-425.617) [-425.890] (-424.871) (-424.530) * (-441.226) (-424.388) (-426.589) [-430.795] -- 0:00:49
39500 -- [-426.942] (-425.362) (-425.031) (-424.000) * (-433.400) (-425.290) [-424.847] (-424.963) -- 0:00:48
40000 -- (-426.953) (-425.880) [-424.468] (-424.167) * (-442.660) (-425.002) [-423.484] (-425.150) -- 0:00:48
Average standard deviation of split frequencies: 0.037937
40500 -- (-430.290) [-425.046] (-423.671) (-429.010) * (-432.725) [-427.066] (-427.265) (-426.401) -- 0:00:47
41000 -- (-426.978) (-424.828) (-423.775) [-425.699] * (-442.537) (-427.451) [-424.525] (-425.643) -- 0:00:46
41500 -- (-427.024) (-425.662) (-426.092) [-425.111] * [-435.898] (-428.031) (-424.472) (-426.166) -- 0:00:46
42000 -- (-427.278) (-423.962) (-425.834) [-424.452] * [-439.845] (-427.469) (-423.561) (-425.340) -- 0:00:45
42500 -- [-427.119] (-428.188) (-427.154) (-424.988) * (-429.392) (-425.454) (-423.926) [-426.865] -- 0:00:45
43000 -- (-426.429) (-424.648) (-427.318) [-425.356] * (-438.324) (-425.464) [-424.536] (-424.366) -- 0:00:44
43500 -- [-431.176] (-425.113) (-426.904) (-424.688) * (-431.055) (-427.973) (-425.269) [-425.361] -- 0:00:43
44000 -- [-425.696] (-425.906) (-425.078) (-424.780) * (-443.311) [-423.741] (-425.258) (-429.322) -- 0:00:43
44500 -- (-428.204) (-425.766) [-427.462] (-427.687) * (-449.287) [-426.733] (-428.903) (-428.868) -- 0:00:42
45000 -- (-425.994) (-424.612) [-425.053] (-425.643) * (-446.318) (-426.915) (-424.704) [-424.649] -- 0:01:03
Average standard deviation of split frequencies: 0.038552
45500 -- (-432.975) (-428.835) [-425.008] (-424.322) * (-433.060) [-426.005] (-428.505) (-428.619) -- 0:01:02
46000 -- (-433.220) [-427.313] (-424.619) (-425.300) * (-425.353) (-427.811) (-428.013) [-426.401] -- 0:01:02
46500 -- [-427.347] (-426.993) (-425.501) (-423.590) * (-428.290) (-425.481) (-427.625) [-424.679] -- 0:01:01
47000 -- (-425.377) (-427.855) (-425.430) [-430.635] * (-427.991) [-427.661] (-426.171) (-425.329) -- 0:01:00
47500 -- (-426.753) (-426.714) [-424.313] (-425.716) * (-428.448) [-424.506] (-425.069) (-424.523) -- 0:01:00
48000 -- (-426.607) (-426.529) (-425.495) [-427.950] * (-425.602) [-427.570] (-426.545) (-424.379) -- 0:00:59
48500 -- [-424.118] (-426.557) (-424.516) (-424.021) * (-426.026) (-432.553) (-428.075) [-423.864] -- 0:00:58
49000 -- [-424.298] (-427.570) (-427.027) (-424.008) * (-428.918) [-425.561] (-427.002) (-423.972) -- 0:00:58
49500 -- (-427.482) (-428.613) [-426.799] (-426.843) * (-427.128) (-430.095) (-426.125) [-424.961] -- 0:00:57
50000 -- (-426.389) (-424.839) (-424.568) [-426.336] * (-430.081) (-425.412) (-425.739) [-425.319] -- 0:00:57
Average standard deviation of split frequencies: 0.044748
50500 -- (-427.327) (-423.981) [-428.861] (-424.736) * (-428.005) (-427.293) (-425.654) [-425.104] -- 0:00:56
51000 -- [-424.618] (-424.775) (-427.343) (-426.012) * [-427.803] (-425.540) (-425.617) (-427.071) -- 0:00:55
51500 -- (-424.000) (-424.572) [-427.859] (-424.401) * (-426.975) (-426.518) (-424.289) [-424.650] -- 0:00:55
52000 -- (-426.144) [-424.632] (-430.645) (-424.354) * (-423.702) [-425.904] (-424.166) (-424.397) -- 0:00:54
52500 -- (-427.245) (-424.125) (-425.643) [-424.406] * (-427.200) (-428.057) [-425.305] (-427.021) -- 0:00:54
53000 -- (-425.632) (-425.055) [-425.373] (-424.485) * (-425.423) [-425.677] (-425.050) (-424.456) -- 0:00:53
53500 -- (-426.761) (-424.403) [-424.207] (-426.836) * (-424.577) (-425.417) (-424.423) [-425.459] -- 0:00:53
54000 -- (-425.640) (-428.611) [-424.217] (-428.318) * (-424.507) (-424.901) (-424.324) [-426.390] -- 0:00:52
54500 -- [-424.751] (-431.123) (-428.271) (-425.904) * (-424.712) (-426.719) [-425.089] (-427.281) -- 0:00:52
55000 -- (-428.312) [-425.011] (-425.012) (-424.335) * (-424.958) (-428.941) [-427.953] (-424.401) -- 0:00:51
Average standard deviation of split frequencies: 0.042511
55500 -- (-426.014) (-427.725) (-427.082) [-428.335] * (-427.079) (-429.329) [-426.044] (-425.816) -- 0:00:51
56000 -- (-424.539) [-425.076] (-426.517) (-424.890) * (-428.834) (-425.336) (-424.662) [-424.937] -- 0:00:50
56500 -- (-432.979) (-424.536) (-425.305) [-425.421] * (-424.348) [-423.827] (-429.041) (-426.143) -- 0:00:50
57000 -- (-426.296) [-424.042] (-426.540) (-424.776) * (-425.341) (-424.103) (-429.495) [-424.797] -- 0:00:49
57500 -- [-427.083] (-425.004) (-424.949) (-426.452) * [-427.942] (-427.226) (-425.353) (-426.923) -- 0:00:49
58000 -- (-426.938) (-428.035) [-425.515] (-424.996) * (-425.568) (-423.887) [-427.681] (-426.648) -- 0:00:48
58500 -- (-425.167) (-424.121) [-426.905] (-426.752) * (-425.615) (-424.591) [-425.235] (-427.411) -- 0:00:48
59000 -- (-425.444) (-425.650) (-424.657) [-425.159] * [-427.820] (-424.620) (-426.358) (-426.810) -- 0:00:47
59500 -- [-424.758] (-424.478) (-424.866) (-425.266) * (-425.532) [-423.971] (-424.313) (-425.944) -- 0:00:47
60000 -- (-425.508) [-428.803] (-427.522) (-426.242) * (-425.479) (-428.040) (-431.385) [-425.536] -- 0:00:47
Average standard deviation of split frequencies: 0.036807
60500 -- (-425.653) [-426.772] (-427.369) (-427.782) * (-427.102) [-426.398] (-426.890) (-427.289) -- 0:00:46
61000 -- (-423.953) [-429.293] (-427.270) (-425.791) * [-425.255] (-425.823) (-429.319) (-430.637) -- 0:01:01
61500 -- (-423.763) (-428.252) (-424.609) [-426.457] * (-425.424) [-426.343] (-427.461) (-432.146) -- 0:01:01
62000 -- (-424.951) (-425.936) (-426.097) [-425.394] * [-425.790] (-426.127) (-426.834) (-425.880) -- 0:01:00
62500 -- [-425.245] (-428.371) (-426.440) (-423.537) * [-425.503] (-424.161) (-425.674) (-423.613) -- 0:01:00
63000 -- (-425.323) (-429.370) (-425.700) [-425.254] * [-425.644] (-423.829) (-426.678) (-425.735) -- 0:00:59
63500 -- [-427.225] (-426.683) (-429.616) (-429.416) * (-425.755) (-423.989) [-425.966] (-426.501) -- 0:00:58
64000 -- [-425.813] (-427.150) (-426.217) (-428.435) * (-425.216) [-423.983] (-426.875) (-425.907) -- 0:00:58
64500 -- (-425.110) (-425.193) (-428.887) [-425.993] * (-425.069) (-426.053) (-423.844) [-424.480] -- 0:00:58
65000 -- [-424.491] (-424.307) (-424.194) (-425.919) * [-427.277] (-425.311) (-425.032) (-424.822) -- 0:00:57
Average standard deviation of split frequencies: 0.027856
65500 -- [-428.004] (-426.387) (-425.523) (-427.982) * (-427.508) (-425.895) (-425.512) [-425.637] -- 0:00:57
66000 -- (-426.165) [-424.040] (-425.750) (-424.937) * (-426.225) [-428.484] (-425.945) (-426.377) -- 0:00:56
66500 -- [-427.905] (-425.268) (-430.038) (-430.461) * (-425.282) [-424.929] (-425.080) (-424.457) -- 0:00:56
67000 -- [-425.494] (-425.434) (-428.726) (-425.342) * [-424.029] (-426.757) (-424.663) (-426.748) -- 0:00:55
67500 -- [-427.823] (-427.469) (-429.867) (-424.379) * (-424.814) [-425.152] (-427.497) (-427.072) -- 0:00:55
68000 -- (-425.868) (-426.765) [-425.052] (-424.517) * (-426.714) [-424.768] (-425.896) (-427.641) -- 0:00:54
68500 -- (-428.812) (-424.731) (-427.423) [-426.716] * (-426.640) (-426.454) (-424.290) [-427.776] -- 0:00:54
69000 -- [-427.122] (-425.162) (-424.908) (-427.596) * (-427.509) [-424.374] (-424.255) (-429.359) -- 0:00:53
69500 -- (-428.213) (-426.218) (-427.078) [-425.322] * (-427.075) [-426.401] (-428.280) (-427.248) -- 0:00:53
70000 -- (-425.506) (-424.787) [-424.546] (-426.395) * (-428.618) (-430.426) [-429.715] (-426.649) -- 0:00:53
Average standard deviation of split frequencies: 0.025279
70500 -- (-424.123) (-427.673) (-424.054) [-424.655] * (-426.446) (-430.498) [-427.457] (-426.624) -- 0:00:52
71000 -- (-426.820) (-426.371) (-427.454) [-424.542] * (-426.615) (-425.619) (-425.015) [-425.257] -- 0:00:52
71500 -- (-429.523) (-425.940) (-427.352) [-425.230] * (-428.242) [-426.994] (-425.571) (-424.071) -- 0:00:51
72000 -- (-427.982) (-427.371) [-425.080] (-427.519) * (-424.172) (-423.743) (-426.366) [-424.716] -- 0:00:51
72500 -- (-426.906) (-425.967) (-429.753) [-426.311] * (-430.114) (-426.564) (-427.395) [-426.379] -- 0:00:51
73000 -- (-424.547) [-427.935] (-427.770) (-426.878) * [-424.773] (-425.516) (-426.095) (-427.591) -- 0:00:50
73500 -- (-427.240) [-423.842] (-425.544) (-424.403) * (-427.878) [-425.919] (-425.842) (-425.051) -- 0:00:50
74000 -- (-426.179) (-424.236) [-425.709] (-425.246) * (-435.082) (-424.156) (-426.971) [-427.067] -- 0:00:50
74500 -- (-427.130) (-424.587) [-425.506] (-424.079) * [-425.136] (-426.044) (-426.777) (-424.955) -- 0:00:49
75000 -- (-424.868) (-429.559) (-425.007) [-426.112] * (-425.430) (-426.467) [-426.387] (-428.794) -- 0:00:49
Average standard deviation of split frequencies: 0.024811
75500 -- (-424.945) (-426.509) (-424.238) [-426.661] * (-425.474) (-424.581) (-426.798) [-428.014] -- 0:00:48
76000 -- (-428.866) [-424.244] (-425.167) (-425.093) * (-427.843) [-427.082] (-427.572) (-425.145) -- 0:00:48
76500 -- [-425.097] (-431.758) (-430.173) (-425.438) * (-426.832) [-428.351] (-425.618) (-427.677) -- 0:00:48
77000 -- (-425.988) [-428.417] (-427.974) (-425.563) * [-426.725] (-427.658) (-428.712) (-425.006) -- 0:00:47
77500 -- [-423.630] (-424.569) (-424.544) (-426.874) * (-424.683) (-427.054) (-429.457) [-425.771] -- 0:00:47
78000 -- (-424.600) (-425.767) [-424.667] (-428.041) * [-424.963] (-425.177) (-425.173) (-428.592) -- 0:00:59
78500 -- (-430.278) [-425.961] (-427.230) (-425.552) * (-423.624) [-425.847] (-426.526) (-424.785) -- 0:00:58
79000 -- [-427.147] (-424.642) (-425.458) (-426.732) * [-425.530] (-425.080) (-424.175) (-424.425) -- 0:00:58
79500 -- (-423.922) (-424.217) [-425.224] (-425.228) * (-426.998) [-425.363] (-424.698) (-424.864) -- 0:00:57
80000 -- (-424.102) (-426.047) [-425.653] (-429.146) * (-425.995) [-424.233] (-425.166) (-429.511) -- 0:00:57
Average standard deviation of split frequencies: 0.022453
80500 -- [-424.851] (-423.813) (-425.325) (-427.156) * (-426.201) [-430.188] (-426.091) (-424.392) -- 0:00:57
81000 -- [-424.641] (-423.606) (-431.094) (-430.552) * (-426.428) [-427.494] (-426.007) (-428.271) -- 0:00:56
81500 -- (-427.697) [-426.999] (-426.058) (-425.328) * (-427.475) (-426.136) [-425.120] (-425.638) -- 0:00:56
82000 -- (-423.871) (-429.600) (-427.750) [-428.195] * (-425.809) [-426.827] (-426.155) (-427.000) -- 0:00:55
82500 -- (-427.955) (-425.211) (-426.642) [-427.268] * (-425.096) (-428.457) [-426.092] (-425.557) -- 0:00:55
83000 -- (-425.257) (-427.974) (-423.647) [-424.346] * (-426.497) (-426.336) [-430.435] (-426.065) -- 0:00:55
83500 -- [-426.963] (-429.682) (-423.762) (-426.396) * [-426.185] (-426.773) (-427.510) (-425.926) -- 0:00:54
84000 -- (-427.650) [-424.281] (-425.978) (-424.306) * (-424.756) (-426.596) (-425.840) [-424.575] -- 0:00:54
84500 -- (-427.755) (-425.394) (-424.046) [-426.953] * [-425.623] (-427.436) (-424.367) (-424.693) -- 0:00:54
85000 -- (-425.737) (-426.385) [-424.935] (-425.371) * (-425.097) [-426.041] (-428.088) (-424.666) -- 0:00:53
Average standard deviation of split frequencies: 0.022503
85500 -- (-425.097) (-425.817) [-425.639] (-424.036) * [-424.677] (-426.373) (-427.686) (-430.747) -- 0:00:53
86000 -- (-426.694) [-426.295] (-428.248) (-425.860) * (-427.823) (-425.132) (-425.772) [-425.994] -- 0:00:53
86500 -- (-430.312) (-424.244) (-430.282) [-428.339] * (-427.543) [-423.880] (-424.058) (-424.400) -- 0:00:52
87000 -- (-426.932) [-428.313] (-427.787) (-427.764) * (-427.335) (-429.173) (-428.168) [-424.703] -- 0:00:52
87500 -- (-425.189) (-425.075) (-425.704) [-424.788] * [-423.472] (-432.153) (-425.723) (-424.852) -- 0:00:52
88000 -- (-424.153) (-428.194) [-424.161] (-424.161) * (-424.172) [-428.741] (-425.269) (-426.974) -- 0:00:51
88500 -- (-424.363) (-425.920) [-426.122] (-428.008) * (-427.836) (-424.909) [-429.806] (-426.582) -- 0:00:51
89000 -- [-424.375] (-426.388) (-424.332) (-425.532) * (-424.887) (-424.961) (-426.848) [-424.513] -- 0:00:51
89500 -- (-425.389) (-424.990) [-425.994] (-424.211) * (-423.785) (-424.470) (-425.708) [-426.234] -- 0:00:50
90000 -- (-424.620) [-426.692] (-429.269) (-426.658) * (-425.831) (-424.343) [-425.079] (-426.058) -- 0:00:50
Average standard deviation of split frequencies: 0.020797
90500 -- [-424.006] (-430.780) (-430.991) (-428.436) * (-426.920) [-426.234] (-425.396) (-426.568) -- 0:00:50
91000 -- [-426.662] (-426.471) (-424.424) (-427.932) * [-426.298] (-426.101) (-426.426) (-426.701) -- 0:00:49
91500 -- (-427.630) (-427.658) (-427.082) [-424.530] * (-424.337) (-428.064) (-426.435) [-426.206] -- 0:00:49
92000 -- (-427.182) [-426.550] (-425.409) (-424.145) * (-427.185) (-424.749) [-425.721] (-425.413) -- 0:00:49
92500 -- [-425.793] (-425.748) (-425.757) (-427.071) * (-427.377) [-424.596] (-426.486) (-430.359) -- 0:00:49
93000 -- (-426.975) (-427.248) [-426.468] (-430.036) * [-424.844] (-426.449) (-430.441) (-427.603) -- 0:00:48
93500 -- (-427.232) (-424.630) [-424.986] (-426.703) * (-425.358) (-429.081) [-429.229] (-427.624) -- 0:00:48
94000 -- (-425.854) [-425.580] (-423.889) (-425.084) * [-427.792] (-430.481) (-424.103) (-425.990) -- 0:00:48
94500 -- (-424.323) (-427.443) (-429.200) [-424.872] * (-427.880) (-426.448) [-427.607] (-427.998) -- 0:00:57
95000 -- (-427.868) (-427.335) [-426.622] (-424.861) * (-424.469) [-425.442] (-430.802) (-426.836) -- 0:00:57
Average standard deviation of split frequencies: 0.020110
95500 -- [-425.540] (-425.530) (-424.250) (-427.142) * [-426.450] (-430.258) (-424.157) (-423.879) -- 0:00:56
96000 -- (-427.699) (-426.127) [-425.180] (-424.239) * [-429.119] (-425.798) (-425.593) (-423.773) -- 0:00:56
96500 -- [-428.300] (-429.390) (-423.764) (-428.941) * (-426.814) [-426.275] (-431.667) (-426.135) -- 0:00:56
97000 -- (-426.046) (-425.519) [-425.235] (-424.095) * (-428.707) (-431.387) [-426.717] (-426.173) -- 0:00:55
97500 -- (-424.811) (-423.948) [-425.165] (-425.335) * (-424.845) [-424.617] (-425.547) (-427.411) -- 0:00:55
98000 -- (-429.835) (-424.300) (-428.897) [-429.972] * [-429.137] (-428.579) (-426.520) (-425.016) -- 0:00:55
98500 -- [-429.978] (-425.425) (-425.499) (-427.201) * (-428.343) (-427.828) (-429.095) [-425.345] -- 0:00:54
99000 -- (-429.208) (-426.485) [-427.029] (-424.282) * (-427.640) (-427.425) (-425.838) [-428.674] -- 0:00:54
99500 -- (-425.233) (-427.216) [-423.725] (-425.489) * (-424.419) [-428.433] (-428.763) (-425.374) -- 0:00:54
100000 -- (-426.302) [-426.832] (-423.566) (-425.839) * (-424.853) (-427.848) (-425.603) [-426.075] -- 0:00:54
Average standard deviation of split frequencies: 0.019400
100500 -- (-424.765) (-430.872) [-424.822] (-424.071) * (-424.340) (-426.150) [-428.011] (-425.779) -- 0:00:53
101000 -- [-424.308] (-424.786) (-424.043) (-428.208) * (-425.910) [-427.518] (-424.926) (-424.597) -- 0:00:53
101500 -- (-426.474) (-425.393) [-425.242] (-425.881) * [-424.207] (-426.204) (-425.049) (-427.759) -- 0:00:53
102000 -- (-425.549) (-424.518) [-423.693] (-424.451) * (-426.833) (-427.608) (-425.056) [-426.986] -- 0:00:52
102500 -- [-428.911] (-424.090) (-430.763) (-425.525) * [-426.884] (-424.904) (-426.487) (-425.293) -- 0:00:52
103000 -- [-430.074] (-427.787) (-431.152) (-424.687) * [-428.623] (-425.265) (-426.860) (-426.726) -- 0:00:52
103500 -- [-425.702] (-425.679) (-429.600) (-426.120) * [-424.455] (-423.662) (-426.871) (-426.025) -- 0:00:51
104000 -- (-426.546) (-425.738) [-428.987] (-424.557) * (-425.382) (-425.365) (-429.540) [-426.336] -- 0:00:51
104500 -- (-424.879) [-423.520] (-427.653) (-425.266) * [-423.572] (-424.675) (-427.870) (-426.158) -- 0:00:51
105000 -- [-425.269] (-425.306) (-428.438) (-424.225) * (-426.180) [-425.260] (-424.959) (-424.943) -- 0:00:51
Average standard deviation of split frequencies: 0.019271
105500 -- [-426.514] (-425.066) (-425.693) (-424.603) * [-425.229] (-427.556) (-424.754) (-428.630) -- 0:00:50
106000 -- (-425.096) (-424.863) (-424.603) [-423.986] * [-428.187] (-424.340) (-425.902) (-426.693) -- 0:00:50
106500 -- (-424.224) [-426.247] (-427.606) (-424.491) * (-427.019) [-424.371] (-426.564) (-426.218) -- 0:00:50
107000 -- (-425.493) (-427.957) (-426.609) [-424.366] * (-430.527) (-426.100) (-427.015) [-427.033] -- 0:00:50
107500 -- (-425.643) (-423.521) [-426.073] (-424.104) * [-424.409] (-427.581) (-425.482) (-425.843) -- 0:00:49
108000 -- (-427.417) (-425.835) (-424.235) [-427.352] * (-427.959) (-424.453) (-426.700) [-424.165] -- 0:00:49
108500 -- (-428.527) [-425.747] (-428.299) (-427.555) * (-425.830) [-424.787] (-425.338) (-424.530) -- 0:00:49
109000 -- (-428.313) (-426.596) [-429.390] (-428.701) * (-424.695) (-426.205) (-429.030) [-425.683] -- 0:00:49
109500 -- (-424.635) [-428.549] (-428.037) (-426.977) * (-424.895) (-425.499) (-427.496) [-424.303] -- 0:00:48
110000 -- [-424.787] (-427.455) (-425.849) (-424.723) * (-425.382) (-428.351) [-427.857] (-426.159) -- 0:00:48
Average standard deviation of split frequencies: 0.020233
110500 -- (-428.506) (-424.747) [-424.768] (-424.783) * (-427.210) [-428.737] (-430.855) (-427.582) -- 0:00:48
111000 -- (-429.610) [-427.130] (-425.805) (-428.493) * (-428.096) [-426.204] (-425.530) (-426.761) -- 0:00:48
111500 -- (-426.515) (-428.550) [-426.148] (-426.670) * (-426.174) (-425.984) (-425.095) [-425.142] -- 0:00:55
112000 -- (-426.225) (-429.227) [-424.334] (-428.484) * (-424.910) [-423.994] (-424.654) (-423.974) -- 0:00:55
112500 -- (-425.279) (-425.410) (-425.088) [-424.927] * (-424.068) (-427.041) [-425.915] (-425.017) -- 0:00:55
113000 -- (-425.577) (-426.463) [-424.361] (-428.403) * [-425.067] (-426.024) (-427.784) (-427.143) -- 0:00:54
113500 -- (-424.401) [-427.822] (-425.145) (-426.714) * (-424.582) [-426.498] (-425.968) (-424.429) -- 0:00:54
114000 -- (-425.154) (-428.562) [-425.758] (-424.615) * (-431.826) (-423.564) [-425.243] (-429.983) -- 0:00:54
114500 -- (-425.041) (-424.901) (-425.008) [-426.590] * [-427.222] (-425.717) (-426.981) (-429.296) -- 0:00:54
115000 -- (-424.872) (-427.847) (-424.155) [-425.232] * (-424.911) (-424.591) [-427.794] (-425.434) -- 0:00:53
Average standard deviation of split frequencies: 0.015828
115500 -- (-424.016) (-425.909) (-424.717) [-427.307] * (-425.443) [-424.665] (-423.660) (-426.184) -- 0:00:53
116000 -- (-424.454) [-423.962] (-426.279) (-425.827) * (-427.357) [-426.271] (-427.622) (-423.919) -- 0:00:53
116500 -- [-424.503] (-425.408) (-424.485) (-427.301) * (-427.155) (-427.141) [-427.220] (-428.912) -- 0:00:53
117000 -- (-425.088) [-424.319] (-424.825) (-424.875) * (-426.110) (-424.553) (-426.237) [-426.368] -- 0:00:52
117500 -- (-426.633) (-424.826) (-424.312) [-425.203] * [-424.471] (-428.228) (-426.052) (-426.493) -- 0:00:52
118000 -- (-428.433) (-424.616) (-424.683) [-426.355] * (-423.882) [-424.659] (-426.381) (-426.851) -- 0:00:52
118500 -- [-427.684] (-425.294) (-425.694) (-425.828) * (-428.289) [-424.385] (-425.933) (-424.562) -- 0:00:52
119000 -- (-428.001) [-424.722] (-425.094) (-429.632) * (-425.270) (-426.765) [-424.518] (-425.709) -- 0:00:51
119500 -- (-427.655) (-427.089) [-426.259] (-424.715) * (-427.820) (-427.744) (-423.896) [-426.541] -- 0:00:51
120000 -- [-425.800] (-425.143) (-430.183) (-426.794) * (-425.157) (-424.287) [-424.263] (-426.468) -- 0:00:51
Average standard deviation of split frequencies: 0.015215
120500 -- (-427.424) (-425.562) [-428.586] (-425.577) * (-426.092) (-424.452) [-424.914] (-426.816) -- 0:00:51
121000 -- (-425.588) (-425.509) (-426.952) [-424.795] * [-424.081] (-427.162) (-424.711) (-425.131) -- 0:00:50
121500 -- (-425.933) [-426.429] (-426.689) (-426.673) * (-424.900) (-425.229) (-428.715) [-424.851] -- 0:00:50
122000 -- [-426.724] (-425.323) (-423.781) (-426.200) * (-426.549) [-424.656] (-426.625) (-423.791) -- 0:00:50
122500 -- (-429.317) [-424.288] (-426.141) (-427.378) * (-432.221) [-427.002] (-426.629) (-425.707) -- 0:00:50
123000 -- (-427.831) [-425.501] (-426.235) (-424.326) * (-426.007) [-425.329] (-425.399) (-425.517) -- 0:00:49
123500 -- (-425.481) (-426.606) [-425.821] (-425.012) * [-428.358] (-426.983) (-424.649) (-424.819) -- 0:00:49
124000 -- (-424.171) (-426.067) (-423.703) [-424.330] * (-426.544) [-425.789] (-427.246) (-428.294) -- 0:00:49
124500 -- (-426.383) (-424.784) (-426.140) [-432.966] * (-423.641) [-425.184] (-424.059) (-426.231) -- 0:00:49
125000 -- (-426.656) [-427.726] (-424.397) (-427.957) * (-427.712) (-424.900) (-424.242) [-429.032] -- 0:00:49
Average standard deviation of split frequencies: 0.015322
125500 -- (-424.303) (-427.839) (-424.781) [-425.882] * (-424.395) [-424.888] (-427.371) (-426.390) -- 0:00:48
126000 -- [-423.988] (-425.281) (-427.057) (-429.549) * (-424.657) [-425.195] (-424.849) (-425.827) -- 0:00:48
126500 -- (-426.459) [-424.594] (-424.053) (-430.105) * [-425.274] (-424.683) (-426.861) (-425.563) -- 0:00:48
127000 -- (-425.171) (-424.157) [-424.920] (-427.686) * [-426.437] (-425.002) (-424.784) (-426.564) -- 0:00:48
127500 -- [-425.331] (-425.836) (-424.968) (-424.702) * (-430.045) [-427.149] (-425.507) (-426.424) -- 0:00:47
128000 -- (-427.633) [-424.398] (-424.953) (-424.636) * [-425.282] (-425.009) (-429.513) (-432.853) -- 0:00:47
128500 -- [-427.524] (-426.554) (-426.329) (-426.411) * (-433.182) (-426.381) [-428.034] (-426.961) -- 0:00:47
129000 -- [-426.972] (-424.939) (-427.330) (-425.732) * (-429.662) (-425.301) [-427.939] (-426.697) -- 0:00:54
129500 -- (-426.744) [-425.847] (-424.971) (-425.594) * (-425.765) [-425.942] (-430.230) (-428.435) -- 0:00:53
130000 -- (-425.330) (-424.777) [-424.578] (-423.679) * (-429.530) [-428.443] (-425.976) (-430.599) -- 0:00:53
Average standard deviation of split frequencies: 0.013291
130500 -- (-426.403) (-425.210) (-423.877) [-425.354] * [-424.871] (-424.909) (-426.110) (-428.466) -- 0:00:53
131000 -- (-427.746) (-425.992) [-425.303] (-425.261) * (-424.322) [-429.193] (-424.262) (-425.147) -- 0:00:53
131500 -- (-427.949) (-426.180) [-429.479] (-423.689) * (-425.306) [-425.871] (-425.424) (-426.034) -- 0:00:52
132000 -- [-423.770] (-426.922) (-429.131) (-424.923) * (-425.895) (-424.969) (-426.705) [-423.869] -- 0:00:52
132500 -- (-430.904) (-427.043) (-430.564) [-425.556] * (-430.630) (-427.409) [-423.657] (-426.276) -- 0:00:52
133000 -- (-424.189) (-424.467) (-428.197) [-424.862] * (-429.471) (-425.447) [-424.508] (-425.771) -- 0:00:52
133500 -- (-426.591) [-424.588] (-426.817) (-425.702) * (-430.250) [-425.196] (-425.926) (-423.744) -- 0:00:51
134000 -- (-426.346) [-429.745] (-431.476) (-428.617) * (-428.494) (-424.294) (-430.872) [-426.402] -- 0:00:51
134500 -- (-426.470) (-423.989) (-427.224) [-431.608] * (-426.514) (-427.929) (-427.148) [-425.737] -- 0:00:51
135000 -- [-425.998] (-424.245) (-425.607) (-426.815) * (-427.710) (-424.474) (-425.309) [-427.369] -- 0:00:51
Average standard deviation of split frequencies: 0.011361
135500 -- [-424.087] (-427.897) (-423.718) (-425.478) * (-424.010) (-425.578) [-426.952] (-424.036) -- 0:00:51
136000 -- (-424.019) (-425.839) [-428.760] (-430.410) * (-424.370) [-425.576] (-425.412) (-425.659) -- 0:00:50
136500 -- (-425.141) (-424.755) (-424.742) [-424.814] * [-424.428] (-425.140) (-425.187) (-426.072) -- 0:00:50
137000 -- [-425.189] (-425.039) (-424.168) (-425.504) * (-424.240) (-428.929) (-426.774) [-425.778] -- 0:00:50
137500 -- (-427.230) [-424.972] (-425.963) (-425.876) * [-424.758] (-427.791) (-425.816) (-425.626) -- 0:00:50
138000 -- (-427.296) (-426.207) [-424.812] (-424.397) * (-425.185) [-428.035] (-426.496) (-424.574) -- 0:00:49
138500 -- [-424.775] (-425.975) (-428.972) (-425.792) * (-425.325) (-423.494) (-426.722) [-424.384] -- 0:00:49
139000 -- (-432.572) [-427.013] (-426.416) (-425.477) * (-427.462) (-430.580) [-423.675] (-424.398) -- 0:00:49
139500 -- (-425.231) (-424.490) [-424.506] (-425.084) * (-426.882) (-433.695) (-425.952) [-425.462] -- 0:00:49
140000 -- (-426.007) [-426.665] (-425.150) (-425.379) * (-424.266) (-426.925) [-425.589] (-424.825) -- 0:00:49
Average standard deviation of split frequencies: 0.013033
140500 -- (-427.754) [-424.984] (-426.557) (-430.092) * (-425.106) (-426.085) [-425.545] (-428.656) -- 0:00:48
141000 -- (-426.510) [-425.894] (-425.848) (-427.321) * [-424.228] (-428.293) (-424.266) (-424.499) -- 0:00:48
141500 -- (-424.107) (-426.661) [-427.508] (-428.527) * (-424.481) (-426.012) (-424.728) [-425.097] -- 0:00:48
142000 -- [-424.643] (-427.282) (-427.091) (-425.601) * (-425.366) (-425.660) [-424.956] (-425.411) -- 0:00:48
142500 -- [-425.948] (-429.550) (-423.587) (-426.905) * (-425.074) (-425.000) (-425.168) [-426.019] -- 0:00:48
143000 -- [-425.867] (-424.948) (-424.495) (-430.724) * (-424.247) (-430.265) [-428.266] (-425.116) -- 0:00:47
143500 -- (-428.167) (-429.089) [-425.818] (-427.089) * (-425.989) (-425.502) (-430.220) [-426.405] -- 0:00:47
144000 -- (-425.319) [-424.894] (-424.999) (-429.895) * [-425.555] (-427.368) (-430.284) (-428.886) -- 0:00:47
144500 -- [-425.295] (-426.431) (-425.325) (-426.082) * (-424.672) (-427.172) [-425.494] (-426.641) -- 0:00:47
145000 -- (-426.004) (-426.931) (-427.479) [-425.645] * (-426.667) [-424.831] (-424.338) (-427.166) -- 0:00:47
Average standard deviation of split frequencies: 0.016314
145500 -- (-428.284) (-425.217) [-425.616] (-428.334) * (-426.103) [-429.845] (-424.580) (-429.125) -- 0:00:46
146000 -- (-424.379) (-425.906) (-427.256) [-423.512] * (-427.024) (-427.519) (-426.465) [-425.252] -- 0:00:52
146500 -- (-423.856) (-424.313) [-425.919] (-429.490) * (-425.819) (-425.863) (-426.928) [-426.461] -- 0:00:52
147000 -- (-426.058) [-428.590] (-425.253) (-426.813) * [-426.460] (-429.653) (-424.774) (-425.540) -- 0:00:52
147500 -- (-427.135) (-425.105) [-424.356] (-429.149) * [-425.950] (-427.250) (-428.658) (-424.566) -- 0:00:52
148000 -- (-427.972) (-425.475) (-426.120) [-425.761] * (-428.255) [-426.921] (-427.084) (-426.056) -- 0:00:51
148500 -- (-424.669) [-426.474] (-428.609) (-425.936) * (-427.854) (-427.493) (-424.531) [-425.025] -- 0:00:51
149000 -- (-429.050) (-426.167) (-426.978) [-425.192] * (-424.952) (-430.584) [-427.169] (-425.000) -- 0:00:51
149500 -- [-433.005] (-426.592) (-428.270) (-424.519) * (-427.191) [-425.727] (-427.448) (-428.327) -- 0:00:51
150000 -- (-426.378) (-424.514) (-424.724) [-424.334] * [-424.932] (-425.774) (-424.832) (-428.969) -- 0:00:51
Average standard deviation of split frequencies: 0.014985
150500 -- (-430.906) (-431.915) (-424.899) [-425.045] * [-426.469] (-423.747) (-425.221) (-426.575) -- 0:00:50
151000 -- (-428.611) (-427.363) (-425.289) [-424.222] * [-428.240] (-426.296) (-424.041) (-425.872) -- 0:00:50
151500 -- (-425.073) (-426.112) [-426.271] (-426.043) * [-426.903] (-426.595) (-424.187) (-424.880) -- 0:00:50
152000 -- (-425.327) [-427.045] (-434.296) (-424.911) * [-426.545] (-425.547) (-425.027) (-425.715) -- 0:00:50
152500 -- (-427.169) [-431.079] (-426.870) (-428.628) * (-424.119) (-423.935) (-426.340) [-425.368] -- 0:00:50
153000 -- [-424.923] (-429.153) (-425.123) (-426.422) * [-425.638] (-424.370) (-425.183) (-429.513) -- 0:00:49
153500 -- (-424.511) (-425.467) (-424.134) [-424.847] * (-428.436) (-425.250) (-427.319) [-427.231] -- 0:00:49
154000 -- (-425.033) (-424.899) [-425.752] (-434.137) * [-425.476] (-425.783) (-427.453) (-428.705) -- 0:00:49
154500 -- (-425.638) (-424.317) [-424.583] (-435.444) * (-429.370) (-427.710) [-428.641] (-432.539) -- 0:00:49
155000 -- [-426.928] (-426.836) (-427.899) (-433.719) * (-425.608) (-425.450) (-426.202) [-424.597] -- 0:00:49
Average standard deviation of split frequencies: 0.012265
155500 -- (-425.707) [-424.946] (-426.556) (-425.038) * [-426.530] (-426.616) (-424.658) (-424.451) -- 0:00:48
156000 -- (-425.829) (-428.451) [-425.127] (-424.557) * (-423.503) [-424.957] (-423.382) (-426.621) -- 0:00:48
156500 -- (-427.188) (-426.654) (-426.445) [-428.171] * [-430.372] (-424.484) (-425.550) (-424.335) -- 0:00:48
157000 -- (-425.140) [-425.995] (-424.957) (-424.394) * [-424.659] (-423.641) (-427.256) (-423.731) -- 0:00:48
157500 -- (-426.902) [-424.155] (-425.779) (-424.267) * (-426.905) (-423.988) (-424.821) [-424.400] -- 0:00:48
158000 -- [-423.518] (-425.237) (-424.582) (-428.390) * [-428.523] (-423.947) (-425.049) (-426.291) -- 0:00:47
158500 -- [-425.148] (-425.520) (-424.714) (-425.015) * (-424.137) [-426.632] (-425.133) (-428.088) -- 0:00:47
159000 -- (-425.325) (-426.056) [-425.015] (-427.273) * (-427.848) [-424.829] (-423.790) (-424.923) -- 0:00:47
159500 -- (-425.332) (-426.066) [-430.032] (-425.659) * (-423.642) (-431.127) [-428.986] (-425.893) -- 0:00:47
160000 -- (-426.441) (-425.366) (-429.546) [-425.852] * (-423.846) (-426.144) (-427.319) [-426.022] -- 0:00:47
Average standard deviation of split frequencies: 0.010528
160500 -- (-431.147) (-424.292) [-427.338] (-427.839) * (-426.104) (-424.586) (-425.305) [-426.111] -- 0:00:47
161000 -- (-425.512) [-425.890] (-428.604) (-425.113) * [-424.302] (-424.856) (-429.278) (-424.659) -- 0:00:46
161500 -- (-425.453) (-430.561) (-429.024) [-425.715] * [-424.898] (-426.499) (-425.793) (-426.847) -- 0:00:46
162000 -- (-424.951) [-428.235] (-425.011) (-425.417) * (-425.036) (-426.752) [-425.615] (-425.021) -- 0:00:46
162500 -- (-425.144) (-425.632) [-424.779] (-424.209) * (-425.162) (-424.437) [-424.454] (-428.080) -- 0:00:46
163000 -- (-425.678) [-429.353] (-424.801) (-423.962) * [-424.553] (-423.920) (-423.668) (-425.941) -- 0:00:46
163500 -- [-425.996] (-427.532) (-424.771) (-425.776) * [-424.692] (-424.979) (-427.446) (-425.583) -- 0:00:51
164000 -- (-428.251) [-424.304] (-430.770) (-428.555) * (-427.484) [-426.780] (-426.306) (-426.963) -- 0:00:50
164500 -- (-426.379) (-426.582) [-427.125] (-426.872) * (-424.998) (-426.845) [-427.258] (-426.563) -- 0:00:50
165000 -- (-423.933) (-426.301) (-424.468) [-424.830] * (-426.463) (-426.449) [-427.940] (-430.431) -- 0:00:50
Average standard deviation of split frequencies: 0.010097
165500 -- (-427.205) (-426.925) [-426.581] (-427.800) * (-426.056) [-425.001] (-425.474) (-425.451) -- 0:00:50
166000 -- (-430.713) (-426.813) [-428.700] (-426.675) * (-424.413) (-427.282) (-425.808) [-424.983] -- 0:00:50
166500 -- (-428.760) (-426.516) (-432.539) [-425.903] * [-424.999] (-423.791) (-426.092) (-426.076) -- 0:00:50
167000 -- (-425.944) (-424.853) (-427.557) [-427.231] * (-425.935) (-424.752) (-424.622) [-425.059] -- 0:00:49
167500 -- (-425.570) [-427.640] (-424.135) (-424.123) * [-427.871] (-424.288) (-425.255) (-426.180) -- 0:00:49
168000 -- (-429.140) (-426.456) (-426.418) [-423.735] * [-424.237] (-423.463) (-426.851) (-425.500) -- 0:00:49
168500 -- (-428.190) [-424.159] (-425.941) (-428.452) * (-424.230) [-424.189] (-427.513) (-424.302) -- 0:00:49
169000 -- (-424.957) (-423.906) [-424.030] (-426.399) * (-425.628) (-424.868) [-424.032] (-426.742) -- 0:00:49
169500 -- [-425.334] (-423.957) (-424.448) (-425.808) * (-425.685) (-424.939) (-427.488) [-428.546] -- 0:00:48
170000 -- (-424.624) (-425.240) [-424.147] (-426.522) * (-424.245) (-424.143) [-426.265] (-427.326) -- 0:00:48
Average standard deviation of split frequencies: 0.009667
170500 -- (-424.893) (-424.134) [-425.514] (-427.192) * [-426.043] (-426.685) (-428.448) (-425.444) -- 0:00:48
171000 -- (-429.026) (-428.090) (-426.722) [-425.924] * (-425.608) [-425.661] (-426.243) (-426.143) -- 0:00:48
171500 -- (-427.638) (-425.998) (-424.872) [-425.230] * (-425.576) (-425.090) [-424.389] (-425.476) -- 0:00:48
172000 -- (-428.942) (-424.172) (-426.732) [-425.886] * (-425.378) [-429.437] (-426.874) (-425.296) -- 0:00:48
172500 -- [-424.985] (-428.579) (-424.416) (-426.038) * (-424.680) (-427.986) (-424.472) [-425.509] -- 0:00:47
173000 -- (-425.924) (-431.819) [-423.617] (-429.339) * (-428.473) (-428.017) [-427.096] (-424.352) -- 0:00:47
173500 -- [-423.760] (-424.585) (-430.210) (-428.285) * (-425.130) (-425.943) [-424.901] (-426.193) -- 0:00:47
174000 -- (-425.624) (-426.819) (-428.132) [-426.048] * (-426.570) (-427.400) [-428.260] (-431.184) -- 0:00:47
174500 -- (-427.348) (-425.410) (-428.655) [-425.936] * (-424.896) (-427.091) [-424.691] (-428.605) -- 0:00:47
175000 -- [-426.007] (-424.236) (-425.787) (-424.346) * (-428.224) (-425.120) (-425.966) [-424.965] -- 0:00:47
Average standard deviation of split frequencies: 0.012289
175500 -- [-424.290] (-425.849) (-424.713) (-430.377) * (-428.387) [-424.092] (-425.563) (-425.025) -- 0:00:46
176000 -- (-424.353) (-425.470) [-423.823] (-430.528) * (-424.703) (-425.263) (-428.549) [-427.043] -- 0:00:46
176500 -- (-425.280) (-423.620) [-428.106] (-428.089) * (-425.012) (-423.782) (-424.195) [-424.736] -- 0:00:46
177000 -- (-424.874) [-426.067] (-438.633) (-427.249) * (-426.431) (-426.500) [-426.629] (-424.363) -- 0:00:46
177500 -- [-425.824] (-424.408) (-433.176) (-424.180) * (-428.933) (-429.551) (-427.583) [-423.669] -- 0:00:46
178000 -- [-425.081] (-425.910) (-430.360) (-427.689) * (-426.710) (-427.650) (-427.644) [-424.128] -- 0:00:46
178500 -- (-427.848) (-425.699) (-430.073) [-424.503] * (-427.089) [-432.386] (-424.283) (-424.480) -- 0:00:46
179000 -- [-425.939] (-426.193) (-427.189) (-425.573) * (-424.614) (-428.899) [-425.983] (-431.885) -- 0:00:45
179500 -- (-426.278) (-428.508) (-428.391) [-425.857] * (-425.457) (-427.620) [-425.019] (-428.680) -- 0:00:45
180000 -- (-427.140) (-429.017) [-429.043] (-425.935) * [-424.806] (-425.073) (-425.406) (-425.808) -- 0:00:45
Average standard deviation of split frequencies: 0.012739
180500 -- (-428.048) (-425.893) [-425.184] (-427.670) * [-425.060] (-425.290) (-423.536) (-425.648) -- 0:00:49
181000 -- (-425.693) (-424.751) [-425.813] (-428.627) * (-424.603) [-424.607] (-425.123) (-424.040) -- 0:00:49
181500 -- (-423.934) (-425.308) [-423.853] (-429.984) * [-423.929] (-425.960) (-423.758) (-425.923) -- 0:00:49
182000 -- [-425.680] (-424.225) (-425.665) (-425.061) * (-426.492) [-426.564] (-424.892) (-427.053) -- 0:00:49
182500 -- (-425.762) (-424.824) [-425.655] (-424.701) * (-426.466) (-425.066) [-423.890] (-426.121) -- 0:00:49
183000 -- (-427.079) [-426.863] (-426.059) (-426.485) * (-425.914) [-425.335] (-427.540) (-428.321) -- 0:00:49
183500 -- (-427.454) (-425.934) [-427.509] (-426.853) * (-425.430) [-424.855] (-426.375) (-424.464) -- 0:00:48
184000 -- (-427.363) [-425.061] (-423.754) (-424.325) * [-427.228] (-425.879) (-425.658) (-424.141) -- 0:00:48
184500 -- (-426.368) (-425.049) (-425.090) [-424.639] * (-433.015) (-425.633) [-424.508] (-425.419) -- 0:00:48
185000 -- (-425.605) (-424.082) (-424.312) [-424.663] * (-426.192) [-426.615] (-426.081) (-426.845) -- 0:00:48
Average standard deviation of split frequencies: 0.013095
185500 -- (-425.268) (-423.993) [-425.322] (-424.575) * (-427.942) [-424.884] (-425.677) (-424.384) -- 0:00:48
186000 -- (-424.928) (-423.533) (-427.108) [-423.812] * (-427.053) (-425.024) [-427.273] (-426.367) -- 0:00:48
186500 -- (-425.447) (-426.461) [-424.683] (-424.589) * [-427.467] (-424.606) (-425.659) (-428.680) -- 0:00:47
187000 -- (-429.496) (-428.354) [-428.319] (-425.067) * (-427.047) (-426.082) (-424.131) [-427.220] -- 0:00:47
187500 -- (-431.632) (-424.722) (-425.759) [-424.616] * (-423.979) (-425.761) [-425.370] (-426.187) -- 0:00:47
188000 -- (-426.171) [-427.281] (-428.230) (-426.179) * (-426.030) (-424.728) [-426.940] (-427.798) -- 0:00:47
188500 -- (-426.615) [-426.631] (-425.667) (-427.476) * (-430.499) (-426.028) (-424.595) [-428.603] -- 0:00:47
189000 -- [-426.521] (-426.355) (-428.352) (-427.557) * (-424.300) (-426.182) (-425.299) [-426.972] -- 0:00:47
189500 -- (-424.426) [-425.545] (-425.713) (-425.456) * [-424.603] (-427.562) (-425.222) (-426.073) -- 0:00:47
190000 -- (-423.917) (-428.400) [-429.380] (-430.651) * (-426.995) (-424.239) (-424.863) [-429.566] -- 0:00:46
Average standard deviation of split frequencies: 0.011926
190500 -- (-426.433) [-427.610] (-424.550) (-424.980) * (-426.944) (-426.505) (-425.336) [-426.072] -- 0:00:46
191000 -- (-426.213) (-426.716) [-428.579] (-428.590) * [-424.491] (-426.179) (-426.825) (-425.734) -- 0:00:46
191500 -- (-425.843) [-424.774] (-426.556) (-424.399) * [-423.804] (-425.138) (-426.303) (-425.025) -- 0:00:46
192000 -- (-424.482) [-424.695] (-424.658) (-424.659) * [-424.970] (-426.094) (-424.096) (-424.929) -- 0:00:46
192500 -- (-425.818) (-424.763) [-424.494] (-429.446) * (-426.037) [-423.936] (-423.777) (-426.982) -- 0:00:46
193000 -- [-424.654] (-424.483) (-427.481) (-426.779) * (-426.176) (-425.774) (-428.798) [-427.225] -- 0:00:45
193500 -- [-424.610] (-427.794) (-427.661) (-430.341) * (-425.138) [-426.170] (-426.067) (-427.888) -- 0:00:45
194000 -- (-426.611) (-424.731) [-426.642] (-426.630) * [-427.212] (-427.093) (-425.571) (-425.602) -- 0:00:45
194500 -- (-425.484) (-424.201) [-425.438] (-427.163) * (-427.256) [-427.087] (-426.774) (-425.243) -- 0:00:45
195000 -- [-425.325] (-425.813) (-424.944) (-426.278) * [-424.930] (-431.299) (-425.752) (-424.331) -- 0:00:45
Average standard deviation of split frequencies: 0.012928
195500 -- [-424.433] (-424.418) (-426.047) (-425.931) * [-425.462] (-423.738) (-426.398) (-428.870) -- 0:00:45
196000 -- (-425.813) (-427.213) [-423.813] (-425.457) * [-423.781] (-425.974) (-424.667) (-427.844) -- 0:00:45
196500 -- [-424.141] (-426.620) (-424.802) (-426.639) * [-424.495] (-426.617) (-426.666) (-427.394) -- 0:00:44
197000 -- (-425.720) (-426.208) [-424.414] (-424.441) * (-423.400) (-427.433) [-427.881] (-426.837) -- 0:00:44
197500 -- (-424.478) [-424.732] (-432.977) (-426.644) * (-426.187) (-427.669) [-424.051] (-427.551) -- 0:00:48
198000 -- (-425.268) (-426.224) (-424.565) [-427.637] * (-432.216) (-426.300) (-424.130) [-424.035] -- 0:00:48
198500 -- (-426.556) [-425.692] (-426.933) (-428.335) * (-427.087) (-424.843) [-423.441] (-427.591) -- 0:00:48
199000 -- [-424.727] (-425.463) (-425.171) (-426.566) * (-427.921) [-424.643] (-425.610) (-426.944) -- 0:00:48
199500 -- [-428.752] (-424.072) (-425.851) (-436.961) * (-425.875) [-425.439] (-427.144) (-423.481) -- 0:00:48
200000 -- (-425.443) [-424.699] (-425.164) (-426.332) * [-425.524] (-423.535) (-427.495) (-424.934) -- 0:00:48
Average standard deviation of split frequencies: 0.012713
200500 -- (-427.373) (-428.348) [-424.760] (-428.043) * (-426.532) [-424.580] (-427.772) (-423.724) -- 0:00:47
201000 -- (-428.717) [-425.220] (-427.083) (-425.040) * (-424.216) (-425.813) (-425.685) [-424.507] -- 0:00:47
201500 -- (-426.411) (-427.512) (-425.145) [-425.864] * (-424.565) [-425.592] (-425.619) (-425.575) -- 0:00:47
202000 -- (-426.152) (-428.709) (-424.888) [-425.632] * (-425.584) [-425.529] (-431.588) (-428.766) -- 0:00:47
202500 -- [-425.685] (-426.649) (-426.002) (-428.549) * (-425.916) [-427.032] (-433.297) (-426.127) -- 0:00:47
203000 -- (-425.990) [-426.123] (-424.439) (-426.567) * (-427.891) (-424.164) [-427.330] (-425.327) -- 0:00:47
203500 -- [-427.987] (-424.107) (-425.294) (-424.822) * (-424.351) [-426.971] (-426.092) (-426.115) -- 0:00:46
204000 -- (-429.226) (-424.457) [-425.673] (-424.035) * (-424.184) (-426.858) (-430.121) [-424.749] -- 0:00:46
204500 -- [-425.742] (-425.052) (-425.996) (-424.424) * (-429.665) (-426.401) [-428.833] (-423.697) -- 0:00:46
205000 -- (-426.952) (-424.796) [-428.735] (-424.985) * (-425.636) [-425.423] (-424.527) (-424.894) -- 0:00:46
Average standard deviation of split frequencies: 0.011315
205500 -- (-425.398) [-427.841] (-425.098) (-426.908) * (-427.009) (-427.688) [-425.665] (-423.774) -- 0:00:46
206000 -- (-426.553) (-431.043) (-425.780) [-429.270] * (-431.057) (-429.064) [-425.024] (-425.431) -- 0:00:46
206500 -- [-427.982] (-426.739) (-425.015) (-425.614) * (-428.187) [-423.509] (-424.311) (-429.510) -- 0:00:46
207000 -- (-425.528) [-425.601] (-425.013) (-423.895) * (-430.006) [-427.940] (-432.143) (-425.277) -- 0:00:45
207500 -- (-424.800) (-424.788) [-424.161] (-426.561) * (-428.635) (-427.779) [-433.090] (-424.117) -- 0:00:45
208000 -- (-424.125) (-428.041) [-426.385] (-423.999) * (-431.891) (-430.382) (-430.955) [-428.144] -- 0:00:45
208500 -- (-425.053) [-428.748] (-427.418) (-424.172) * (-429.801) [-428.233] (-424.569) (-427.086) -- 0:00:45
209000 -- (-428.771) (-429.666) (-427.487) [-426.071] * (-428.510) (-432.392) [-425.452] (-427.197) -- 0:00:45
209500 -- [-429.885] (-427.673) (-425.893) (-427.088) * (-425.968) (-423.909) (-426.001) [-423.867] -- 0:00:45
210000 -- (-428.380) (-425.029) (-428.046) [-424.930] * (-425.664) (-425.470) (-425.036) [-424.224] -- 0:00:45
Average standard deviation of split frequencies: 0.009930
210500 -- (-425.823) [-425.789] (-427.834) (-427.001) * (-424.280) (-424.982) [-427.160] (-425.977) -- 0:00:45
211000 -- (-425.571) [-425.171] (-426.306) (-426.405) * [-425.793] (-426.341) (-425.673) (-424.228) -- 0:00:44
211500 -- [-423.746] (-425.246) (-427.123) (-425.650) * [-424.534] (-426.996) (-424.808) (-424.193) -- 0:00:44
212000 -- [-427.596] (-426.476) (-424.910) (-424.879) * (-429.176) (-426.854) [-424.485] (-426.056) -- 0:00:44
212500 -- (-426.703) (-426.450) (-424.900) [-426.367] * [-426.036] (-430.194) (-426.716) (-426.366) -- 0:00:44
213000 -- (-425.019) (-425.093) (-424.994) [-426.557] * [-426.278] (-432.133) (-426.932) (-425.088) -- 0:00:44
213500 -- (-423.784) (-425.808) (-426.507) [-424.444] * (-425.847) (-426.656) (-427.527) [-424.711] -- 0:00:44
214000 -- (-428.970) (-425.761) (-425.490) [-426.543] * (-430.171) [-427.279] (-425.939) (-427.323) -- 0:00:44
214500 -- (-425.912) (-424.770) (-425.689) [-427.104] * (-426.257) (-425.911) (-425.456) [-423.797] -- 0:00:47
215000 -- (-424.783) [-424.836] (-424.219) (-426.473) * (-423.918) [-424.072] (-431.454) (-423.849) -- 0:00:47
Average standard deviation of split frequencies: 0.010503
215500 -- [-434.840] (-426.598) (-429.350) (-425.304) * (-428.118) (-428.835) (-425.111) [-424.960] -- 0:00:47
216000 -- (-427.730) [-425.812] (-426.850) (-428.825) * [-426.582] (-429.974) (-429.345) (-425.330) -- 0:00:47
216500 -- (-426.742) (-425.421) (-426.119) [-424.240] * (-424.340) (-431.653) (-426.713) [-427.835] -- 0:00:47
217000 -- (-424.175) (-423.717) (-426.450) [-426.706] * (-425.460) [-427.818] (-428.034) (-425.189) -- 0:00:46
217500 -- [-426.665] (-426.040) (-426.469) (-426.362) * (-424.802) (-428.772) [-425.176] (-424.249) -- 0:00:46
218000 -- (-425.649) [-426.339] (-427.811) (-427.575) * (-424.124) (-424.479) (-426.229) [-424.163] -- 0:00:46
218500 -- (-431.195) (-429.917) [-425.482] (-423.483) * [-423.910] (-424.545) (-424.048) (-423.980) -- 0:00:46
219000 -- (-430.439) (-426.513) [-426.708] (-427.953) * (-425.870) (-425.712) [-427.274] (-424.195) -- 0:00:46
219500 -- (-428.503) (-427.396) (-424.073) [-425.525] * [-425.315] (-427.385) (-425.636) (-424.385) -- 0:00:46
220000 -- [-427.225] (-426.444) (-425.266) (-426.325) * (-423.591) [-424.355] (-426.327) (-424.988) -- 0:00:46
Average standard deviation of split frequencies: 0.008946
220500 -- [-426.056] (-427.055) (-427.879) (-424.817) * (-423.792) (-426.962) (-424.592) [-424.946] -- 0:00:45
221000 -- [-425.300] (-424.908) (-426.308) (-424.849) * (-425.199) (-427.311) [-427.166] (-425.727) -- 0:00:45
221500 -- (-425.714) (-427.323) (-426.704) [-423.762] * (-425.808) (-425.681) [-427.051] (-425.137) -- 0:00:45
222000 -- (-425.512) (-430.502) [-428.038] (-426.247) * [-427.393] (-425.428) (-424.170) (-423.656) -- 0:00:45
222500 -- (-425.126) [-424.770] (-432.644) (-423.821) * (-426.964) (-425.661) (-425.304) [-425.696] -- 0:00:45
223000 -- (-425.672) [-423.798] (-426.600) (-429.364) * [-426.784] (-423.662) (-428.368) (-425.032) -- 0:00:45
223500 -- [-424.255] (-425.067) (-428.563) (-426.333) * (-428.137) [-424.392] (-423.904) (-429.954) -- 0:00:45
224000 -- (-424.276) [-425.637] (-425.138) (-425.804) * (-425.227) (-429.519) [-424.791] (-428.190) -- 0:00:45
224500 -- (-424.008) (-425.433) [-423.720] (-425.938) * (-427.087) (-429.524) (-428.982) [-424.287] -- 0:00:44
225000 -- (-424.733) (-424.303) (-424.880) [-424.953] * (-425.586) (-424.576) [-427.208] (-424.996) -- 0:00:44
Average standard deviation of split frequencies: 0.009777
225500 -- [-424.454] (-425.151) (-426.798) (-425.337) * [-424.899] (-424.614) (-429.377) (-426.416) -- 0:00:44
226000 -- (-428.126) [-424.418] (-425.978) (-433.277) * (-425.207) (-424.267) [-425.346] (-425.289) -- 0:00:44
226500 -- (-425.285) (-425.009) (-425.020) [-430.840] * [-425.076] (-429.465) (-426.514) (-427.294) -- 0:00:44
227000 -- (-427.262) (-425.320) (-424.388) [-424.281] * [-426.084] (-426.608) (-428.229) (-426.883) -- 0:00:44
227500 -- (-424.457) (-424.357) (-425.277) [-425.181] * (-425.441) (-424.244) [-423.925] (-429.605) -- 0:00:44
228000 -- (-427.068) [-429.908] (-426.273) (-428.579) * [-426.692] (-425.776) (-425.176) (-428.454) -- 0:00:44
228500 -- (-429.792) (-424.476) (-426.261) [-424.298] * (-425.279) [-423.604] (-429.642) (-424.042) -- 0:00:43
229000 -- [-424.788] (-425.669) (-430.065) (-425.218) * (-425.475) (-431.931) (-425.126) [-428.501] -- 0:00:43
229500 -- [-424.585] (-425.523) (-426.930) (-427.318) * (-427.964) (-425.359) [-427.996] (-424.455) -- 0:00:47
230000 -- [-425.883] (-426.192) (-425.998) (-424.326) * (-427.818) [-424.506] (-425.443) (-425.544) -- 0:00:46
Average standard deviation of split frequencies: 0.010601
230500 -- (-424.567) (-429.501) [-425.374] (-424.383) * (-427.046) [-423.897] (-426.541) (-426.120) -- 0:00:46
231000 -- [-428.076] (-427.298) (-426.222) (-425.256) * (-424.355) (-425.422) (-424.020) [-424.941] -- 0:00:46
231500 -- (-427.555) (-426.812) [-426.791] (-425.624) * (-425.353) (-426.860) (-427.824) [-428.880] -- 0:00:46
232000 -- (-429.301) (-424.380) (-428.604) [-427.708] * [-424.894] (-424.754) (-428.177) (-424.943) -- 0:00:46
232500 -- (-425.918) (-428.312) [-425.674] (-427.796) * (-428.948) (-426.609) (-424.445) [-427.608] -- 0:00:46
233000 -- (-424.646) (-428.381) (-424.340) [-426.024] * (-426.076) (-425.662) [-424.516] (-427.378) -- 0:00:46
233500 -- [-424.131] (-428.601) (-426.795) (-428.764) * [-424.103] (-425.188) (-426.004) (-425.776) -- 0:00:45
234000 -- (-424.416) (-426.895) [-423.786] (-428.393) * (-426.398) (-425.967) (-426.745) [-424.652] -- 0:00:45
234500 -- (-424.155) (-425.510) [-424.999] (-425.274) * (-427.520) [-425.633] (-428.210) (-424.583) -- 0:00:45
235000 -- (-425.357) [-424.675] (-429.815) (-426.343) * [-424.978] (-424.633) (-425.919) (-424.330) -- 0:00:45
Average standard deviation of split frequencies: 0.011985
235500 -- [-427.904] (-424.610) (-428.918) (-425.951) * (-423.543) (-424.798) [-425.325] (-425.508) -- 0:00:45
236000 -- (-425.976) [-425.977] (-432.742) (-426.784) * (-424.749) (-425.674) (-429.006) [-426.493] -- 0:00:45
236500 -- (-424.787) (-425.826) [-425.454] (-424.255) * [-425.508] (-426.222) (-427.828) (-429.719) -- 0:00:45
237000 -- (-424.765) [-424.234] (-425.460) (-424.405) * (-428.107) (-429.381) [-423.811] (-426.665) -- 0:00:45
237500 -- (-424.195) (-427.498) (-429.587) [-424.726] * (-426.833) (-424.742) [-425.259] (-425.263) -- 0:00:44
238000 -- (-423.639) (-426.925) [-429.239] (-425.875) * (-426.085) (-425.521) [-424.138] (-425.799) -- 0:00:44
238500 -- (-424.179) (-424.081) [-429.438] (-424.357) * [-424.374] (-424.742) (-425.514) (-426.008) -- 0:00:44
239000 -- [-424.163] (-428.328) (-424.544) (-428.835) * [-424.477] (-427.944) (-424.952) (-428.950) -- 0:00:44
239500 -- (-423.780) (-424.798) (-425.143) [-425.154] * (-426.829) (-429.116) [-425.625] (-429.794) -- 0:00:44
240000 -- [-424.197] (-428.061) (-426.516) (-426.506) * (-425.409) (-426.965) [-424.676] (-427.178) -- 0:00:44
Average standard deviation of split frequencies: 0.011263
240500 -- (-427.026) (-434.053) (-426.833) [-424.788] * (-428.661) [-424.676] (-426.953) (-425.406) -- 0:00:44
241000 -- [-427.931] (-428.104) (-427.125) (-424.222) * (-426.169) (-426.177) [-425.665] (-427.688) -- 0:00:44
241500 -- (-424.171) (-427.649) [-424.998] (-430.303) * (-424.947) [-424.561] (-423.644) (-423.845) -- 0:00:43
242000 -- [-426.888] (-424.372) (-424.747) (-426.624) * (-427.401) (-425.323) (-424.298) [-424.839] -- 0:00:43
242500 -- (-427.829) (-424.947) [-424.763] (-428.324) * (-426.190) [-425.150] (-426.218) (-424.879) -- 0:00:43
243000 -- (-425.637) (-425.249) [-425.394] (-426.010) * [-425.661] (-424.463) (-428.561) (-427.580) -- 0:00:43
243500 -- (-425.071) (-424.062) (-425.264) [-425.429] * [-427.939] (-425.036) (-426.640) (-425.293) -- 0:00:43
244000 -- (-425.316) [-424.648] (-425.426) (-424.898) * (-426.939) (-426.046) [-425.239] (-430.374) -- 0:00:46
244500 -- (-427.530) [-425.891] (-426.928) (-424.700) * (-425.254) (-429.379) (-424.723) [-426.915] -- 0:00:46
245000 -- (-426.429) [-428.431] (-425.691) (-425.385) * [-428.111] (-429.418) (-424.913) (-426.099) -- 0:00:46
Average standard deviation of split frequencies: 0.010540
245500 -- (-425.551) (-428.728) (-424.954) [-426.668] * (-428.046) [-424.660] (-424.477) (-424.016) -- 0:00:46
246000 -- (-427.343) [-427.198] (-429.046) (-426.816) * (-428.952) [-423.955] (-424.519) (-427.730) -- 0:00:45
246500 -- (-424.439) [-423.758] (-429.773) (-426.556) * (-425.433) [-424.883] (-424.773) (-425.029) -- 0:00:45
247000 -- (-425.574) (-423.852) (-425.955) [-431.011] * (-425.345) (-425.640) [-426.487] (-424.537) -- 0:00:45
247500 -- (-426.963) (-426.453) [-429.654] (-423.785) * [-424.691] (-424.351) (-425.319) (-426.427) -- 0:00:45
248000 -- (-425.566) (-426.398) [-429.193] (-424.788) * (-432.351) [-429.647] (-427.812) (-424.164) -- 0:00:45
248500 -- (-424.919) (-425.366) [-425.642] (-424.819) * (-426.944) [-425.114] (-425.850) (-424.278) -- 0:00:45
249000 -- (-427.920) (-424.139) [-424.704] (-430.045) * (-427.861) [-426.266] (-425.625) (-429.555) -- 0:00:45
249500 -- [-425.760] (-425.019) (-424.080) (-427.755) * (-423.701) (-426.405) (-426.481) [-425.065] -- 0:00:45
250000 -- (-425.274) (-427.345) (-427.059) [-425.092] * (-430.497) (-428.429) [-425.494] (-425.334) -- 0:00:45
Average standard deviation of split frequencies: 0.011837
250500 -- (-425.357) [-425.646] (-424.976) (-424.766) * (-427.061) (-425.110) [-424.862] (-428.034) -- 0:00:44
251000 -- (-426.547) [-424.720] (-430.318) (-430.050) * [-424.753] (-424.273) (-425.541) (-425.822) -- 0:00:44
251500 -- (-425.761) (-428.224) (-426.576) [-424.118] * (-425.679) [-425.777] (-424.206) (-426.277) -- 0:00:44
252000 -- [-424.384] (-425.874) (-427.397) (-424.552) * (-425.007) [-424.217] (-425.807) (-427.115) -- 0:00:44
252500 -- (-424.221) [-425.904] (-429.371) (-425.877) * (-426.267) (-429.892) (-425.761) [-426.523] -- 0:00:44
253000 -- [-426.387] (-427.522) (-427.121) (-425.812) * (-424.293) (-424.293) [-425.642] (-424.991) -- 0:00:47
253500 -- (-428.015) [-427.480] (-425.313) (-425.833) * (-426.918) (-425.389) [-424.241] (-426.920) -- 0:00:47
254000 -- (-427.801) [-430.068] (-425.845) (-424.025) * (-425.317) (-424.308) [-430.264] (-425.393) -- 0:00:46
254500 -- (-427.762) (-425.365) (-425.831) [-423.721] * [-429.134] (-425.675) (-427.550) (-424.689) -- 0:00:46
255000 -- [-424.527] (-427.132) (-425.752) (-424.650) * (-429.179) [-425.575] (-429.113) (-424.169) -- 0:00:46
Average standard deviation of split frequencies: 0.011915
255500 -- [-425.856] (-425.253) (-431.850) (-426.489) * [-427.463] (-428.100) (-428.501) (-425.219) -- 0:00:46
256000 -- (-428.081) (-430.234) [-429.057] (-425.619) * [-424.515] (-426.966) (-425.985) (-425.015) -- 0:00:46
256500 -- (-427.441) (-424.956) [-427.100] (-430.188) * (-430.127) (-425.724) [-427.373] (-423.706) -- 0:00:46
257000 -- (-425.499) (-425.901) (-425.219) [-424.687] * (-426.236) (-425.598) (-427.814) [-423.809] -- 0:00:46
257500 -- (-425.361) (-426.626) (-426.977) [-424.053] * [-426.107] (-427.568) (-425.754) (-424.200) -- 0:00:46
258000 -- (-424.531) (-425.871) (-426.733) [-426.969] * [-424.132] (-425.623) (-425.952) (-423.838) -- 0:00:46
258500 -- (-427.492) (-424.863) (-426.390) [-427.847] * (-423.709) [-426.151] (-424.926) (-424.843) -- 0:00:45
259000 -- (-427.644) (-425.703) (-426.009) [-428.454] * (-426.110) (-425.125) [-424.987] (-427.058) -- 0:00:45
259500 -- (-425.075) (-423.957) [-425.109] (-426.635) * (-429.087) (-424.048) [-424.523] (-424.649) -- 0:00:45
260000 -- (-425.722) (-425.787) (-426.779) [-425.685] * (-425.487) [-425.577] (-424.954) (-423.897) -- 0:00:45
Average standard deviation of split frequencies: 0.010212
260500 -- [-426.227] (-426.357) (-426.005) (-425.123) * (-426.452) [-425.928] (-425.562) (-424.959) -- 0:00:45
261000 -- (-429.594) [-425.471] (-428.099) (-424.745) * (-427.452) (-428.504) [-425.622] (-424.589) -- 0:00:45
261500 -- [-426.840] (-426.803) (-425.286) (-425.564) * (-427.556) (-424.885) [-424.768] (-423.540) -- 0:00:45
262000 -- (-424.740) (-427.486) (-423.734) [-424.446] * (-431.123) [-426.197] (-424.928) (-427.649) -- 0:00:45
262500 -- [-426.913] (-424.952) (-424.552) (-427.429) * (-434.350) (-425.472) (-426.080) [-426.713] -- 0:00:44
263000 -- [-424.186] (-426.660) (-424.561) (-426.662) * (-427.012) (-426.368) (-426.325) [-427.612] -- 0:00:44
263500 -- (-423.985) [-424.198] (-427.830) (-424.921) * (-424.698) (-426.995) [-426.441] (-428.808) -- 0:00:44
264000 -- (-426.885) [-427.934] (-425.669) (-428.927) * (-425.999) (-426.224) (-423.579) [-426.708] -- 0:00:44
264500 -- [-424.477] (-428.217) (-428.345) (-425.798) * [-426.183] (-424.778) (-424.941) (-424.655) -- 0:00:44
265000 -- (-426.892) [-425.859] (-427.763) (-430.491) * (-424.921) (-427.524) [-425.949] (-428.693) -- 0:00:44
Average standard deviation of split frequencies: 0.010008
265500 -- (-424.651) (-427.547) [-430.638] (-427.578) * (-424.426) (-426.356) (-425.597) [-429.237] -- 0:00:47
266000 -- (-426.097) [-426.190] (-430.553) (-424.712) * (-427.449) (-428.160) (-425.334) [-424.983] -- 0:00:46
266500 -- (-423.734) (-424.630) (-425.642) [-425.064] * (-428.466) (-425.135) [-426.519] (-424.465) -- 0:00:46
267000 -- [-425.196] (-426.568) (-426.840) (-423.681) * [-427.400] (-425.668) (-426.023) (-424.615) -- 0:00:46
267500 -- [-426.015] (-424.586) (-427.589) (-426.856) * (-424.865) (-426.907) (-425.159) [-425.303] -- 0:00:46
268000 -- (-425.558) [-426.635] (-426.358) (-426.311) * [-425.671] (-426.546) (-424.339) (-424.599) -- 0:00:46
268500 -- (-425.295) [-424.540] (-428.813) (-427.721) * (-431.484) (-425.781) (-429.270) [-424.916] -- 0:00:46
269000 -- (-424.813) (-424.236) (-429.371) [-426.511] * (-425.471) (-427.100) (-427.693) [-425.291] -- 0:00:46
269500 -- (-429.192) (-426.312) (-425.958) [-431.931] * [-424.569] (-428.059) (-424.035) (-426.274) -- 0:00:46
270000 -- (-424.640) [-425.182] (-426.543) (-426.418) * (-423.619) [-423.849] (-428.357) (-424.592) -- 0:00:45
Average standard deviation of split frequencies: 0.009733
270500 -- (-434.409) [-425.345] (-426.243) (-426.986) * (-424.125) (-425.875) [-424.903] (-429.525) -- 0:00:45
271000 -- (-426.550) (-427.597) (-424.744) [-426.331] * (-426.074) [-425.720] (-426.014) (-429.746) -- 0:00:45
271500 -- (-426.871) (-427.350) (-426.005) [-425.719] * (-425.793) [-426.597] (-426.048) (-428.097) -- 0:00:45
272000 -- (-426.017) (-425.440) (-426.220) [-426.885] * (-424.444) (-424.032) [-427.602] (-426.445) -- 0:00:45
272500 -- [-425.308] (-428.859) (-424.694) (-427.242) * (-424.984) (-426.366) [-428.522] (-424.659) -- 0:00:45
273000 -- (-425.699) (-427.007) (-425.934) [-430.418] * (-427.079) [-427.522] (-423.988) (-423.873) -- 0:00:45
273500 -- (-427.146) (-428.877) [-427.660] (-431.491) * (-427.040) (-427.885) (-428.090) [-425.888] -- 0:00:45
274000 -- [-425.870] (-425.574) (-426.215) (-427.872) * (-425.146) [-424.261] (-427.323) (-428.869) -- 0:00:45
274500 -- (-427.519) [-424.071] (-425.354) (-424.950) * (-424.904) (-424.767) [-426.553] (-426.610) -- 0:00:44
275000 -- [-425.084] (-425.340) (-424.235) (-425.035) * (-428.300) (-426.561) [-427.247] (-425.010) -- 0:00:44
Average standard deviation of split frequencies: 0.009645
275500 -- (-423.977) (-424.910) [-425.938] (-425.364) * (-429.016) (-424.362) [-424.275] (-425.465) -- 0:00:44
276000 -- (-423.769) (-427.328) (-425.128) [-424.815] * (-427.161) (-426.238) [-426.928] (-429.228) -- 0:00:44
276500 -- (-426.533) (-429.526) [-425.576] (-426.435) * (-431.009) (-428.324) (-427.720) [-427.715] -- 0:00:44
277000 -- [-425.101] (-424.138) (-425.981) (-424.851) * [-426.671] (-426.114) (-425.654) (-425.440) -- 0:00:44
277500 -- (-427.208) (-426.252) (-427.766) [-425.250] * [-425.771] (-425.051) (-425.854) (-426.981) -- 0:00:46
278000 -- (-426.847) (-427.886) [-425.061] (-427.680) * (-429.586) [-424.840] (-428.299) (-428.464) -- 0:00:46
278500 -- (-423.813) (-424.881) [-427.225] (-425.110) * (-424.385) (-428.930) (-425.511) [-426.937] -- 0:00:46
279000 -- (-426.800) (-424.653) [-428.486] (-424.832) * (-426.285) (-431.099) (-426.994) [-424.137] -- 0:00:46
279500 -- (-426.715) (-423.809) (-425.039) [-424.599] * [-426.759] (-426.670) (-424.752) (-428.678) -- 0:00:46
280000 -- [-425.882] (-424.592) (-433.286) (-425.342) * [-428.596] (-425.198) (-428.026) (-426.348) -- 0:00:46
Average standard deviation of split frequencies: 0.010275
280500 -- (-425.423) (-426.330) [-431.366] (-425.120) * (-426.604) (-426.669) (-428.001) [-423.968] -- 0:00:46
281000 -- (-430.859) (-423.767) [-427.190] (-426.428) * (-424.762) (-427.591) [-432.287] (-425.623) -- 0:00:46
281500 -- (-430.535) (-425.069) [-425.901] (-428.468) * [-423.480] (-426.790) (-435.077) (-424.114) -- 0:00:45
282000 -- [-426.804] (-428.685) (-424.326) (-425.707) * (-426.910) (-426.280) [-424.863] (-424.207) -- 0:00:45
282500 -- (-424.493) (-426.930) [-426.381] (-424.098) * (-427.739) [-427.603] (-425.768) (-426.437) -- 0:00:45
283000 -- (-425.458) (-424.666) [-424.768] (-424.598) * (-425.274) (-426.674) [-425.447] (-425.710) -- 0:00:45
283500 -- (-424.877) (-424.702) [-424.788] (-425.058) * (-426.984) [-424.539] (-424.300) (-428.088) -- 0:00:45
284000 -- [-427.257] (-423.905) (-426.983) (-425.857) * [-426.360] (-425.871) (-424.111) (-428.789) -- 0:00:45
284500 -- (-430.794) [-427.413] (-424.745) (-429.007) * (-424.881) (-427.809) [-425.676] (-425.092) -- 0:00:45
285000 -- [-427.255] (-425.341) (-425.180) (-423.936) * (-423.866) [-426.137] (-430.796) (-427.329) -- 0:00:45
Average standard deviation of split frequencies: 0.010622
285500 -- (-426.211) (-435.098) (-424.509) [-425.349] * [-424.921] (-429.265) (-425.695) (-433.507) -- 0:00:45
286000 -- (-428.075) (-425.183) (-429.040) [-425.964] * (-426.218) (-428.274) [-423.811] (-425.418) -- 0:00:44
286500 -- (-426.628) (-424.093) (-426.027) [-424.973] * (-427.819) (-427.736) (-429.943) [-426.706] -- 0:00:44
287000 -- [-425.866] (-425.073) (-425.590) (-427.503) * [-427.770] (-424.758) (-425.435) (-426.592) -- 0:00:44
287500 -- [-426.447] (-425.688) (-425.009) (-424.096) * (-426.568) (-425.084) [-424.636] (-426.289) -- 0:00:44
288000 -- (-426.113) (-427.568) [-429.931] (-425.083) * (-436.351) (-424.537) [-425.248] (-423.875) -- 0:00:44
288500 -- [-425.245] (-426.798) (-430.593) (-424.621) * (-427.316) (-424.737) [-424.606] (-425.467) -- 0:00:44
289000 -- [-425.848] (-427.531) (-424.998) (-429.778) * (-428.245) (-425.367) (-426.008) [-424.872] -- 0:00:44
289500 -- (-426.674) (-424.388) [-426.998] (-426.640) * [-426.906] (-425.368) (-426.696) (-424.238) -- 0:00:44
290000 -- (-425.345) (-424.388) [-426.886] (-426.995) * (-426.859) (-424.621) [-425.681] (-423.808) -- 0:00:44
Average standard deviation of split frequencies: 0.011162
290500 -- (-426.532) (-432.085) (-425.062) [-426.529] * (-425.922) (-425.734) [-424.177] (-426.001) -- 0:00:43
291000 -- (-424.916) [-425.032] (-427.871) (-426.595) * (-426.979) (-424.328) (-424.263) [-424.978] -- 0:00:43
291500 -- (-424.898) (-429.679) (-426.641) [-423.829] * [-426.146] (-426.105) (-426.904) (-424.214) -- 0:00:43
292000 -- (-427.747) (-426.620) [-424.838] (-425.152) * (-425.382) [-427.821] (-426.219) (-428.000) -- 0:00:43
292500 -- (-424.769) (-432.354) (-427.075) [-425.133] * (-426.808) (-425.896) (-425.321) [-423.983] -- 0:00:43
293000 -- (-426.668) [-424.974] (-424.729) (-426.646) * (-425.634) (-425.054) (-425.151) [-424.737] -- 0:00:45
293500 -- (-425.665) (-425.391) [-423.950] (-427.217) * (-425.887) [-423.918] (-424.745) (-425.213) -- 0:00:45
294000 -- (-424.325) (-425.897) (-424.810) [-427.853] * (-428.132) (-426.747) [-424.879] (-426.230) -- 0:00:45
294500 -- (-426.026) [-427.429] (-426.349) (-427.166) * (-424.913) (-426.180) [-426.225] (-425.326) -- 0:00:45
295000 -- (-426.887) [-427.284] (-423.642) (-426.976) * (-425.129) (-428.621) (-424.857) [-426.850] -- 0:00:45
Average standard deviation of split frequencies: 0.010118
295500 -- (-425.542) (-426.494) (-424.294) [-423.670] * (-430.051) (-430.174) (-426.171) [-427.193] -- 0:00:45
296000 -- (-426.801) (-425.104) (-424.734) [-426.627] * (-425.991) [-427.855] (-424.022) (-432.040) -- 0:00:45
296500 -- [-424.184] (-425.172) (-427.143) (-425.549) * (-424.900) (-424.439) (-424.868) [-425.248] -- 0:00:45
297000 -- (-424.318) (-425.538) [-428.281] (-426.064) * [-424.553] (-426.112) (-428.222) (-425.518) -- 0:00:44
297500 -- [-425.341] (-426.543) (-424.124) (-427.256) * (-424.661) (-428.977) (-424.869) [-426.247] -- 0:00:44
298000 -- [-424.380] (-425.988) (-424.596) (-425.628) * (-424.046) (-427.291) (-427.280) [-425.035] -- 0:00:44
298500 -- (-427.369) (-427.192) [-424.659] (-426.482) * (-424.079) [-425.699] (-424.581) (-425.467) -- 0:00:44
299000 -- (-428.928) [-425.108] (-429.270) (-424.982) * (-425.879) (-427.209) [-425.228] (-426.231) -- 0:00:44
299500 -- (-429.257) (-425.575) (-425.794) [-426.571] * (-425.737) (-427.499) (-428.411) [-427.859] -- 0:00:44
300000 -- (-427.776) [-427.422] (-424.907) (-424.969) * (-429.615) (-427.653) [-426.037] (-425.320) -- 0:00:44
Average standard deviation of split frequencies: 0.009603
300500 -- [-426.826] (-425.661) (-428.350) (-426.164) * [-423.595] (-424.722) (-427.220) (-425.180) -- 0:00:44
301000 -- (-428.013) (-425.839) (-435.259) [-424.328] * [-427.158] (-424.716) (-427.650) (-425.935) -- 0:00:44
301500 -- [-426.468] (-427.102) (-428.487) (-424.472) * [-424.102] (-432.055) (-424.776) (-425.678) -- 0:00:44
302000 -- (-426.939) (-424.550) [-430.929] (-423.914) * (-425.083) [-424.977] (-424.798) (-430.316) -- 0:00:43
302500 -- (-426.934) (-427.078) [-424.669] (-424.399) * (-424.314) (-425.594) [-425.203] (-427.425) -- 0:00:43
303000 -- (-427.797) [-427.260] (-432.143) (-428.948) * [-424.302] (-427.405) (-427.067) (-427.131) -- 0:00:43
303500 -- (-423.721) (-426.663) [-428.323] (-426.150) * (-428.162) (-425.853) [-424.642] (-425.109) -- 0:00:43
304000 -- [-424.424] (-426.789) (-426.186) (-425.136) * [-429.484] (-426.603) (-426.874) (-424.837) -- 0:00:43
304500 -- (-423.991) (-427.017) (-424.605) [-424.867] * (-424.931) (-424.915) [-426.990] (-425.751) -- 0:00:43
305000 -- (-424.486) [-426.341] (-429.594) (-426.762) * (-425.004) (-424.409) (-425.446) [-425.292] -- 0:00:43
Average standard deviation of split frequencies: 0.010495
305500 -- (-424.402) [-428.992] (-427.183) (-428.247) * (-426.413) (-425.201) [-425.782] (-423.885) -- 0:00:43
306000 -- [-425.349] (-427.260) (-427.295) (-428.446) * (-424.751) (-424.544) [-427.080] (-426.730) -- 0:00:43
306500 -- (-425.388) [-428.480] (-425.316) (-427.849) * [-425.794] (-424.951) (-426.398) (-424.500) -- 0:00:42
307000 -- [-424.161] (-425.097) (-426.746) (-427.113) * (-424.959) [-427.391] (-428.733) (-425.849) -- 0:00:42
307500 -- (-424.482) [-424.041] (-426.798) (-426.491) * (-428.289) (-425.616) [-427.231] (-429.842) -- 0:00:42
308000 -- (-424.159) (-424.056) (-424.042) [-426.656] * (-428.780) [-424.796] (-426.744) (-424.716) -- 0:00:42
308500 -- (-424.750) (-427.284) (-425.961) [-425.460] * [-424.200] (-424.731) (-426.660) (-424.451) -- 0:00:42
309000 -- (-424.344) (-426.570) (-425.740) [-425.760] * [-426.086] (-424.638) (-429.981) (-425.343) -- 0:00:42
309500 -- (-427.205) [-424.853] (-424.305) (-425.537) * (-423.878) [-426.134] (-427.652) (-424.716) -- 0:00:44
310000 -- (-429.278) [-425.831] (-425.797) (-427.086) * (-423.658) [-425.352] (-428.014) (-427.068) -- 0:00:44
Average standard deviation of split frequencies: 0.011475
310500 -- (-432.608) (-429.672) [-425.215] (-427.524) * [-425.202] (-425.676) (-429.993) (-426.800) -- 0:00:44
311000 -- [-426.962] (-424.695) (-426.213) (-424.762) * (-425.662) (-426.061) [-424.650] (-423.949) -- 0:00:44
311500 -- (-425.165) [-425.784] (-427.965) (-428.929) * (-427.614) (-430.318) (-424.722) [-425.894] -- 0:00:44
312000 -- (-426.793) [-423.677] (-427.756) (-424.347) * (-429.619) [-426.590] (-424.567) (-425.707) -- 0:00:44
312500 -- (-427.830) [-424.588] (-425.019) (-425.421) * (-428.691) [-425.163] (-424.424) (-428.200) -- 0:00:44
313000 -- (-425.375) (-426.552) [-425.382] (-425.397) * (-427.489) (-425.774) (-425.435) [-425.951] -- 0:00:43
313500 -- (-427.663) (-426.248) [-425.123] (-423.952) * [-425.482] (-427.871) (-425.245) (-426.059) -- 0:00:43
314000 -- (-430.205) (-425.575) (-424.559) [-424.777] * (-426.247) (-425.023) (-425.667) [-431.363] -- 0:00:43
314500 -- (-428.472) (-425.926) [-425.217] (-425.065) * (-426.468) (-427.036) [-427.761] (-429.491) -- 0:00:43
315000 -- (-427.005) (-425.273) [-424.062] (-428.997) * [-426.965] (-425.869) (-426.205) (-427.241) -- 0:00:43
Average standard deviation of split frequencies: 0.011002
315500 -- (-426.524) [-426.359] (-425.842) (-424.280) * (-428.067) [-423.810] (-428.865) (-425.865) -- 0:00:43
316000 -- (-430.400) (-430.233) [-424.892] (-424.575) * (-427.022) (-426.974) [-426.627] (-426.673) -- 0:00:43
316500 -- (-425.343) (-425.209) [-429.785] (-424.246) * (-424.659) (-426.717) [-425.062] (-426.327) -- 0:00:43
317000 -- (-424.910) (-425.685) (-426.653) [-424.969] * (-426.434) (-424.626) [-425.414] (-426.048) -- 0:00:43
317500 -- (-425.218) (-425.998) (-428.173) [-423.914] * [-426.162] (-426.465) (-423.756) (-425.181) -- 0:00:42
318000 -- (-425.359) (-426.607) (-428.230) [-424.347] * (-425.134) [-426.411] (-423.756) (-427.470) -- 0:00:42
318500 -- (-424.088) (-424.683) [-425.975] (-426.263) * (-425.969) (-425.883) [-424.336] (-426.455) -- 0:00:42
319000 -- (-424.826) [-423.821] (-425.790) (-426.295) * (-428.301) (-428.656) (-426.429) [-425.663] -- 0:00:42
319500 -- (-425.233) (-423.652) [-425.328] (-425.804) * (-426.613) (-426.412) (-425.874) [-424.743] -- 0:00:42
320000 -- (-425.323) (-424.672) (-425.304) [-425.701] * (-428.467) [-424.018] (-425.726) (-425.773) -- 0:00:42
Average standard deviation of split frequencies: 0.011485
320500 -- (-423.825) [-428.129] (-427.471) (-425.661) * (-427.079) (-424.483) [-423.630] (-423.666) -- 0:00:42
321000 -- (-425.138) [-425.268] (-427.214) (-426.829) * [-424.825] (-424.689) (-425.697) (-424.454) -- 0:00:42
321500 -- (-429.579) [-423.968] (-424.880) (-425.345) * (-427.860) [-426.029] (-428.222) (-426.990) -- 0:00:42
322000 -- (-424.185) [-426.278] (-427.458) (-428.907) * (-426.301) (-426.532) [-423.635] (-425.091) -- 0:00:42
322500 -- (-426.109) [-424.489] (-426.955) (-425.791) * [-427.300] (-427.422) (-424.988) (-426.065) -- 0:00:42
323000 -- (-427.188) [-426.074] (-423.962) (-426.675) * [-426.689] (-424.438) (-426.137) (-424.997) -- 0:00:41
323500 -- (-426.658) (-426.233) [-428.932] (-426.006) * (-425.932) [-426.130] (-426.287) (-428.859) -- 0:00:41
324000 -- (-426.801) [-426.112] (-424.563) (-425.007) * (-428.721) (-426.771) (-426.491) [-423.541] -- 0:00:41
324500 -- [-424.345] (-426.814) (-424.921) (-424.908) * (-426.258) (-425.636) (-426.532) [-424.408] -- 0:00:41
325000 -- (-426.226) (-428.412) (-429.900) [-424.245] * (-425.194) (-426.179) (-425.550) [-424.559] -- 0:00:43
Average standard deviation of split frequencies: 0.011026
325500 -- (-430.280) [-425.407] (-425.400) (-427.169) * (-425.642) (-425.426) (-428.799) [-424.203] -- 0:00:43
326000 -- (-424.012) (-427.553) [-425.267] (-424.711) * (-426.231) (-427.683) (-429.734) [-424.915] -- 0:00:43
326500 -- (-424.389) (-424.946) (-424.275) [-425.601] * (-425.022) (-426.252) [-423.990] (-428.658) -- 0:00:43
327000 -- [-425.067] (-425.423) (-425.978) (-426.598) * [-425.425] (-426.258) (-424.973) (-424.617) -- 0:00:43
327500 -- (-429.417) (-424.074) (-425.506) [-424.947] * (-424.774) [-423.896] (-426.998) (-424.468) -- 0:00:43
328000 -- (-429.609) (-425.395) [-425.226] (-423.715) * [-429.056] (-424.316) (-425.900) (-424.457) -- 0:00:43
328500 -- (-427.563) (-427.082) [-425.852] (-426.258) * [-425.730] (-426.135) (-425.629) (-427.321) -- 0:00:42
329000 -- (-426.045) (-424.053) (-426.604) [-423.523] * (-428.635) (-425.339) (-424.883) [-427.831] -- 0:00:42
329500 -- [-427.630] (-428.032) (-425.454) (-424.844) * [-426.204] (-426.159) (-424.711) (-425.882) -- 0:00:42
330000 -- (-425.815) (-425.042) (-425.953) [-424.322] * (-425.563) (-425.063) [-424.792] (-424.343) -- 0:00:42
Average standard deviation of split frequencies: 0.012474
330500 -- (-428.275) (-424.218) (-425.454) [-426.985] * [-424.527] (-424.683) (-427.326) (-425.297) -- 0:00:42
331000 -- (-425.488) [-428.001] (-426.191) (-427.151) * (-423.909) (-426.285) [-426.388] (-425.704) -- 0:00:42
331500 -- (-424.945) (-425.869) (-424.741) [-425.699] * (-426.994) [-427.651] (-425.563) (-425.345) -- 0:00:42
332000 -- (-424.437) (-425.209) (-425.732) [-424.594] * (-425.103) [-425.633] (-426.068) (-428.344) -- 0:00:42
332500 -- (-425.701) [-424.109] (-426.925) (-424.156) * (-424.283) (-424.636) [-424.849] (-425.611) -- 0:00:42
333000 -- [-425.109] (-426.050) (-423.914) (-425.030) * (-427.385) [-423.531] (-426.837) (-424.963) -- 0:00:42
333500 -- [-426.104] (-426.683) (-425.913) (-423.844) * (-426.785) (-423.785) [-424.973] (-425.599) -- 0:00:41
334000 -- [-426.365] (-425.806) (-424.857) (-426.609) * (-427.762) [-424.578] (-424.000) (-424.567) -- 0:00:41
334500 -- (-427.682) (-427.122) (-425.791) [-425.650] * (-427.909) (-425.716) (-424.659) [-426.252] -- 0:00:41
335000 -- (-429.449) (-426.223) (-424.092) [-423.920] * (-428.356) [-424.644] (-426.743) (-425.387) -- 0:00:41
Average standard deviation of split frequencies: 0.011312
335500 -- (-426.337) (-427.555) [-424.204] (-426.995) * [-426.794] (-427.461) (-426.174) (-429.094) -- 0:00:41
336000 -- (-427.221) (-425.249) [-425.748] (-424.505) * [-425.719] (-426.722) (-427.762) (-431.144) -- 0:00:41
336500 -- (-426.947) [-426.368] (-425.194) (-429.432) * (-424.212) (-433.059) (-425.801) [-424.340] -- 0:00:41
337000 -- (-425.857) (-425.535) [-426.459] (-426.323) * (-426.982) [-424.843] (-427.265) (-427.204) -- 0:00:41
337500 -- (-425.906) (-425.804) (-429.289) [-424.926] * (-425.800) [-426.105] (-423.909) (-426.531) -- 0:00:41
338000 -- (-426.352) [-427.723] (-429.236) (-424.760) * (-426.420) (-427.129) (-424.776) [-425.292] -- 0:00:41
338500 -- (-425.313) (-424.869) [-425.259] (-426.385) * (-424.284) [-426.399] (-424.924) (-426.533) -- 0:00:41
339000 -- [-425.807] (-426.161) (-427.243) (-425.606) * [-427.494] (-426.347) (-425.172) (-424.957) -- 0:00:40
339500 -- (-429.229) (-428.752) (-425.598) [-427.777] * (-425.344) [-428.964] (-424.864) (-431.717) -- 0:00:40
340000 -- (-431.088) (-424.874) (-426.161) [-425.936] * (-425.199) (-425.946) [-427.296] (-425.206) -- 0:00:40
Average standard deviation of split frequencies: 0.010119
340500 -- (-426.475) (-424.997) [-429.307] (-425.959) * [-424.343] (-427.029) (-424.160) (-429.837) -- 0:00:40
341000 -- [-424.694] (-426.716) (-425.699) (-427.557) * [-423.968] (-427.324) (-425.867) (-425.766) -- 0:00:42
341500 -- [-423.705] (-427.479) (-424.431) (-424.536) * (-425.912) [-426.298] (-425.898) (-430.110) -- 0:00:42
342000 -- (-424.798) [-428.998] (-425.423) (-426.048) * (-425.107) [-425.603] (-427.670) (-428.418) -- 0:00:42
342500 -- [-429.841] (-424.529) (-426.437) (-423.955) * (-426.894) [-424.878] (-427.698) (-427.512) -- 0:00:42
343000 -- (-423.918) (-429.367) [-425.040] (-429.692) * (-424.969) (-425.056) (-424.469) [-428.498] -- 0:00:42
343500 -- (-426.234) (-427.038) [-424.769] (-424.105) * [-424.339] (-426.624) (-429.168) (-425.219) -- 0:00:42
344000 -- (-424.734) (-428.671) (-424.697) [-425.121] * (-426.632) (-429.171) (-425.538) [-423.731] -- 0:00:41
344500 -- [-424.348] (-426.614) (-426.294) (-426.006) * (-426.326) (-427.225) (-427.114) [-428.385] -- 0:00:41
345000 -- (-425.183) [-426.971] (-423.842) (-424.229) * (-425.585) (-426.409) [-424.663] (-427.648) -- 0:00:41
Average standard deviation of split frequencies: 0.010389
345500 -- [-427.322] (-427.230) (-425.671) (-427.174) * (-425.866) (-427.229) [-424.754] (-425.980) -- 0:00:41
346000 -- [-428.969] (-429.227) (-424.030) (-428.321) * (-425.410) (-426.811) (-424.256) [-425.413] -- 0:00:41
346500 -- (-432.337) (-426.344) [-424.457] (-428.316) * (-424.842) (-428.081) (-426.154) [-428.136] -- 0:00:41
347000 -- (-424.675) [-429.813] (-423.865) (-426.784) * (-426.676) (-425.895) (-424.313) [-426.155] -- 0:00:41
347500 -- [-426.877] (-425.362) (-425.447) (-424.813) * (-429.491) (-427.788) (-426.178) [-425.033] -- 0:00:41
348000 -- (-425.946) [-425.181] (-426.889) (-425.895) * (-430.430) (-424.883) (-426.840) [-428.107] -- 0:00:41
348500 -- [-425.378] (-425.210) (-426.714) (-423.490) * (-429.995) (-426.076) (-428.566) [-424.208] -- 0:00:41
349000 -- (-425.753) (-427.080) [-426.075] (-423.819) * (-428.502) (-428.306) (-429.744) [-426.149] -- 0:00:41
349500 -- (-424.352) (-426.159) [-425.013] (-426.810) * (-426.066) (-425.139) (-427.141) [-424.404] -- 0:00:40
350000 -- (-426.416) (-426.968) (-426.334) [-425.034] * (-425.161) (-426.818) [-424.453] (-424.576) -- 0:00:40
Average standard deviation of split frequencies: 0.010923
350500 -- [-424.086] (-430.098) (-428.181) (-425.456) * (-425.712) [-424.529] (-429.219) (-425.719) -- 0:00:40
351000 -- (-424.363) (-425.148) [-424.053] (-425.847) * (-425.300) [-430.051] (-427.188) (-424.630) -- 0:00:40
351500 -- [-423.939] (-425.338) (-424.584) (-425.367) * (-425.265) (-425.507) [-424.027] (-425.619) -- 0:00:40
352000 -- (-424.624) (-430.800) [-425.139] (-426.590) * [-423.925] (-426.624) (-424.576) (-425.453) -- 0:00:42
352500 -- (-424.744) [-427.878] (-426.366) (-425.599) * (-425.225) (-427.109) [-426.265] (-424.330) -- 0:00:42
353000 -- (-424.113) (-425.107) [-426.667] (-423.993) * (-424.778) (-429.485) (-427.437) [-425.895] -- 0:00:42
353500 -- (-427.638) [-424.344] (-428.406) (-426.936) * (-427.438) (-429.687) [-427.779] (-427.185) -- 0:00:42
354000 -- (-424.519) (-426.418) [-425.103] (-424.089) * (-428.743) [-425.269] (-428.687) (-426.180) -- 0:00:41
354500 -- [-424.502] (-425.723) (-424.948) (-426.518) * [-426.237] (-428.701) (-426.384) (-425.507) -- 0:00:41
355000 -- [-424.664] (-425.766) (-425.641) (-429.387) * (-427.942) [-426.021] (-424.943) (-428.396) -- 0:00:41
Average standard deviation of split frequencies: 0.010180
355500 -- (-423.841) (-426.300) [-426.840] (-427.083) * [-425.494] (-424.791) (-427.690) (-427.914) -- 0:00:41
356000 -- (-425.576) (-424.339) [-425.038] (-424.674) * (-426.488) (-425.538) [-424.489] (-424.622) -- 0:00:41
356500 -- [-426.914] (-426.390) (-426.529) (-427.108) * (-424.393) (-426.730) [-423.823] (-424.645) -- 0:00:41
357000 -- [-424.518] (-428.055) (-424.673) (-426.232) * (-426.185) (-425.355) (-425.458) [-426.687] -- 0:00:41
357500 -- (-426.214) (-425.697) [-426.715] (-430.681) * (-427.706) (-424.793) [-424.134] (-424.190) -- 0:00:41
358000 -- [-427.378] (-427.734) (-426.138) (-425.149) * (-426.757) (-426.121) [-424.049] (-428.677) -- 0:00:41
358500 -- [-424.055] (-425.008) (-426.188) (-424.647) * (-424.472) [-425.318] (-428.425) (-426.551) -- 0:00:41
359000 -- [-423.759] (-425.569) (-427.108) (-425.775) * (-425.925) (-428.033) [-428.535] (-426.269) -- 0:00:41
359500 -- (-426.121) (-428.102) [-426.003] (-423.703) * [-424.659] (-427.926) (-426.949) (-425.124) -- 0:00:40
360000 -- (-425.568) [-424.019] (-430.494) (-425.086) * [-425.904] (-427.006) (-426.420) (-426.537) -- 0:00:40
Average standard deviation of split frequencies: 0.009803
360500 -- (-425.422) (-426.425) (-427.248) [-425.902] * (-425.715) [-423.465] (-426.201) (-426.939) -- 0:00:40
361000 -- [-426.319] (-427.737) (-426.526) (-423.605) * (-425.296) (-425.538) [-426.885] (-427.765) -- 0:00:40
361500 -- (-427.686) (-424.173) (-425.063) [-427.163] * (-425.703) (-424.722) [-425.656] (-425.578) -- 0:00:40
362000 -- (-425.653) (-431.085) (-427.561) [-425.696] * (-425.427) (-424.496) [-424.181] (-427.095) -- 0:00:40
362500 -- (-425.907) [-427.997] (-427.806) (-423.792) * (-427.188) (-426.650) (-425.374) [-426.895] -- 0:00:40
363000 -- (-425.893) (-425.425) [-424.185] (-428.968) * (-427.705) [-426.625] (-425.624) (-425.660) -- 0:00:40
363500 -- (-425.610) (-424.645) (-426.247) [-427.783] * (-428.348) (-429.025) (-425.971) [-425.988] -- 0:00:40
364000 -- [-429.067] (-425.119) (-423.703) (-425.267) * (-428.364) (-429.443) [-425.212] (-426.894) -- 0:00:40
364500 -- (-425.636) [-425.493] (-426.726) (-426.766) * [-423.851] (-426.275) (-427.558) (-425.648) -- 0:00:40
365000 -- [-423.756] (-427.794) (-427.392) (-424.285) * (-426.129) (-428.457) [-427.149] (-428.324) -- 0:00:40
Average standard deviation of split frequencies: 0.009338
365500 -- (-425.480) (-426.444) (-430.582) [-427.471] * (-426.973) (-424.154) [-423.987] (-424.512) -- 0:00:41
366000 -- [-425.574] (-426.091) (-429.826) (-424.994) * (-425.237) (-426.006) (-428.881) [-424.952] -- 0:00:41
366500 -- (-424.347) (-424.948) (-429.417) [-426.753] * (-426.623) (-425.101) [-427.077] (-425.578) -- 0:00:41
367000 -- (-427.057) (-424.854) [-424.575] (-424.229) * [-428.484] (-427.759) (-425.669) (-423.893) -- 0:00:41
367500 -- [-426.661] (-423.899) (-427.069) (-426.038) * (-426.793) [-424.695] (-428.653) (-426.817) -- 0:00:41
368000 -- (-430.287) (-424.373) [-424.318] (-427.207) * (-425.777) (-434.555) (-427.412) [-426.565] -- 0:00:41
368500 -- [-423.936] (-425.230) (-425.253) (-425.960) * (-424.147) (-424.273) [-424.810] (-427.391) -- 0:00:41
369000 -- (-424.782) (-427.493) (-426.241) [-427.610] * (-425.203) (-423.683) (-425.504) [-426.230] -- 0:00:41
369500 -- [-424.880] (-427.825) (-428.020) (-426.615) * (-424.570) [-427.408] (-424.979) (-425.130) -- 0:00:40
370000 -- (-423.831) (-425.637) (-427.676) [-424.627] * (-424.180) (-424.639) (-426.363) [-424.946] -- 0:00:40
Average standard deviation of split frequencies: 0.009220
370500 -- [-425.140] (-425.871) (-423.952) (-424.758) * (-424.352) [-428.318] (-427.116) (-425.323) -- 0:00:40
371000 -- (-424.625) (-427.076) [-425.125] (-425.236) * (-425.274) (-426.683) (-426.487) [-426.526] -- 0:00:40
371500 -- [-425.660] (-426.127) (-424.046) (-425.546) * (-425.291) [-426.339] (-429.965) (-427.359) -- 0:00:40
372000 -- [-425.159] (-426.520) (-424.422) (-425.673) * [-424.992] (-428.643) (-428.649) (-423.690) -- 0:00:40
372500 -- [-425.003] (-425.049) (-423.780) (-424.609) * (-424.670) (-429.737) (-424.664) [-423.642] -- 0:00:40
373000 -- (-425.350) [-424.699] (-424.524) (-426.766) * (-425.983) (-424.494) [-427.915] (-426.599) -- 0:00:40
373500 -- (-423.916) [-424.431] (-426.545) (-425.123) * (-429.772) (-426.477) [-425.747] (-425.193) -- 0:00:40
374000 -- (-424.729) (-425.298) [-425.724] (-425.182) * (-425.799) [-424.756] (-426.257) (-427.876) -- 0:00:40
374500 -- (-424.329) (-424.162) (-425.374) [-426.703] * (-428.591) [-424.326] (-427.471) (-426.810) -- 0:00:40
375000 -- (-427.407) [-426.037] (-423.510) (-426.023) * (-426.681) [-425.583] (-424.803) (-426.486) -- 0:00:40
Average standard deviation of split frequencies: 0.009873
375500 -- (-426.541) (-425.559) [-423.682] (-426.327) * (-426.499) (-428.395) [-425.068] (-425.545) -- 0:00:39
376000 -- (-426.331) [-425.004] (-432.264) (-424.287) * [-428.243] (-426.080) (-425.729) (-426.332) -- 0:00:39
376500 -- (-425.801) (-428.506) (-427.537) [-426.764] * (-429.842) (-425.347) [-426.235] (-424.861) -- 0:00:39
377000 -- (-425.352) [-428.455] (-426.636) (-423.930) * (-425.744) [-426.863] (-425.043) (-425.018) -- 0:00:39
377500 -- (-425.644) (-425.807) (-426.310) [-426.110] * (-423.936) [-425.720] (-427.273) (-424.235) -- 0:00:39
378000 -- (-425.972) (-426.030) (-424.894) [-425.671] * (-424.564) [-424.195] (-425.827) (-430.592) -- 0:00:39
378500 -- (-424.433) (-429.081) (-424.000) [-427.070] * (-426.347) [-424.548] (-427.950) (-425.110) -- 0:00:39
379000 -- (-425.821) (-429.240) (-424.265) [-427.860] * [-425.004] (-425.051) (-424.432) (-425.124) -- 0:00:39
379500 -- [-423.857] (-426.712) (-425.552) (-426.024) * (-426.116) (-424.873) (-426.719) [-425.536] -- 0:00:39
380000 -- (-427.816) [-424.199] (-425.491) (-427.784) * [-426.887] (-424.372) (-425.187) (-424.740) -- 0:00:39
Average standard deviation of split frequencies: 0.009056
380500 -- (-424.100) (-423.734) [-424.511] (-426.089) * (-430.501) [-427.303] (-425.628) (-423.664) -- 0:00:39
381000 -- (-424.267) (-426.752) [-423.842] (-424.482) * (-426.333) (-424.079) (-425.462) [-425.475] -- 0:00:38
381500 -- [-426.294] (-424.684) (-423.622) (-424.319) * (-430.676) (-427.122) (-423.625) [-425.690] -- 0:00:38
382000 -- [-426.280] (-424.969) (-424.933) (-427.072) * (-426.202) (-428.349) (-427.764) [-425.454] -- 0:00:38
382500 -- (-428.239) (-424.063) [-426.321] (-424.323) * (-425.376) [-425.001] (-432.456) (-426.309) -- 0:00:38
383000 -- [-425.461] (-427.076) (-426.414) (-426.068) * (-428.180) (-429.742) (-425.339) [-425.636] -- 0:00:40
383500 -- (-424.386) (-432.229) (-429.551) [-425.638] * [-426.902] (-433.889) (-427.146) (-425.296) -- 0:00:40
384000 -- [-425.431] (-428.058) (-426.060) (-425.669) * [-426.212] (-428.524) (-424.163) (-427.991) -- 0:00:40
384500 -- (-424.158) [-425.390] (-424.643) (-424.806) * (-426.973) (-425.564) [-424.523] (-424.346) -- 0:00:40
385000 -- (-429.517) (-424.366) [-426.343] (-426.797) * (-424.504) [-425.599] (-428.496) (-427.074) -- 0:00:39
Average standard deviation of split frequencies: 0.007862
385500 -- (-425.714) (-428.626) [-427.381] (-430.869) * [-424.930] (-424.775) (-427.139) (-426.082) -- 0:00:39
386000 -- (-424.655) [-424.453] (-428.155) (-425.122) * (-429.494) (-425.904) (-425.791) [-423.752] -- 0:00:39
386500 -- (-425.712) (-425.939) (-427.637) [-424.029] * (-425.672) (-427.467) (-425.557) [-424.140] -- 0:00:39
387000 -- (-425.040) (-424.941) (-426.073) [-425.052] * (-424.088) (-427.013) (-424.889) [-425.166] -- 0:00:39
387500 -- (-426.980) (-426.850) (-427.018) [-427.771] * (-424.678) [-424.357] (-425.450) (-425.227) -- 0:00:39
388000 -- [-426.284] (-425.612) (-425.207) (-424.935) * (-426.330) (-429.777) (-423.666) [-424.277] -- 0:00:39
388500 -- (-425.569) [-426.693] (-425.040) (-424.557) * (-424.346) (-425.031) [-424.071] (-429.260) -- 0:00:39
389000 -- (-426.016) (-426.716) (-423.647) [-427.800] * (-435.401) (-427.765) [-423.754] (-427.309) -- 0:00:39
389500 -- (-425.081) (-429.099) [-425.566] (-428.070) * [-428.669] (-427.324) (-426.510) (-423.823) -- 0:00:39
390000 -- (-426.658) (-427.277) [-426.410] (-432.516) * (-425.010) [-423.894] (-424.932) (-424.353) -- 0:00:39
Average standard deviation of split frequencies: 0.007768
390500 -- (-426.313) (-425.919) (-426.950) [-428.063] * [-428.987] (-423.442) (-425.277) (-428.186) -- 0:00:39
391000 -- [-426.119] (-426.448) (-427.925) (-430.908) * (-426.157) (-423.856) (-425.421) [-425.215] -- 0:00:38
391500 -- (-425.301) [-426.659] (-426.546) (-427.995) * (-426.558) (-426.519) [-427.383] (-426.094) -- 0:00:38
392000 -- (-426.242) [-430.037] (-429.600) (-426.527) * (-425.602) [-424.670] (-427.525) (-425.762) -- 0:00:38
392500 -- (-425.763) (-423.686) (-429.993) [-424.802] * (-425.049) (-425.803) (-428.369) [-425.623] -- 0:00:38
393000 -- (-426.381) (-426.747) [-425.088] (-425.962) * (-424.773) (-425.403) [-426.878] (-425.762) -- 0:00:38
393500 -- (-425.118) (-427.483) (-425.094) [-426.133] * [-428.513] (-423.593) (-426.898) (-425.561) -- 0:00:38
394000 -- (-427.030) (-424.648) [-425.952] (-428.011) * [-424.929] (-425.526) (-425.981) (-427.353) -- 0:00:38
394500 -- (-426.715) (-425.824) (-424.491) [-429.585] * (-428.387) [-424.620] (-423.790) (-424.429) -- 0:00:38
395000 -- (-427.938) (-423.908) [-425.947] (-426.946) * (-425.060) (-427.276) (-423.972) [-425.350] -- 0:00:38
Average standard deviation of split frequencies: 0.007887
395500 -- (-425.375) [-429.761] (-426.890) (-426.905) * (-424.830) (-426.188) (-425.309) [-426.418] -- 0:00:38
396000 -- [-425.072] (-426.453) (-424.587) (-424.651) * (-425.340) [-424.814] (-433.904) (-424.781) -- 0:00:38
396500 -- (-424.680) [-424.943] (-425.932) (-425.760) * (-427.115) (-428.126) (-425.510) [-425.934] -- 0:00:38
397000 -- [-424.957] (-424.934) (-430.037) (-426.304) * [-424.384] (-427.659) (-424.255) (-425.541) -- 0:00:37
397500 -- (-425.194) (-424.808) [-425.183] (-423.708) * (-426.870) (-426.629) (-425.381) [-427.890] -- 0:00:37
398000 -- (-426.357) [-426.364] (-424.655) (-424.802) * (-425.738) (-427.433) (-427.092) [-424.983] -- 0:00:39
398500 -- (-432.083) (-426.416) (-423.574) [-425.156] * (-426.266) [-424.412] (-428.015) (-427.640) -- 0:00:39
399000 -- (-423.465) (-429.757) [-426.242] (-425.627) * (-426.353) (-427.204) [-424.293] (-426.613) -- 0:00:39
399500 -- (-424.426) (-429.911) (-425.729) [-426.904] * [-425.633] (-425.794) (-425.567) (-425.964) -- 0:00:39
400000 -- (-423.665) [-424.902] (-428.780) (-424.211) * (-424.155) [-424.451] (-426.081) (-428.280) -- 0:00:39
Average standard deviation of split frequencies: 0.008383
400500 -- (-425.486) (-432.837) (-425.779) [-425.443] * (-424.000) (-428.336) [-426.477] (-423.899) -- 0:00:38
401000 -- [-425.090] (-429.999) (-428.320) (-429.118) * (-427.818) (-425.935) [-424.109] (-429.070) -- 0:00:38
401500 -- [-425.650] (-425.435) (-426.200) (-429.921) * (-427.702) (-426.696) (-424.959) [-428.056] -- 0:00:38
402000 -- [-426.640] (-427.253) (-427.512) (-425.436) * (-424.854) [-428.453] (-426.269) (-431.818) -- 0:00:38
402500 -- [-424.945] (-429.144) (-423.962) (-426.668) * (-427.867) [-425.572] (-424.458) (-428.393) -- 0:00:38
403000 -- (-424.368) (-429.089) (-425.663) [-427.009] * (-431.907) (-426.031) [-427.632] (-428.781) -- 0:00:38
403500 -- [-425.154] (-424.364) (-425.757) (-425.293) * (-426.096) (-429.768) [-425.960] (-425.099) -- 0:00:38
404000 -- (-424.684) (-424.051) [-425.861] (-424.352) * [-424.814] (-424.984) (-426.591) (-425.865) -- 0:00:38
404500 -- (-424.524) (-424.069) (-425.523) [-424.172] * (-426.248) (-426.243) [-425.777] (-425.759) -- 0:00:38
405000 -- (-425.328) [-424.052] (-425.333) (-423.432) * (-428.150) [-423.867] (-423.982) (-425.381) -- 0:00:38
Average standard deviation of split frequencies: 0.007910
405500 -- [-425.050] (-427.305) (-426.401) (-423.430) * (-425.297) (-425.759) [-427.781] (-425.270) -- 0:00:38
406000 -- (-428.646) (-424.997) (-426.186) [-424.039] * (-425.426) [-426.761] (-425.817) (-424.713) -- 0:00:38
406500 -- [-425.681] (-426.110) (-427.252) (-428.741) * (-424.080) (-425.388) (-426.393) [-427.244] -- 0:00:37
407000 -- [-428.306] (-425.531) (-425.885) (-429.821) * (-426.224) (-433.971) [-425.974] (-426.079) -- 0:00:37
407500 -- (-425.151) (-430.588) (-425.031) [-425.010] * [-427.185] (-427.434) (-428.672) (-425.253) -- 0:00:37
408000 -- [-424.522] (-424.880) (-427.987) (-424.673) * (-434.316) (-426.973) (-430.196) [-426.623] -- 0:00:37
408500 -- (-431.657) (-423.664) [-425.834] (-424.855) * (-425.152) [-427.814] (-424.636) (-426.351) -- 0:00:37
409000 -- [-428.585] (-426.235) (-429.722) (-424.507) * (-429.321) (-428.557) (-424.096) [-426.311] -- 0:00:37
409500 -- (-426.954) (-427.266) (-430.922) [-425.178] * (-426.897) (-424.305) (-425.471) [-427.329] -- 0:00:37
410000 -- (-426.470) (-428.046) (-428.152) [-426.027] * (-426.138) (-426.940) [-423.961] (-425.251) -- 0:00:37
Average standard deviation of split frequencies: 0.007677
410500 -- (-426.630) (-425.076) [-424.349] (-431.924) * (-425.597) (-425.778) (-423.741) [-424.793] -- 0:00:37
411000 -- [-425.147] (-424.902) (-426.382) (-428.901) * [-426.864] (-427.033) (-425.358) (-425.058) -- 0:00:37
411500 -- [-425.681] (-425.073) (-427.140) (-425.127) * (-430.309) [-424.749] (-431.158) (-428.149) -- 0:00:37
412000 -- (-424.947) (-425.126) [-425.426] (-427.146) * (-426.536) [-424.196] (-432.735) (-426.133) -- 0:00:37
412500 -- (-425.201) (-430.188) (-429.561) [-429.706] * (-425.835) (-426.039) (-426.314) [-424.945] -- 0:00:37
413000 -- (-427.379) (-429.375) (-429.112) [-426.204] * (-425.400) (-426.266) [-423.965] (-424.215) -- 0:00:38
413500 -- (-426.420) (-427.720) (-425.918) [-424.324] * (-426.545) (-424.709) [-425.467] (-424.618) -- 0:00:38
414000 -- [-423.408] (-425.202) (-427.766) (-425.103) * (-426.760) [-426.340] (-428.350) (-426.584) -- 0:00:38
414500 -- [-423.850] (-427.380) (-428.070) (-425.964) * (-425.746) (-426.721) [-426.259] (-424.705) -- 0:00:38
415000 -- [-429.895] (-426.322) (-428.366) (-424.833) * [-427.248] (-425.737) (-427.513) (-428.149) -- 0:00:38
Average standard deviation of split frequencies: 0.008003
415500 -- [-425.853] (-427.577) (-425.040) (-424.503) * [-423.885] (-428.081) (-428.295) (-425.741) -- 0:00:37
416000 -- (-426.215) (-425.084) (-424.385) [-425.273] * (-424.643) [-424.897] (-425.519) (-425.341) -- 0:00:37
416500 -- (-426.644) (-427.066) (-425.036) [-425.261] * (-425.223) [-424.672] (-430.337) (-426.997) -- 0:00:37
417000 -- (-425.543) [-424.905] (-427.288) (-430.174) * (-426.007) [-424.683] (-427.412) (-424.697) -- 0:00:37
417500 -- (-427.602) (-426.860) [-424.578] (-426.163) * (-430.069) [-429.165] (-426.447) (-424.608) -- 0:00:37
418000 -- (-424.284) (-425.655) [-424.350] (-426.154) * (-427.657) (-423.994) (-429.011) [-426.381] -- 0:00:37
418500 -- (-424.834) (-426.717) (-424.756) [-427.170] * [-426.485] (-428.717) (-428.925) (-426.526) -- 0:00:37
419000 -- (-426.642) (-430.032) [-424.049] (-426.702) * [-425.774] (-425.408) (-429.254) (-427.963) -- 0:00:37
419500 -- (-426.929) [-424.068] (-425.616) (-425.297) * (-424.748) (-426.101) (-426.094) [-426.904] -- 0:00:37
420000 -- (-424.263) [-423.811] (-427.393) (-425.772) * [-428.422] (-428.417) (-425.465) (-428.207) -- 0:00:37
Average standard deviation of split frequencies: 0.008054
420500 -- (-424.763) (-426.513) (-425.509) [-426.578] * [-426.209] (-425.913) (-423.931) (-429.201) -- 0:00:37
421000 -- (-424.302) (-428.618) [-424.711] (-433.319) * (-428.746) (-425.900) (-429.955) [-427.716] -- 0:00:37
421500 -- (-424.604) (-425.533) [-425.265] (-427.402) * (-427.399) [-424.557] (-423.905) (-424.158) -- 0:00:37
422000 -- (-429.466) (-424.197) [-425.796] (-425.443) * (-428.578) (-425.620) (-424.958) [-424.762] -- 0:00:36
422500 -- (-424.432) [-424.825] (-424.898) (-424.582) * [-427.216] (-425.384) (-426.201) (-426.917) -- 0:00:36
423000 -- (-425.135) (-425.084) [-426.126] (-426.530) * [-426.966] (-424.711) (-424.988) (-424.058) -- 0:00:36
423500 -- [-425.805] (-429.576) (-425.477) (-424.934) * [-427.073] (-427.985) (-429.790) (-426.093) -- 0:00:36
424000 -- (-425.513) (-424.917) (-425.837) [-426.297] * (-426.403) (-425.256) [-424.690] (-424.460) -- 0:00:36
424500 -- [-424.495] (-426.562) (-425.591) (-426.512) * [-423.946] (-424.942) (-427.732) (-426.488) -- 0:00:36
425000 -- (-426.157) [-425.270] (-425.342) (-427.949) * (-424.744) (-425.278) (-425.204) [-426.314] -- 0:00:36
Average standard deviation of split frequencies: 0.008299
425500 -- (-426.207) [-425.610] (-423.668) (-431.700) * [-427.326] (-426.175) (-427.003) (-426.643) -- 0:00:36
426000 -- (-424.923) [-423.610] (-423.747) (-425.666) * (-425.423) (-427.513) (-426.370) [-424.541] -- 0:00:36
426500 -- [-425.398] (-424.044) (-425.589) (-424.119) * [-424.641] (-424.260) (-425.663) (-426.121) -- 0:00:36
427000 -- (-425.265) [-427.000] (-424.228) (-426.324) * (-428.075) (-426.750) [-425.478] (-428.252) -- 0:00:36
427500 -- (-427.931) (-423.718) [-426.241] (-426.192) * [-425.437] (-427.385) (-424.774) (-427.107) -- 0:00:36
428000 -- [-423.828] (-426.093) (-425.515) (-427.876) * (-423.876) (-428.932) [-427.280] (-423.908) -- 0:00:36
428500 -- (-427.082) (-426.379) (-424.638) [-425.270] * (-428.395) [-425.210] (-424.110) (-425.519) -- 0:00:36
429000 -- [-424.908] (-429.307) (-428.555) (-425.446) * [-424.769] (-423.837) (-427.060) (-428.709) -- 0:00:37
429500 -- (-425.738) (-424.466) [-424.694] (-426.850) * (-428.890) [-429.093] (-423.777) (-429.851) -- 0:00:37
430000 -- (-424.682) (-423.705) (-426.070) [-429.611] * [-425.166] (-424.315) (-423.912) (-429.026) -- 0:00:37
Average standard deviation of split frequencies: 0.007388
430500 -- [-424.363] (-427.896) (-425.000) (-424.447) * (-430.050) [-427.200] (-425.454) (-425.272) -- 0:00:37
431000 -- (-424.014) (-426.447) [-423.852] (-426.837) * (-426.409) (-424.685) (-424.568) [-426.664] -- 0:00:36
431500 -- (-424.757) [-425.020] (-425.083) (-424.475) * (-424.476) (-426.542) [-424.961] (-426.772) -- 0:00:36
432000 -- [-425.779] (-427.250) (-429.119) (-428.209) * [-425.967] (-426.326) (-424.540) (-427.063) -- 0:00:36
432500 -- (-426.128) (-423.817) (-427.029) [-426.096] * [-428.830] (-425.197) (-424.330) (-425.380) -- 0:00:36
433000 -- (-425.230) (-425.167) [-426.879] (-430.302) * (-424.775) (-426.852) [-425.020] (-424.929) -- 0:00:36
433500 -- (-426.836) (-425.054) [-426.174] (-427.029) * [-424.575] (-425.799) (-425.513) (-426.006) -- 0:00:36
434000 -- (-430.456) [-425.001] (-427.278) (-424.377) * [-425.284] (-425.493) (-424.742) (-424.328) -- 0:00:36
434500 -- (-428.089) [-430.212] (-424.956) (-424.714) * (-426.719) [-425.000] (-424.233) (-426.495) -- 0:00:36
435000 -- [-424.862] (-434.439) (-424.635) (-427.616) * [-425.238] (-425.769) (-426.528) (-424.132) -- 0:00:36
Average standard deviation of split frequencies: 0.007974
435500 -- (-424.638) (-428.048) [-424.987] (-424.590) * (-424.604) (-427.300) (-426.520) [-425.521] -- 0:00:36
436000 -- [-425.060] (-425.445) (-426.638) (-424.543) * [-423.889] (-424.589) (-426.773) (-425.547) -- 0:00:36
436500 -- (-425.588) (-424.863) [-429.011] (-424.861) * [-423.800] (-427.337) (-424.171) (-429.169) -- 0:00:36
437000 -- (-424.506) (-425.201) (-424.082) [-424.810] * (-423.605) [-425.389] (-424.892) (-423.992) -- 0:00:36
437500 -- (-425.019) [-427.046] (-427.343) (-428.381) * (-427.025) (-428.115) [-424.487] (-425.458) -- 0:00:36
438000 -- [-425.678] (-425.910) (-425.655) (-424.810) * (-428.164) (-425.960) (-425.844) [-424.148] -- 0:00:35
438500 -- (-425.658) [-424.980] (-424.380) (-424.388) * (-423.564) [-426.854] (-424.066) (-425.359) -- 0:00:35
439000 -- (-424.416) [-425.398] (-426.034) (-424.413) * [-423.902] (-424.414) (-424.839) (-424.127) -- 0:00:35
439500 -- (-424.228) [-427.775] (-426.997) (-427.692) * (-427.191) (-424.826) [-423.695] (-427.996) -- 0:00:35
440000 -- [-424.112] (-427.183) (-430.548) (-426.032) * (-430.666) (-431.491) [-425.454] (-423.604) -- 0:00:35
Average standard deviation of split frequencies: 0.008424
440500 -- (-424.352) (-428.226) [-427.407] (-427.038) * (-425.294) (-428.696) (-426.876) [-427.729] -- 0:00:35
441000 -- [-426.301] (-426.668) (-426.269) (-424.490) * [-424.396] (-426.010) (-429.086) (-426.029) -- 0:00:35
441500 -- (-426.233) [-428.677] (-429.069) (-431.527) * (-424.853) [-426.513] (-425.211) (-425.497) -- 0:00:35
442000 -- (-428.052) [-427.516] (-427.179) (-427.969) * (-424.250) (-424.353) (-424.396) [-428.348] -- 0:00:35
442500 -- [-427.576] (-425.493) (-426.885) (-427.220) * [-424.984] (-426.339) (-426.202) (-427.058) -- 0:00:35
443000 -- (-426.706) [-424.838] (-426.398) (-426.211) * (-423.648) (-429.504) [-425.455] (-424.927) -- 0:00:35
443500 -- [-426.309] (-428.771) (-428.138) (-424.292) * (-425.102) [-430.171] (-425.812) (-431.143) -- 0:00:35
444000 -- (-424.481) (-429.352) (-424.561) [-424.983] * (-429.343) (-430.359) [-428.850] (-427.167) -- 0:00:35
444500 -- (-425.909) [-426.064] (-424.477) (-424.005) * [-428.262] (-432.014) (-426.127) (-435.671) -- 0:00:36
445000 -- [-425.086] (-426.372) (-428.558) (-430.244) * [-424.780] (-427.826) (-428.481) (-431.086) -- 0:00:36
Average standard deviation of split frequencies: 0.008324
445500 -- (-426.881) (-425.196) [-425.338] (-426.659) * (-426.520) (-425.086) [-427.983] (-426.857) -- 0:00:36
446000 -- (-424.054) (-425.647) [-426.487] (-424.592) * (-425.197) (-426.918) (-425.203) [-424.723] -- 0:00:36
446500 -- (-424.809) (-424.721) [-426.448] (-430.225) * (-426.643) [-424.300] (-426.864) (-424.174) -- 0:00:35
447000 -- (-423.922) (-426.335) (-425.998) [-423.724] * (-423.886) (-427.210) (-425.137) [-425.973] -- 0:00:35
447500 -- [-423.856] (-425.038) (-424.307) (-424.290) * (-427.248) (-425.849) (-427.451) [-426.996] -- 0:00:35
448000 -- (-424.145) [-424.602] (-423.602) (-424.860) * (-425.791) [-423.887] (-425.413) (-424.789) -- 0:00:35
448500 -- (-425.255) (-426.250) [-423.569] (-426.883) * [-425.512] (-425.263) (-424.027) (-428.045) -- 0:00:35
449000 -- [-426.837] (-427.679) (-424.193) (-428.581) * (-424.466) (-426.411) (-426.406) [-424.444] -- 0:00:35
449500 -- (-430.354) (-424.402) (-424.067) [-424.985] * (-423.760) (-429.325) [-425.577] (-429.928) -- 0:00:35
450000 -- [-424.197] (-424.755) (-427.986) (-425.596) * (-424.043) [-424.151] (-425.974) (-428.899) -- 0:00:35
Average standard deviation of split frequencies: 0.008499
450500 -- (-433.855) (-425.913) [-426.537] (-426.905) * (-425.982) (-429.761) (-426.876) [-428.209] -- 0:00:35
451000 -- [-425.287] (-427.456) (-424.603) (-427.830) * [-425.990] (-425.402) (-423.791) (-425.768) -- 0:00:35
451500 -- [-425.670] (-425.535) (-424.278) (-426.086) * (-425.553) (-428.265) [-425.778] (-426.623) -- 0:00:35
452000 -- (-425.463) (-424.696) [-428.079] (-425.669) * (-425.564) [-426.732] (-429.477) (-426.959) -- 0:00:35
452500 -- (-425.337) (-427.356) [-426.277] (-426.726) * (-430.247) (-424.886) [-425.309] (-424.320) -- 0:00:35
453000 -- [-425.032] (-432.151) (-425.394) (-426.625) * [-427.022] (-424.763) (-426.126) (-424.147) -- 0:00:35
453500 -- [-424.310] (-425.572) (-426.692) (-425.657) * [-425.050] (-424.702) (-426.311) (-427.721) -- 0:00:34
454000 -- (-423.938) [-425.158] (-429.184) (-424.204) * [-426.457] (-425.057) (-426.051) (-427.929) -- 0:00:34
454500 -- [-424.427] (-426.095) (-427.082) (-424.432) * (-425.949) [-424.659] (-424.905) (-427.165) -- 0:00:34
455000 -- (-427.770) (-428.593) [-426.031] (-424.408) * (-425.703) (-424.783) [-426.770] (-427.166) -- 0:00:34
Average standard deviation of split frequencies: 0.008658
455500 -- [-423.894] (-430.641) (-425.778) (-429.537) * [-424.619] (-426.175) (-429.315) (-429.433) -- 0:00:34
456000 -- (-427.998) (-426.385) (-426.986) [-427.461] * (-423.576) (-427.617) [-424.894] (-425.526) -- 0:00:34
456500 -- (-426.112) (-426.810) (-424.405) [-426.655] * (-426.051) (-426.421) [-430.414] (-426.591) -- 0:00:34
457000 -- (-429.241) (-424.910) [-424.462] (-427.810) * [-427.956] (-425.988) (-428.060) (-426.293) -- 0:00:34
457500 -- [-424.758] (-428.458) (-424.927) (-426.225) * (-427.021) (-427.575) [-432.474] (-425.537) -- 0:00:34
458000 -- (-423.720) [-426.321] (-426.370) (-426.707) * (-428.500) (-429.287) [-424.220] (-427.103) -- 0:00:34
458500 -- [-423.498] (-424.581) (-423.978) (-426.210) * (-427.628) (-425.098) [-424.737] (-423.812) -- 0:00:34
459000 -- (-423.964) (-428.499) (-424.802) [-430.609] * [-425.745] (-424.619) (-425.438) (-425.704) -- 0:00:34
459500 -- (-424.688) (-424.065) (-425.402) [-433.478] * (-424.107) [-429.875] (-425.877) (-425.473) -- 0:00:34
460000 -- (-426.094) (-426.868) (-425.316) [-429.095] * (-425.398) [-428.941] (-424.978) (-428.648) -- 0:00:35
Average standard deviation of split frequencies: 0.008186
460500 -- (-428.169) [-424.449] (-424.832) (-425.666) * [-425.346] (-425.592) (-425.993) (-429.730) -- 0:00:35
461000 -- (-425.250) (-423.996) (-425.661) [-423.859] * (-427.603) [-425.882] (-424.595) (-425.167) -- 0:00:35
461500 -- [-428.428] (-426.499) (-424.626) (-426.603) * (-426.369) (-424.674) (-424.881) [-425.327] -- 0:00:35
462000 -- (-428.913) [-426.480] (-426.413) (-424.748) * (-424.039) [-426.475] (-425.065) (-424.306) -- 0:00:34
462500 -- [-427.848] (-427.185) (-426.943) (-424.293) * (-424.157) (-425.207) [-425.021] (-423.844) -- 0:00:34
463000 -- (-426.414) [-424.503] (-429.093) (-425.817) * (-428.400) (-425.930) (-425.103) [-425.471] -- 0:00:34
463500 -- (-427.216) [-427.213] (-426.805) (-424.214) * [-430.483] (-426.410) (-429.891) (-424.021) -- 0:00:34
464000 -- (-434.806) (-427.621) (-423.888) [-423.456] * (-425.710) (-426.355) (-425.561) [-423.676] -- 0:00:34
464500 -- (-430.150) [-425.403] (-424.693) (-424.663) * (-425.931) [-427.979] (-428.227) (-424.183) -- 0:00:34
465000 -- (-429.220) (-425.280) (-424.276) [-427.003] * (-425.931) (-428.857) [-424.751] (-424.954) -- 0:00:34
Average standard deviation of split frequencies: 0.007650
465500 -- (-426.630) (-424.447) (-428.472) [-425.666] * (-424.792) (-426.944) (-424.067) [-427.267] -- 0:00:34
466000 -- (-426.632) (-424.299) [-426.044] (-424.139) * (-424.866) (-423.841) (-427.925) [-426.167] -- 0:00:34
466500 -- (-426.060) (-425.722) [-428.069] (-424.258) * (-425.663) [-424.307] (-425.868) (-424.132) -- 0:00:34
467000 -- (-433.147) [-423.755] (-425.157) (-425.400) * (-428.413) [-424.441] (-425.354) (-428.049) -- 0:00:34
467500 -- [-425.119] (-427.234) (-427.196) (-425.829) * (-426.637) [-427.422] (-424.483) (-424.078) -- 0:00:34
468000 -- [-425.984] (-424.187) (-426.578) (-424.868) * (-426.419) [-425.173] (-426.389) (-425.356) -- 0:00:34
468500 -- (-425.299) [-424.111] (-428.273) (-425.638) * (-429.037) [-424.408] (-427.145) (-427.728) -- 0:00:34
469000 -- (-427.713) (-428.772) (-426.637) [-430.883] * (-428.343) (-424.938) (-424.296) [-426.248] -- 0:00:33
469500 -- [-424.483] (-429.729) (-427.498) (-424.618) * (-427.184) [-424.205] (-425.693) (-426.712) -- 0:00:33
470000 -- (-424.444) (-429.871) (-426.203) [-427.361] * (-431.290) (-425.804) (-426.553) [-424.238] -- 0:00:33
Average standard deviation of split frequencies: 0.007887
470500 -- (-425.226) (-427.912) (-428.035) [-425.395] * (-425.177) (-425.766) (-427.153) [-424.590] -- 0:00:33
471000 -- (-430.076) (-427.990) [-424.713] (-424.634) * [-424.609] (-426.601) (-425.101) (-428.119) -- 0:00:33
471500 -- (-427.131) (-424.462) [-426.503] (-431.889) * (-427.082) [-425.634] (-430.159) (-427.367) -- 0:00:33
472000 -- (-425.315) (-430.253) [-426.307] (-429.741) * (-427.333) [-424.316] (-424.717) (-425.054) -- 0:00:33
472500 -- (-426.160) [-429.718] (-424.425) (-425.183) * [-427.815] (-426.036) (-424.387) (-425.596) -- 0:00:33
473000 -- (-430.165) [-427.217] (-426.155) (-429.319) * (-427.068) (-424.627) (-423.767) [-424.448] -- 0:00:33
473500 -- [-426.170] (-426.620) (-426.452) (-425.912) * (-426.259) [-423.787] (-425.861) (-428.670) -- 0:00:33
474000 -- (-425.788) (-426.991) (-426.410) [-426.421] * [-423.921] (-423.735) (-425.649) (-426.224) -- 0:00:33
474500 -- (-424.419) (-428.901) [-428.099] (-425.621) * [-425.254] (-424.403) (-424.244) (-426.006) -- 0:00:33
475000 -- (-425.535) (-425.838) (-427.669) [-423.663] * [-425.109] (-426.235) (-428.061) (-424.238) -- 0:00:33
Average standard deviation of split frequencies: 0.008294
475500 -- [-427.512] (-426.283) (-428.684) (-424.066) * [-427.239] (-426.087) (-425.749) (-426.514) -- 0:00:33
476000 -- (-425.660) (-424.266) (-427.777) [-428.288] * [-424.376] (-427.173) (-424.908) (-427.011) -- 0:00:33
476500 -- (-425.840) (-426.131) (-425.914) [-424.328] * (-423.880) (-431.155) [-426.311] (-424.298) -- 0:00:32
477000 -- (-424.063) (-426.017) [-428.147] (-424.776) * (-424.412) (-424.746) (-426.970) [-424.557] -- 0:00:33
477500 -- [-424.229] (-426.481) (-425.545) (-423.488) * (-426.105) [-423.875] (-426.994) (-424.805) -- 0:00:33
478000 -- [-424.638] (-425.145) (-425.803) (-425.848) * (-425.207) (-424.056) [-424.748] (-426.359) -- 0:00:33
478500 -- [-425.887] (-424.874) (-425.165) (-424.151) * [-425.155] (-423.743) (-426.151) (-426.711) -- 0:00:33
479000 -- (-429.513) (-426.094) (-424.733) [-424.420] * (-426.174) (-423.909) [-425.761] (-429.573) -- 0:00:33
479500 -- [-425.616] (-425.213) (-425.831) (-423.907) * (-425.350) (-425.525) [-426.643] (-425.316) -- 0:00:33
480000 -- (-426.766) (-426.127) (-426.261) [-424.504] * (-428.113) (-425.753) (-427.574) [-430.211] -- 0:00:33
Average standard deviation of split frequencies: 0.007417
480500 -- (-427.525) (-423.740) (-425.206) [-425.609] * (-426.064) [-425.478] (-424.747) (-426.905) -- 0:00:33
481000 -- (-425.625) (-423.981) [-424.886] (-426.329) * (-427.522) [-425.418] (-425.438) (-424.953) -- 0:00:33
481500 -- (-425.291) (-425.652) (-428.945) [-427.375] * [-424.285] (-425.507) (-424.070) (-426.275) -- 0:00:33
482000 -- (-424.169) (-425.539) [-425.300] (-428.583) * [-425.889] (-434.486) (-425.337) (-425.619) -- 0:00:33
482500 -- (-424.627) (-426.184) (-427.070) [-427.761] * (-430.768) (-426.486) (-425.806) [-424.813] -- 0:00:33
483000 -- [-424.567] (-424.678) (-423.613) (-424.671) * (-424.527) (-428.329) (-423.872) [-425.496] -- 0:00:33
483500 -- (-429.772) (-425.999) [-425.019] (-426.541) * (-426.341) (-425.287) [-423.472] (-425.322) -- 0:00:33
484000 -- (-424.897) [-424.603] (-424.776) (-427.181) * (-428.589) (-428.458) (-432.671) [-425.639] -- 0:00:33
484500 -- (-423.919) (-426.611) (-424.088) [-429.865] * (-425.987) (-431.297) [-426.779] (-426.085) -- 0:00:32
485000 -- (-427.609) (-425.184) [-424.954] (-423.758) * (-424.109) (-429.339) [-425.167] (-425.156) -- 0:00:32
Average standard deviation of split frequencies: 0.006911
485500 -- [-424.810] (-424.534) (-430.951) (-426.721) * (-425.003) (-427.753) [-427.249] (-425.075) -- 0:00:32
486000 -- [-425.767] (-426.558) (-425.564) (-426.441) * (-428.678) [-426.828] (-426.317) (-428.137) -- 0:00:32
486500 -- (-427.076) [-426.325] (-425.361) (-425.827) * (-428.771) (-425.307) [-425.494] (-429.053) -- 0:00:32
487000 -- (-426.755) (-426.169) [-424.159] (-425.932) * (-426.320) (-425.388) (-424.870) [-426.983] -- 0:00:32
487500 -- (-425.589) (-424.569) (-425.707) [-427.155] * (-428.610) (-425.196) [-425.744] (-425.118) -- 0:00:32
488000 -- (-426.223) (-428.239) [-426.249] (-426.449) * (-429.008) [-427.344] (-429.373) (-424.114) -- 0:00:32
488500 -- (-428.237) (-428.095) (-423.973) [-426.414] * (-424.375) (-423.676) (-429.139) [-424.795] -- 0:00:32
489000 -- (-427.823) (-428.744) [-425.207] (-424.947) * (-425.105) (-423.735) [-426.520] (-427.938) -- 0:00:32
489500 -- [-424.889] (-425.456) (-425.104) (-424.723) * (-427.947) [-424.516] (-428.238) (-431.121) -- 0:00:32
490000 -- (-426.634) (-430.124) (-427.817) [-425.598] * (-427.284) [-424.168] (-424.679) (-427.283) -- 0:00:32
Average standard deviation of split frequencies: 0.007085
490500 -- [-429.501] (-426.242) (-426.592) (-425.964) * (-425.226) (-424.525) [-424.418] (-424.546) -- 0:00:32
491000 -- (-430.333) (-424.649) (-428.599) [-424.924] * (-424.082) [-427.983] (-425.197) (-425.722) -- 0:00:32
491500 -- (-425.865) [-425.574] (-427.343) (-427.618) * (-426.062) (-424.601) (-424.952) [-423.779] -- 0:00:32
492000 -- [-425.810] (-425.960) (-426.139) (-424.215) * (-425.749) (-426.876) [-424.512] (-424.171) -- 0:00:32
492500 -- (-423.787) [-426.114] (-425.655) (-424.006) * [-427.842] (-424.980) (-425.508) (-429.242) -- 0:00:31
493000 -- (-425.764) [-429.343] (-425.107) (-430.418) * (-425.395) (-424.262) [-426.644] (-430.320) -- 0:00:32
493500 -- (-428.664) (-427.218) (-424.648) [-426.748] * [-426.043] (-425.585) (-425.419) (-428.079) -- 0:00:32
494000 -- (-426.609) [-427.831] (-425.009) (-427.177) * (-424.636) [-424.140] (-427.231) (-426.131) -- 0:00:32
494500 -- [-425.223] (-425.230) (-426.236) (-424.380) * [-423.977] (-427.915) (-423.955) (-426.296) -- 0:00:32
495000 -- [-424.477] (-424.376) (-425.142) (-427.608) * (-424.797) (-425.090) [-425.056] (-428.173) -- 0:00:32
Average standard deviation of split frequencies: 0.007247
495500 -- (-429.665) (-423.968) [-424.306] (-425.273) * (-424.572) (-425.555) (-424.147) [-425.952] -- 0:00:32
496000 -- (-430.441) [-425.711] (-426.456) (-424.977) * (-424.040) [-428.894] (-424.155) (-425.878) -- 0:00:32
496500 -- (-425.541) (-425.339) (-426.137) [-423.748] * (-425.058) [-425.668] (-425.735) (-423.950) -- 0:00:32
497000 -- (-426.484) [-423.832] (-426.604) (-428.163) * (-424.042) [-425.704] (-427.235) (-429.854) -- 0:00:32
497500 -- (-427.551) [-425.192] (-428.074) (-426.681) * (-424.165) (-426.809) [-425.570] (-428.101) -- 0:00:32
498000 -- (-425.871) (-425.333) [-425.618] (-426.346) * (-426.206) (-425.166) [-424.514] (-424.794) -- 0:00:32
498500 -- (-424.539) (-423.945) [-427.921] (-427.313) * (-428.161) [-425.389] (-425.601) (-424.902) -- 0:00:32
499000 -- [-424.291] (-425.488) (-425.210) (-428.165) * [-428.873] (-429.200) (-425.063) (-426.548) -- 0:00:32
499500 -- (-431.698) [-426.267] (-426.116) (-426.526) * (-425.131) (-425.595) (-425.225) [-423.866] -- 0:00:32
500000 -- (-428.411) (-423.962) [-427.515] (-428.107) * (-427.239) (-427.603) (-427.480) [-423.746] -- 0:00:32
Average standard deviation of split frequencies: 0.007179
500500 -- [-424.787] (-425.306) (-428.754) (-424.686) * (-425.383) [-425.944] (-426.433) (-424.735) -- 0:00:31
501000 -- [-426.026] (-425.606) (-425.160) (-425.223) * (-425.844) (-426.011) [-426.843] (-425.966) -- 0:00:31
501500 -- (-428.846) [-426.742] (-424.931) (-426.769) * (-425.359) (-430.848) (-426.747) [-424.369] -- 0:00:31
502000 -- (-427.741) (-426.399) [-425.037] (-424.022) * [-426.017] (-428.067) (-426.982) (-425.047) -- 0:00:31
502500 -- [-429.994] (-426.846) (-425.616) (-425.952) * (-425.974) (-424.706) (-424.747) [-424.927] -- 0:00:31
503000 -- (-427.560) (-424.684) [-428.980] (-428.291) * (-426.417) (-426.813) [-426.310] (-426.915) -- 0:00:31
503500 -- (-424.993) (-430.903) [-425.576] (-424.033) * (-426.386) (-427.313) (-428.857) [-424.501] -- 0:00:31
504000 -- (-426.371) (-430.446) [-425.233] (-424.112) * (-424.100) [-426.301] (-426.378) (-423.776) -- 0:00:31
504500 -- (-425.643) (-429.663) (-427.933) [-427.098] * [-423.821] (-423.607) (-426.609) (-425.821) -- 0:00:31
505000 -- [-424.661] (-427.086) (-427.297) (-426.125) * (-427.178) [-424.081] (-430.796) (-428.571) -- 0:00:31
Average standard deviation of split frequencies: 0.008111
505500 -- (-427.777) [-428.724] (-424.973) (-429.711) * (-427.554) [-427.455] (-426.969) (-427.196) -- 0:00:31
506000 -- (-425.073) [-428.586] (-426.187) (-428.568) * (-425.454) [-427.819] (-425.107) (-424.394) -- 0:00:31
506500 -- (-428.937) [-429.509] (-424.454) (-428.326) * [-425.440] (-423.725) (-423.799) (-427.254) -- 0:00:31
507000 -- (-427.904) (-425.235) [-424.258] (-426.836) * (-428.361) [-425.040] (-427.340) (-425.632) -- 0:00:31
507500 -- [-426.144] (-426.244) (-423.985) (-430.975) * (-430.238) (-424.140) [-425.872] (-425.757) -- 0:00:31
508000 -- (-426.109) (-427.393) (-423.432) [-426.957] * (-429.520) (-426.785) (-427.150) [-424.408] -- 0:00:31
508500 -- (-428.225) (-426.053) (-426.050) [-427.454] * [-427.721] (-428.528) (-425.143) (-425.993) -- 0:00:31
509000 -- [-427.503] (-430.408) (-424.662) (-427.130) * (-427.090) [-425.692] (-426.713) (-429.230) -- 0:00:31
509500 -- (-427.193) [-424.341] (-429.442) (-423.406) * (-425.534) [-423.752] (-426.089) (-426.686) -- 0:00:31
510000 -- (-428.048) (-424.149) (-426.146) [-423.660] * (-426.018) (-425.034) [-424.720] (-425.061) -- 0:00:31
Average standard deviation of split frequencies: 0.007819
510500 -- (-424.574) (-424.298) [-427.145] (-427.037) * (-426.290) (-428.211) (-428.104) [-424.290] -- 0:00:31
511000 -- (-427.634) (-424.759) (-424.954) [-425.848] * (-426.093) (-428.558) (-426.048) [-426.306] -- 0:00:31
511500 -- [-426.631] (-426.162) (-424.289) (-425.768) * (-425.219) (-424.138) (-426.777) [-424.813] -- 0:00:31
512000 -- (-424.796) (-424.723) [-424.927] (-430.999) * (-426.864) (-425.424) (-427.630) [-426.222] -- 0:00:31
512500 -- (-427.826) [-425.365] (-424.941) (-428.768) * (-425.690) (-424.318) [-425.887] (-427.854) -- 0:00:31
513000 -- (-425.159) (-429.676) (-425.295) [-424.742] * (-427.895) [-424.254] (-427.895) (-424.173) -- 0:00:31
513500 -- (-425.455) [-423.994] (-426.204) (-426.325) * (-429.492) [-424.506] (-424.530) (-423.961) -- 0:00:31
514000 -- (-435.676) (-424.561) (-425.821) [-424.247] * [-425.761] (-423.963) (-426.369) (-425.037) -- 0:00:31
514500 -- [-434.629] (-426.034) (-426.735) (-425.988) * (-425.837) [-423.924] (-430.512) (-425.400) -- 0:00:31
515000 -- [-427.936] (-429.570) (-426.073) (-426.078) * [-425.210] (-424.535) (-424.666) (-426.956) -- 0:00:31
Average standard deviation of split frequencies: 0.008760
515500 -- [-425.674] (-427.100) (-430.041) (-425.199) * (-425.106) (-426.821) (-424.430) [-423.782] -- 0:00:31
516000 -- (-428.237) (-424.906) [-428.096] (-426.839) * (-426.207) (-424.307) (-424.934) [-427.768] -- 0:00:30
516500 -- (-426.574) (-424.260) (-423.875) [-425.892] * (-427.907) (-426.345) (-427.663) [-427.395] -- 0:00:30
517000 -- (-424.351) (-425.463) (-424.085) [-428.507] * (-426.267) (-425.324) [-426.043] (-426.981) -- 0:00:30
517500 -- (-424.993) (-426.260) (-428.624) [-425.357] * (-424.114) (-425.280) [-425.816] (-425.235) -- 0:00:31
518000 -- [-427.709] (-426.124) (-423.634) (-427.926) * [-425.493] (-426.809) (-425.532) (-426.926) -- 0:00:31
518500 -- (-425.621) [-424.486] (-424.958) (-424.374) * (-425.944) (-426.264) (-425.639) [-424.993] -- 0:00:31
519000 -- (-426.066) (-426.262) (-425.928) [-424.095] * (-426.183) (-424.847) (-424.011) [-425.342] -- 0:00:31
519500 -- (-425.921) (-423.780) [-426.229] (-423.780) * (-426.251) (-425.941) (-424.739) [-424.453] -- 0:00:31
520000 -- (-427.756) (-430.722) [-424.601] (-426.664) * (-424.788) (-426.178) (-425.607) [-424.343] -- 0:00:31
Average standard deviation of split frequencies: 0.008947
520500 -- (-426.300) [-423.431] (-430.842) (-429.216) * (-425.816) [-424.743] (-424.398) (-434.482) -- 0:00:31
521000 -- (-426.064) (-423.421) [-423.709] (-429.064) * (-425.800) (-424.733) [-426.929] (-426.392) -- 0:00:31
521500 -- (-424.173) (-425.662) (-423.534) [-430.282] * (-425.939) (-425.010) (-425.203) [-425.558] -- 0:00:31
522000 -- (-424.851) (-426.764) (-423.975) [-429.544] * [-427.530] (-425.405) (-426.154) (-428.850) -- 0:00:31
522500 -- (-427.650) (-424.728) [-423.434] (-426.839) * [-423.663] (-424.676) (-428.070) (-427.963) -- 0:00:31
523000 -- (-425.898) [-424.683] (-427.685) (-427.107) * (-424.722) [-424.208] (-427.947) (-426.873) -- 0:00:31
523500 -- [-423.881] (-430.915) (-428.390) (-424.354) * (-425.858) [-427.168] (-425.927) (-425.082) -- 0:00:30
524000 -- (-423.587) (-425.984) (-426.183) [-424.834] * (-426.415) [-427.268] (-427.403) (-430.731) -- 0:00:30
524500 -- (-425.850) [-425.034] (-425.641) (-427.862) * (-426.710) (-425.900) [-425.317] (-428.303) -- 0:00:30
525000 -- (-425.318) [-426.426] (-426.896) (-426.560) * (-426.267) (-426.381) (-425.909) [-426.285] -- 0:00:30
Average standard deviation of split frequencies: 0.009067
525500 -- (-431.139) (-425.366) (-426.811) [-425.273] * [-426.082] (-426.255) (-427.555) (-425.842) -- 0:00:30
526000 -- (-424.422) (-427.055) (-426.454) [-424.205] * (-425.895) (-426.134) (-427.495) [-425.041] -- 0:00:30
526500 -- (-427.932) (-426.562) [-424.253] (-426.014) * (-432.831) (-424.872) [-426.069] (-426.483) -- 0:00:30
527000 -- (-424.690) [-424.292] (-424.970) (-429.018) * (-430.621) [-426.044] (-431.150) (-426.868) -- 0:00:30
527500 -- (-425.939) [-424.053] (-426.004) (-426.725) * (-425.694) (-427.662) [-424.826] (-429.437) -- 0:00:30
528000 -- (-425.437) (-425.333) [-427.636] (-424.195) * (-428.146) (-425.083) (-424.899) [-424.556] -- 0:00:30
528500 -- (-425.422) (-424.474) [-425.067] (-425.229) * [-424.872] (-426.238) (-425.894) (-426.647) -- 0:00:30
529000 -- (-426.989) (-425.144) [-425.323] (-426.639) * (-429.808) (-424.234) [-428.525] (-425.661) -- 0:00:30
529500 -- (-426.351) (-427.089) [-424.870] (-427.482) * (-426.846) [-423.784] (-428.471) (-425.602) -- 0:00:30
530000 -- (-424.939) [-424.742] (-425.819) (-428.785) * (-425.325) (-425.177) [-427.285] (-426.072) -- 0:00:30
Average standard deviation of split frequencies: 0.008413
530500 -- (-424.055) [-423.857] (-425.165) (-425.202) * [-427.635] (-425.030) (-424.137) (-425.822) -- 0:00:30
531000 -- (-432.480) (-425.889) [-425.387] (-428.002) * (-427.598) [-425.301] (-424.161) (-432.166) -- 0:00:30
531500 -- (-425.546) (-423.819) (-425.897) [-426.735] * [-428.116] (-424.160) (-426.380) (-424.507) -- 0:00:29
532000 -- (-427.900) [-425.084] (-425.044) (-425.304) * (-426.505) (-426.611) (-426.229) [-425.510] -- 0:00:29
532500 -- (-428.588) [-427.063] (-425.896) (-425.280) * (-424.221) (-426.610) [-426.168] (-424.554) -- 0:00:29
533000 -- (-424.543) (-428.429) (-424.422) [-425.684] * [-424.732] (-425.542) (-424.367) (-428.393) -- 0:00:29
533500 -- (-425.157) (-428.474) [-423.950] (-424.519) * (-426.100) (-425.447) [-424.143] (-427.294) -- 0:00:30
534000 -- [-426.319] (-423.440) (-425.171) (-424.031) * (-425.150) (-425.005) (-425.353) [-427.751] -- 0:00:30
534500 -- (-426.762) [-424.787] (-424.626) (-423.584) * (-425.743) [-425.735] (-427.224) (-425.518) -- 0:00:30
535000 -- [-427.170] (-425.036) (-427.330) (-423.732) * (-428.853) [-425.821] (-428.162) (-427.522) -- 0:00:30
Average standard deviation of split frequencies: 0.008640
535500 -- (-424.979) [-424.927] (-427.732) (-429.558) * (-430.839) (-427.701) [-424.287] (-425.742) -- 0:00:30
536000 -- [-425.384] (-423.753) (-429.158) (-429.751) * (-428.187) (-425.454) [-425.031] (-424.279) -- 0:00:30
536500 -- (-426.217) [-425.488] (-424.614) (-424.010) * (-431.018) (-424.722) (-426.613) [-424.100] -- 0:00:30
537000 -- (-429.615) [-423.814] (-424.622) (-424.047) * (-427.382) (-429.885) (-427.162) [-426.249] -- 0:00:30
537500 -- [-428.630] (-425.447) (-424.389) (-425.395) * (-425.009) (-425.121) (-427.785) [-425.506] -- 0:00:30
538000 -- [-424.743] (-424.185) (-424.422) (-423.799) * (-430.089) (-424.650) (-425.371) [-424.046] -- 0:00:30
538500 -- (-425.648) (-425.064) [-424.187] (-424.491) * [-428.804] (-428.161) (-424.691) (-424.311) -- 0:00:29
539000 -- (-426.285) (-427.158) [-424.692] (-423.917) * (-428.690) (-424.325) (-425.984) [-430.993] -- 0:00:29
539500 -- [-424.369] (-427.743) (-426.528) (-424.412) * (-423.673) (-425.030) (-424.287) [-429.164] -- 0:00:29
540000 -- (-423.908) (-427.995) (-423.762) [-426.802] * [-424.138] (-424.305) (-426.181) (-429.103) -- 0:00:29
Average standard deviation of split frequencies: 0.008463
540500 -- (-429.422) (-431.436) (-426.673) [-424.200] * (-424.478) (-426.463) (-426.508) [-424.898] -- 0:00:29
541000 -- (-425.561) (-431.918) [-426.015] (-424.496) * (-425.248) [-424.654] (-432.054) (-428.297) -- 0:00:29
541500 -- (-426.937) (-429.582) [-425.730] (-424.558) * (-424.786) (-428.406) (-424.275) [-425.345] -- 0:00:29
542000 -- (-424.545) (-425.607) (-426.617) [-425.622] * (-425.703) (-424.742) (-425.893) [-430.757] -- 0:00:29
542500 -- (-423.800) (-424.905) (-423.564) [-424.887] * (-426.133) [-425.141] (-433.442) (-425.001) -- 0:00:29
543000 -- (-428.754) (-427.496) (-424.932) [-425.391] * [-426.400] (-429.978) (-424.979) (-429.328) -- 0:00:29
543500 -- (-426.837) (-428.796) (-425.809) [-424.368] * (-426.247) (-426.292) (-430.433) [-425.809] -- 0:00:29
544000 -- (-433.529) (-424.354) [-425.193] (-426.160) * (-425.868) (-431.838) [-427.241] (-424.211) -- 0:00:29
544500 -- (-428.729) (-425.784) [-425.178] (-427.571) * (-427.698) [-426.657] (-425.598) (-426.451) -- 0:00:29
545000 -- (-426.230) [-426.042] (-428.559) (-428.888) * [-424.945] (-424.385) (-425.539) (-424.613) -- 0:00:29
Average standard deviation of split frequencies: 0.008177
545500 -- (-425.969) [-424.753] (-430.020) (-425.104) * (-424.544) [-425.286] (-426.958) (-424.467) -- 0:00:29
546000 -- (-425.864) [-426.577] (-427.095) (-425.510) * (-428.186) (-425.797) (-423.802) [-426.880] -- 0:00:29
546500 -- (-425.649) (-426.605) (-424.726) [-425.822] * (-425.465) (-427.052) [-424.610] (-427.978) -- 0:00:29
547000 -- [-426.492] (-424.232) (-425.564) (-427.501) * [-425.726] (-423.844) (-424.638) (-424.734) -- 0:00:28
547500 -- (-424.802) (-428.866) (-427.748) [-424.886] * (-426.154) (-426.264) [-425.267] (-426.626) -- 0:00:28
548000 -- (-428.541) (-427.164) [-424.397] (-424.555) * (-425.030) (-428.668) (-424.070) [-425.022] -- 0:00:28
548500 -- [-424.304] (-423.903) (-424.642) (-427.028) * (-432.425) (-426.129) (-424.176) [-424.864] -- 0:00:28
549000 -- (-426.666) [-425.122] (-425.273) (-427.182) * (-425.427) [-425.436] (-423.595) (-426.084) -- 0:00:28
549500 -- (-424.690) [-424.970] (-425.653) (-427.503) * [-426.394] (-425.509) (-424.632) (-424.015) -- 0:00:28
550000 -- (-430.109) [-424.534] (-425.902) (-425.924) * (-426.013) [-425.477] (-424.474) (-424.534) -- 0:00:28
Average standard deviation of split frequencies: 0.008611
550500 -- (-425.689) [-424.309] (-428.262) (-426.664) * (-426.162) (-424.575) (-423.435) [-424.901] -- 0:00:29
551000 -- [-427.325] (-425.518) (-425.074) (-429.025) * (-428.482) [-424.673] (-425.642) (-426.334) -- 0:00:29
551500 -- (-426.870) (-426.428) [-424.653] (-423.802) * [-425.508] (-426.817) (-425.623) (-426.236) -- 0:00:29
552000 -- (-424.958) (-425.988) (-425.417) [-423.765] * (-424.587) (-427.344) [-423.550] (-428.173) -- 0:00:29
552500 -- (-430.337) (-426.346) (-424.766) [-424.476] * (-424.216) (-429.855) (-428.851) [-425.956] -- 0:00:29
553000 -- (-427.021) [-424.743] (-428.854) (-424.175) * [-424.508] (-426.374) (-429.332) (-427.436) -- 0:00:29
553500 -- [-427.563] (-426.051) (-427.460) (-424.673) * (-424.880) [-427.953] (-424.885) (-426.102) -- 0:00:29
554000 -- (-427.627) [-425.504] (-427.288) (-424.281) * (-425.351) (-424.258) (-424.981) [-425.815] -- 0:00:28
554500 -- (-426.312) [-427.652] (-429.013) (-425.849) * (-429.753) (-424.081) [-425.866] (-424.725) -- 0:00:28
555000 -- (-425.168) (-426.669) (-424.687) [-427.018] * [-425.186] (-425.521) (-425.913) (-428.419) -- 0:00:28
Average standard deviation of split frequencies: 0.007737
555500 -- [-427.080] (-428.041) (-424.065) (-424.216) * [-425.293] (-424.760) (-431.813) (-426.047) -- 0:00:28
556000 -- (-427.297) (-428.031) [-424.130] (-427.380) * (-425.724) [-427.395] (-425.398) (-428.019) -- 0:00:28
556500 -- (-427.694) (-425.245) [-424.302] (-429.561) * (-424.859) [-424.023] (-426.103) (-427.136) -- 0:00:28
557000 -- (-424.774) (-426.490) [-424.814] (-425.188) * (-425.598) (-428.277) (-426.575) [-426.544] -- 0:00:28
557500 -- (-424.936) (-426.430) (-424.098) [-424.873] * (-424.140) (-423.938) [-426.046] (-433.269) -- 0:00:28
558000 -- [-426.491] (-428.050) (-426.042) (-425.181) * [-425.928] (-435.424) (-423.901) (-432.838) -- 0:00:28
558500 -- (-427.871) (-423.898) (-424.493) [-424.518] * (-428.302) (-430.383) [-424.495] (-428.229) -- 0:00:28
559000 -- (-426.373) [-427.115] (-423.529) (-425.537) * (-423.874) (-426.380) [-425.350] (-430.459) -- 0:00:28
559500 -- (-424.584) [-426.238] (-423.636) (-424.734) * (-426.211) (-426.903) [-425.400] (-427.211) -- 0:00:28
560000 -- [-427.952] (-426.741) (-425.018) (-429.122) * [-427.097] (-428.471) (-425.954) (-425.285) -- 0:00:28
Average standard deviation of split frequencies: 0.007725
560500 -- (-426.246) [-427.266] (-424.114) (-428.393) * (-426.841) [-426.329] (-426.423) (-427.358) -- 0:00:28
561000 -- (-426.330) [-425.782] (-424.454) (-426.524) * [-429.052] (-426.374) (-424.706) (-426.887) -- 0:00:28
561500 -- (-429.055) (-424.323) (-426.780) [-426.340] * (-424.813) (-426.448) (-424.331) [-426.670] -- 0:00:28
562000 -- (-427.047) (-431.896) (-426.115) [-424.069] * (-425.887) (-425.661) [-424.100] (-424.954) -- 0:00:28
562500 -- (-425.395) (-424.704) (-427.535) [-424.933] * (-426.797) [-425.699] (-424.514) (-424.385) -- 0:00:28
563000 -- (-424.065) (-424.313) (-424.541) [-423.655] * [-425.112] (-425.503) (-424.715) (-424.197) -- 0:00:27
563500 -- (-425.387) (-428.312) (-426.500) [-423.367] * (-425.385) [-426.574] (-424.399) (-427.106) -- 0:00:27
564000 -- (-425.804) [-426.957] (-427.361) (-426.687) * (-426.182) (-427.206) (-426.914) [-425.645] -- 0:00:27
564500 -- [-425.301] (-428.663) (-428.667) (-426.569) * (-424.815) (-426.464) (-425.511) [-428.127] -- 0:00:27
565000 -- (-424.572) (-424.773) [-429.209] (-425.707) * (-425.317) [-426.020] (-423.698) (-424.732) -- 0:00:27
Average standard deviation of split frequencies: 0.008427
565500 -- (-426.263) (-425.151) (-425.028) [-430.772] * [-425.054] (-428.282) (-426.197) (-428.068) -- 0:00:27
566000 -- [-424.842] (-425.512) (-426.198) (-427.064) * (-426.360) (-426.147) [-426.355] (-424.844) -- 0:00:27
566500 -- (-425.816) (-424.517) [-427.651] (-425.895) * (-425.579) (-425.535) (-424.334) [-424.637] -- 0:00:27
567000 -- [-423.953] (-425.567) (-426.050) (-424.460) * (-426.506) (-426.887) (-424.553) [-424.106] -- 0:00:27
567500 -- (-424.323) [-427.675] (-426.048) (-424.126) * [-426.781] (-430.040) (-426.590) (-424.571) -- 0:00:27
568000 -- (-429.581) [-427.886] (-424.262) (-426.224) * (-425.060) [-423.382] (-429.222) (-424.002) -- 0:00:28
568500 -- (-427.533) [-430.319] (-424.313) (-427.005) * [-426.056] (-424.210) (-426.256) (-425.607) -- 0:00:28
569000 -- (-426.312) [-427.669] (-424.181) (-425.826) * (-424.915) (-426.938) (-424.966) [-428.094] -- 0:00:28
569500 -- (-424.245) (-425.513) [-424.417] (-424.451) * (-426.974) (-426.440) (-424.515) [-425.304] -- 0:00:27
570000 -- (-425.829) (-424.537) [-426.754] (-428.459) * [-426.540] (-425.151) (-429.896) (-425.683) -- 0:00:27
Average standard deviation of split frequencies: 0.008212
570500 -- (-430.703) [-426.684] (-425.841) (-430.180) * (-426.487) [-426.957] (-426.192) (-424.797) -- 0:00:27
571000 -- (-426.649) [-424.640] (-424.098) (-426.588) * [-426.750] (-424.110) (-425.651) (-425.568) -- 0:00:27
571500 -- (-424.035) (-428.222) (-423.590) [-427.646] * (-426.418) (-424.934) [-423.669] (-426.546) -- 0:00:27
572000 -- (-426.963) (-425.022) (-424.523) [-426.724] * (-425.535) [-424.410] (-424.235) (-426.397) -- 0:00:27
572500 -- (-426.593) (-424.800) [-423.974] (-425.261) * (-425.480) (-424.155) [-427.111] (-425.841) -- 0:00:27
573000 -- [-426.177] (-424.872) (-425.130) (-424.943) * (-423.991) (-425.835) [-424.178] (-424.548) -- 0:00:27
573500 -- (-425.879) (-424.709) (-425.394) [-423.839] * (-425.880) (-424.973) [-426.030] (-427.851) -- 0:00:27
574000 -- (-426.197) [-425.092] (-425.447) (-425.356) * (-426.241) [-426.688] (-426.838) (-427.102) -- 0:00:27
574500 -- (-426.062) (-425.740) (-427.601) [-424.450] * [-427.486] (-427.005) (-425.984) (-427.427) -- 0:00:27
575000 -- (-427.429) (-425.140) (-423.548) [-426.310] * (-428.443) [-427.619] (-426.908) (-424.695) -- 0:00:27
Average standard deviation of split frequencies: 0.007417
575500 -- (-430.143) (-427.917) [-426.325] (-424.214) * (-425.749) [-424.425] (-424.685) (-425.858) -- 0:00:27
576000 -- (-428.497) (-426.568) [-424.579] (-423.722) * [-426.408] (-425.680) (-427.648) (-425.352) -- 0:00:27
576500 -- (-428.644) [-425.550] (-424.442) (-425.288) * (-424.798) [-424.702] (-425.696) (-426.836) -- 0:00:27
577000 -- (-424.475) [-428.140] (-429.468) (-425.104) * (-424.126) (-424.224) [-423.779] (-425.463) -- 0:00:27
577500 -- (-424.748) (-424.615) (-426.643) [-426.365] * [-424.626] (-425.364) (-425.840) (-427.016) -- 0:00:27
578000 -- (-427.669) [-426.639] (-429.290) (-426.952) * (-425.634) [-425.339] (-426.917) (-426.946) -- 0:00:27
578500 -- (-427.850) (-425.600) (-426.427) [-424.364] * [-426.512] (-425.203) (-424.377) (-432.888) -- 0:00:26
579000 -- (-423.842) [-426.293] (-424.779) (-424.852) * (-429.694) (-427.064) [-424.237] (-428.778) -- 0:00:26
579500 -- (-425.737) [-426.156] (-425.406) (-424.289) * (-426.489) [-423.629] (-428.752) (-428.555) -- 0:00:26
580000 -- (-425.579) (-428.580) (-428.662) [-426.571] * (-427.552) [-423.627] (-427.162) (-427.839) -- 0:00:26
Average standard deviation of split frequencies: 0.006850
580500 -- (-427.985) [-424.497] (-426.203) (-425.562) * (-426.967) (-425.814) [-427.331] (-426.342) -- 0:00:26
581000 -- (-428.757) (-425.167) [-426.842] (-426.135) * (-424.509) (-427.280) (-425.390) [-427.792] -- 0:00:26
581500 -- [-426.007] (-425.206) (-424.593) (-425.211) * (-428.878) (-424.985) (-427.168) [-427.720] -- 0:00:26
582000 -- (-428.228) [-424.308] (-424.781) (-427.298) * [-425.451] (-427.361) (-428.362) (-424.166) -- 0:00:26
582500 -- [-429.716] (-426.777) (-425.958) (-427.686) * (-424.261) [-425.764] (-425.507) (-424.011) -- 0:00:26
583000 -- (-425.416) (-426.324) [-425.737] (-427.695) * [-425.643] (-426.854) (-425.852) (-424.846) -- 0:00:26
583500 -- (-425.167) [-427.044] (-426.022) (-424.998) * (-425.578) (-425.706) (-426.279) [-424.496] -- 0:00:26
584000 -- [-424.397] (-426.963) (-425.369) (-424.732) * (-428.266) (-428.901) (-428.384) [-423.909] -- 0:00:26
584500 -- (-423.826) (-424.698) [-423.975] (-424.386) * [-426.863] (-429.154) (-426.930) (-424.916) -- 0:00:26
585000 -- [-423.957] (-424.614) (-428.636) (-425.337) * [-426.408] (-424.844) (-425.825) (-426.178) -- 0:00:26
Average standard deviation of split frequencies: 0.006385
585500 -- (-425.286) (-424.850) [-424.597] (-428.411) * (-424.321) (-428.066) (-425.182) [-425.407] -- 0:00:26
586000 -- (-427.863) [-425.022] (-428.002) (-428.652) * (-426.153) [-427.155] (-426.358) (-428.437) -- 0:00:26
586500 -- (-430.100) [-427.305] (-426.512) (-428.716) * (-424.690) (-426.958) [-424.522] (-426.027) -- 0:00:26
587000 -- (-426.153) (-426.565) [-424.802] (-425.919) * (-424.143) [-425.483] (-427.491) (-425.019) -- 0:00:26
587500 -- (-425.161) [-425.370] (-427.116) (-429.426) * (-425.285) (-428.034) [-425.543] (-426.272) -- 0:00:26
588000 -- [-423.882] (-424.780) (-429.421) (-431.306) * (-428.145) (-424.620) (-425.571) [-426.357] -- 0:00:26
588500 -- (-425.331) [-423.842] (-427.835) (-426.329) * (-426.457) (-425.499) [-425.561] (-426.621) -- 0:00:26
589000 -- (-425.634) [-425.255] (-426.881) (-426.594) * (-428.266) (-425.910) (-425.294) [-424.402] -- 0:00:26
589500 -- [-425.254] (-425.576) (-424.726) (-424.629) * (-424.114) [-427.879] (-425.721) (-424.680) -- 0:00:26
590000 -- (-426.179) (-423.605) [-426.029] (-426.358) * (-425.616) [-424.068] (-425.080) (-432.052) -- 0:00:26
Average standard deviation of split frequencies: 0.005637
590500 -- (-424.656) (-423.979) (-429.724) [-424.652] * (-427.414) [-426.707] (-426.034) (-425.735) -- 0:00:26
591000 -- (-426.232) (-426.551) [-424.042] (-425.650) * [-423.959] (-427.493) (-428.102) (-427.188) -- 0:00:26
591500 -- (-424.917) (-423.692) [-426.131] (-425.490) * (-424.424) (-425.654) [-424.996] (-426.550) -- 0:00:26
592000 -- (-427.974) (-424.566) [-426.099] (-424.312) * (-425.954) (-427.763) (-425.691) [-424.654] -- 0:00:26
592500 -- (-426.088) (-425.267) (-425.403) [-425.382] * (-425.015) [-424.049] (-425.154) (-424.267) -- 0:00:26
593000 -- (-424.275) (-426.789) [-423.659] (-423.848) * (-427.152) (-425.773) (-428.682) [-424.152] -- 0:00:26
593500 -- (-425.055) (-425.577) (-424.738) [-425.047] * (-426.208) [-423.718] (-425.087) (-425.901) -- 0:00:26
594000 -- (-425.141) (-427.537) [-426.015] (-427.112) * (-425.656) [-429.371] (-425.623) (-424.998) -- 0:00:25
594500 -- (-424.139) (-423.948) (-424.223) [-425.097] * (-426.822) (-427.709) [-431.173] (-425.863) -- 0:00:25
595000 -- [-423.936] (-424.537) (-425.866) (-425.197) * (-424.499) (-423.696) (-430.363) [-427.207] -- 0:00:25
Average standard deviation of split frequencies: 0.005537
595500 -- (-425.140) [-424.160] (-426.384) (-425.561) * (-423.846) [-425.018] (-424.727) (-430.588) -- 0:00:25
596000 -- (-424.237) [-426.611] (-423.722) (-426.602) * (-424.347) (-424.589) (-427.038) [-426.264] -- 0:00:25
596500 -- [-424.882] (-429.672) (-430.663) (-428.756) * (-426.208) [-426.831] (-424.692) (-426.000) -- 0:00:25
597000 -- (-424.916) (-429.779) [-429.722] (-431.604) * (-425.420) (-427.113) [-423.899] (-426.199) -- 0:00:25
597500 -- (-426.431) (-424.095) [-426.195] (-431.306) * [-426.033] (-424.323) (-425.551) (-427.773) -- 0:00:25
598000 -- (-426.843) (-425.602) (-429.047) [-430.126] * (-429.824) [-423.592] (-426.059) (-431.445) -- 0:00:25
598500 -- (-426.980) (-425.544) [-426.392] (-424.491) * (-428.631) (-424.090) (-425.691) [-425.340] -- 0:00:25
599000 -- (-425.980) (-424.069) (-425.878) [-424.351] * (-427.512) (-425.979) (-425.573) [-425.905] -- 0:00:25
599500 -- (-425.276) (-424.680) [-426.209] (-424.710) * (-427.220) (-428.925) [-425.770] (-424.504) -- 0:00:25
600000 -- (-424.570) [-427.352] (-424.909) (-427.647) * [-424.665] (-429.077) (-428.194) (-426.106) -- 0:00:25
Average standard deviation of split frequencies: 0.005543
600500 -- (-426.154) (-425.779) (-424.293) [-424.819] * [-424.042] (-426.447) (-431.534) (-427.614) -- 0:00:25
601000 -- (-424.998) (-428.153) [-423.815] (-425.036) * (-425.016) [-425.865] (-424.875) (-425.570) -- 0:00:25
601500 -- (-427.245) (-426.155) [-425.566] (-424.882) * (-425.151) [-426.255] (-423.983) (-427.604) -- 0:00:25
602000 -- (-428.498) [-425.244] (-424.910) (-424.744) * [-426.562] (-429.206) (-425.812) (-426.135) -- 0:00:25
602500 -- (-424.262) (-427.386) [-424.623] (-426.018) * (-425.389) (-429.595) [-424.411] (-424.557) -- 0:00:25
603000 -- (-427.368) [-426.283] (-425.686) (-424.177) * (-426.004) (-425.394) (-424.595) [-428.402] -- 0:00:25
603500 -- (-426.154) (-426.088) [-425.217] (-425.316) * (-425.664) (-425.090) [-425.594] (-424.847) -- 0:00:25
604000 -- [-424.986] (-428.176) (-423.797) (-426.154) * [-429.186] (-427.709) (-427.689) (-423.727) -- 0:00:25
604500 -- (-426.761) [-424.108] (-423.776) (-424.404) * (-424.264) (-426.879) [-427.593] (-425.652) -- 0:00:25
605000 -- (-424.876) [-427.380] (-424.545) (-426.193) * (-424.004) (-425.403) (-427.929) [-425.829] -- 0:00:25
Average standard deviation of split frequencies: 0.004667
605500 -- (-430.058) (-430.624) [-424.311] (-424.273) * (-427.341) (-426.222) (-424.505) [-430.565] -- 0:00:25
606000 -- (-427.068) (-426.463) [-425.664] (-425.962) * (-424.823) (-424.974) (-424.424) [-426.275] -- 0:00:25
606500 -- [-425.620] (-427.371) (-425.577) (-424.961) * (-426.198) [-429.588] (-427.935) (-428.249) -- 0:00:25
607000 -- (-425.341) [-425.687] (-426.064) (-425.999) * [-426.132] (-426.094) (-426.730) (-425.741) -- 0:00:25
607500 -- (-426.078) (-425.097) (-424.229) [-423.704] * (-425.200) (-427.933) [-425.037] (-423.644) -- 0:00:25
608000 -- [-425.284] (-425.258) (-426.350) (-425.978) * (-425.602) (-424.246) (-424.904) [-426.379] -- 0:00:25
608500 -- (-424.862) (-426.444) [-425.714] (-424.048) * [-427.041] (-425.623) (-424.312) (-424.825) -- 0:00:25
609000 -- (-425.287) (-424.788) [-426.946] (-424.069) * [-426.315] (-429.134) (-424.561) (-423.994) -- 0:00:25
609500 -- (-425.489) (-425.848) (-427.050) [-424.210] * (-424.860) [-428.482] (-424.152) (-423.845) -- 0:00:24
610000 -- [-427.974] (-426.957) (-426.061) (-426.002) * (-426.669) (-426.033) (-426.398) [-426.156] -- 0:00:24
Average standard deviation of split frequencies: 0.004969
610500 -- (-430.401) (-425.210) (-427.092) [-424.000] * (-424.841) (-425.866) [-425.242] (-430.890) -- 0:00:24
611000 -- (-425.281) (-424.761) [-425.282] (-425.474) * (-427.048) (-424.888) (-425.058) [-424.630] -- 0:00:24
611500 -- (-425.102) [-425.269] (-430.250) (-425.303) * [-427.521] (-428.272) (-425.779) (-428.412) -- 0:00:24
612000 -- [-424.658] (-426.222) (-425.601) (-426.826) * (-424.009) (-427.284) (-426.519) [-424.617] -- 0:00:24
612500 -- (-424.826) (-425.054) (-425.516) [-426.609] * (-427.146) (-425.193) (-426.745) [-426.175] -- 0:00:24
613000 -- (-424.299) [-426.621] (-426.790) (-428.654) * (-424.947) [-424.041] (-427.585) (-425.278) -- 0:00:24
613500 -- (-426.487) (-428.445) [-430.418] (-427.125) * [-424.023] (-427.398) (-425.812) (-427.772) -- 0:00:24
614000 -- (-424.057) (-425.357) (-424.620) [-425.418] * (-423.692) (-426.608) [-427.920] (-435.653) -- 0:00:24
614500 -- [-423.796] (-425.850) (-425.153) (-425.886) * (-429.843) (-426.812) (-428.215) [-424.958] -- 0:00:24
615000 -- (-424.540) (-424.228) (-424.162) [-427.947] * (-425.591) (-425.256) (-424.991) [-426.598] -- 0:00:24
Average standard deviation of split frequencies: 0.005548
615500 -- (-424.933) [-423.835] (-427.962) (-425.735) * (-427.935) (-428.855) (-424.084) [-430.677] -- 0:00:24
616000 -- (-426.128) (-425.695) (-425.256) [-426.452] * (-431.103) [-428.452] (-425.675) (-429.328) -- 0:00:24
616500 -- (-425.102) [-426.109] (-428.724) (-425.218) * (-429.056) (-427.305) [-425.471] (-424.290) -- 0:00:24
617000 -- (-426.713) (-428.707) (-426.198) [-425.813] * (-423.621) (-424.749) (-427.536) [-424.573] -- 0:00:24
617500 -- [-425.256] (-428.999) (-425.127) (-429.666) * (-424.575) (-425.958) (-425.491) [-424.540] -- 0:00:24
618000 -- (-426.297) (-425.384) [-424.595] (-427.283) * (-426.277) (-425.495) (-424.052) [-425.042] -- 0:00:24
618500 -- (-426.686) (-424.414) (-427.748) [-424.894] * [-425.517] (-427.704) (-423.903) (-427.916) -- 0:00:24
619000 -- (-431.620) (-424.873) (-424.274) [-425.256] * (-425.883) (-427.272) (-425.711) [-424.559] -- 0:00:24
619500 -- (-428.961) (-433.878) [-425.003] (-426.695) * (-429.288) (-424.715) [-428.810] (-426.619) -- 0:00:24
620000 -- (-424.989) [-427.751] (-425.573) (-424.967) * [-424.530] (-424.422) (-430.337) (-425.506) -- 0:00:24
Average standard deviation of split frequencies: 0.005696
620500 -- [-424.595] (-430.340) (-427.368) (-431.256) * (-427.745) (-430.070) (-430.782) [-424.510] -- 0:00:24
621000 -- (-424.616) (-427.064) [-425.758] (-430.569) * (-427.122) [-426.108] (-426.689) (-429.069) -- 0:00:24
621500 -- [-425.071] (-427.372) (-426.051) (-429.307) * (-424.435) (-427.235) [-427.911] (-428.713) -- 0:00:24
622000 -- (-427.206) [-430.322] (-426.568) (-424.902) * (-425.504) (-428.541) (-425.622) [-426.937] -- 0:00:24
622500 -- (-427.394) (-433.450) (-427.163) [-424.425] * (-425.855) (-429.656) (-424.702) [-426.566] -- 0:00:24
623000 -- (-423.777) (-429.802) (-429.080) [-428.728] * (-428.385) [-425.091] (-425.553) (-426.506) -- 0:00:24
623500 -- [-425.722] (-424.780) (-426.212) (-427.247) * (-424.146) [-424.895] (-428.439) (-424.623) -- 0:00:24
624000 -- (-425.400) [-426.598] (-431.432) (-425.666) * (-427.282) [-424.686] (-432.092) (-426.052) -- 0:00:24
624500 -- [-424.506] (-424.068) (-428.323) (-430.012) * (-425.568) [-424.547] (-428.484) (-424.830) -- 0:00:24
625000 -- (-425.047) [-426.290] (-426.529) (-425.325) * (-424.149) [-423.997] (-433.859) (-429.159) -- 0:00:24
Average standard deviation of split frequencies: 0.005271
625500 -- (-426.338) (-427.629) [-424.178] (-427.638) * (-424.120) (-426.232) (-428.016) [-427.838] -- 0:00:23
626000 -- (-425.071) (-433.933) (-427.560) [-424.613] * (-427.004) (-424.951) [-424.348] (-431.786) -- 0:00:23
626500 -- (-429.190) [-425.231] (-424.741) (-424.295) * (-425.663) (-426.761) [-428.299] (-425.862) -- 0:00:23
627000 -- (-429.876) (-426.031) (-425.642) [-426.064] * (-424.372) [-423.736] (-432.417) (-424.547) -- 0:00:23
627500 -- [-426.353] (-429.650) (-426.948) (-423.504) * (-424.355) (-424.377) (-425.373) [-425.817] -- 0:00:23
628000 -- (-423.809) [-424.253] (-425.549) (-423.752) * (-424.524) (-425.107) (-426.075) [-427.844] -- 0:00:23
628500 -- (-425.245) (-427.515) [-425.137] (-423.757) * (-427.066) [-427.947] (-424.633) (-423.875) -- 0:00:23
629000 -- (-424.610) (-428.635) [-425.665] (-430.507) * (-425.955) (-426.674) (-424.739) [-423.813] -- 0:00:23
629500 -- [-424.395] (-425.715) (-425.415) (-427.080) * (-425.935) [-423.948] (-425.412) (-426.250) -- 0:00:23
630000 -- (-424.881) (-426.018) [-427.086] (-424.693) * [-425.674] (-425.838) (-423.802) (-424.242) -- 0:00:23
Average standard deviation of split frequencies: 0.005279
630500 -- (-425.574) (-428.323) (-426.283) [-427.145] * (-425.469) [-426.652] (-424.134) (-427.416) -- 0:00:23
631000 -- (-424.413) [-425.805] (-424.191) (-425.002) * (-441.342) [-424.900] (-424.672) (-425.767) -- 0:00:23
631500 -- [-426.853] (-424.650) (-423.895) (-426.989) * (-428.367) [-425.748] (-425.535) (-426.387) -- 0:00:23
632000 -- (-426.782) (-424.780) [-425.825] (-428.215) * (-425.934) (-424.559) [-425.010] (-427.857) -- 0:00:23
632500 -- (-427.270) [-423.926] (-426.288) (-428.054) * (-424.577) (-424.583) [-426.806] (-425.308) -- 0:00:23
633000 -- (-428.759) [-425.551] (-428.152) (-425.201) * (-424.531) (-425.529) [-427.843] (-426.479) -- 0:00:23
633500 -- (-427.163) (-425.380) (-425.826) [-426.802] * [-423.896] (-428.193) (-426.239) (-426.437) -- 0:00:23
634000 -- (-427.657) [-425.813] (-427.009) (-427.097) * (-425.852) (-425.466) [-424.752] (-430.688) -- 0:00:23
634500 -- [-426.285] (-424.051) (-425.027) (-431.100) * (-425.636) (-426.075) (-424.639) [-424.984] -- 0:00:23
635000 -- (-424.122) (-425.088) [-424.640] (-425.562) * (-424.381) (-431.750) (-425.602) [-425.354] -- 0:00:22
Average standard deviation of split frequencies: 0.006393
635500 -- (-427.228) (-425.020) [-427.755] (-428.315) * (-423.797) (-426.070) [-426.336] (-427.150) -- 0:00:22
636000 -- (-424.109) (-426.309) (-427.964) [-425.761] * (-425.178) [-425.163] (-428.881) (-424.144) -- 0:00:22
636500 -- (-423.589) [-426.729] (-426.977) (-429.703) * (-428.249) (-424.222) (-428.312) [-425.438] -- 0:00:22
637000 -- [-424.680] (-425.022) (-424.030) (-427.946) * (-426.790) (-426.040) (-427.766) [-424.284] -- 0:00:23
637500 -- (-423.882) (-425.881) (-426.688) [-425.497] * [-425.665] (-426.037) (-426.450) (-425.217) -- 0:00:23
638000 -- (-425.701) [-426.022] (-425.836) (-424.693) * (-425.619) [-424.275] (-426.514) (-426.325) -- 0:00:23
638500 -- [-425.282] (-432.198) (-429.892) (-428.203) * (-425.332) (-425.534) [-426.665] (-424.945) -- 0:00:23
639000 -- [-426.806] (-428.723) (-427.982) (-429.419) * (-424.883) (-425.554) (-426.286) [-425.275] -- 0:00:23
639500 -- (-433.013) [-425.059] (-425.167) (-426.191) * (-426.006) (-423.958) [-426.458] (-425.182) -- 0:00:23
640000 -- (-428.339) (-426.078) [-426.153] (-426.681) * (-427.346) (-428.262) [-425.470] (-426.698) -- 0:00:23
Average standard deviation of split frequencies: 0.006760
640500 -- [-424.890] (-424.611) (-425.865) (-427.986) * (-426.472) (-424.807) (-424.706) [-424.539] -- 0:00:23
641000 -- (-427.212) (-425.199) [-425.434] (-427.036) * (-424.582) (-426.474) (-424.875) [-425.174] -- 0:00:22
641500 -- (-424.753) (-426.119) [-426.255] (-423.886) * [-424.061] (-428.251) (-426.400) (-426.351) -- 0:00:22
642000 -- (-428.856) [-423.902] (-426.265) (-427.248) * (-424.882) (-428.118) (-424.759) [-426.714] -- 0:00:22
642500 -- (-428.313) [-428.434] (-426.096) (-426.325) * [-424.984] (-428.144) (-424.628) (-423.935) -- 0:00:22
643000 -- (-425.861) [-427.337] (-425.197) (-429.344) * (-424.588) (-429.211) [-425.086] (-425.539) -- 0:00:22
643500 -- [-424.653] (-430.033) (-426.783) (-425.506) * [-429.131] (-426.621) (-426.328) (-425.270) -- 0:00:22
644000 -- (-424.291) [-425.636] (-429.501) (-424.728) * (-425.975) [-426.292] (-425.052) (-425.578) -- 0:00:22
644500 -- (-425.198) [-425.341] (-426.611) (-424.618) * (-424.237) [-425.315] (-427.679) (-424.452) -- 0:00:22
645000 -- (-427.534) (-424.575) (-424.238) [-426.379] * (-424.564) (-426.495) (-424.934) [-425.644] -- 0:00:22
Average standard deviation of split frequencies: 0.006932
645500 -- (-429.245) [-425.583] (-424.234) (-425.275) * (-425.869) (-429.368) [-425.166] (-427.587) -- 0:00:22
646000 -- [-426.444] (-424.962) (-427.635) (-425.076) * (-425.295) (-429.250) (-425.336) [-426.542] -- 0:00:22
646500 -- [-424.315] (-428.512) (-424.886) (-426.671) * (-424.920) (-426.750) (-425.909) [-426.975] -- 0:00:22
647000 -- (-427.550) (-427.598) [-429.934] (-426.501) * (-425.785) (-426.842) (-429.443) [-424.886] -- 0:00:22
647500 -- (-427.074) [-429.319] (-425.041) (-427.540) * (-426.973) [-425.713] (-425.273) (-425.961) -- 0:00:22
648000 -- (-427.125) (-426.875) [-426.552] (-426.020) * (-425.555) [-423.779] (-424.382) (-424.678) -- 0:00:22
648500 -- (-424.534) (-424.004) [-426.566] (-426.109) * [-425.056] (-424.118) (-426.290) (-426.427) -- 0:00:22
649000 -- [-424.175] (-424.986) (-427.322) (-434.705) * (-424.703) (-426.719) [-427.577] (-428.783) -- 0:00:22
649500 -- (-425.172) [-423.879] (-425.588) (-428.550) * (-424.960) (-426.705) [-428.097] (-426.628) -- 0:00:22
650000 -- (-426.844) (-425.242) [-423.806] (-427.696) * [-428.347] (-424.167) (-427.331) (-427.360) -- 0:00:22
Average standard deviation of split frequencies: 0.007154
650500 -- (-427.317) (-424.499) [-430.772] (-424.420) * [-425.901] (-424.243) (-425.772) (-426.629) -- 0:00:22
651000 -- (-424.958) [-425.199] (-423.635) (-426.168) * (-424.073) [-425.660] (-428.658) (-425.328) -- 0:00:21
651500 -- (-425.213) [-428.514] (-425.984) (-425.800) * (-424.729) [-423.432] (-432.076) (-426.076) -- 0:00:21
652000 -- (-427.442) (-429.430) [-424.160] (-424.745) * (-425.016) (-424.570) [-430.226] (-426.504) -- 0:00:21
652500 -- (-426.718) [-425.427] (-426.255) (-423.909) * [-425.026] (-424.196) (-425.131) (-431.745) -- 0:00:21
653000 -- [-426.545] (-424.064) (-429.092) (-426.481) * (-428.555) (-427.694) [-424.582] (-425.701) -- 0:00:21
653500 -- (-427.646) (-424.142) (-428.241) [-426.402] * (-432.094) [-426.842] (-427.631) (-430.164) -- 0:00:21
654000 -- [-426.616] (-427.228) (-424.695) (-425.975) * (-430.140) (-425.217) (-425.309) [-429.014] -- 0:00:22
654500 -- (-426.334) (-427.855) (-424.712) [-426.731] * (-429.211) (-427.084) [-427.111] (-425.159) -- 0:00:22
655000 -- [-425.420] (-427.045) (-427.679) (-425.761) * [-426.237] (-424.863) (-427.845) (-426.574) -- 0:00:22
Average standard deviation of split frequencies: 0.007186
655500 -- (-429.200) (-426.352) (-424.263) [-427.300] * [-424.569] (-427.298) (-425.797) (-426.210) -- 0:00:22
656000 -- (-425.202) [-426.701] (-423.894) (-424.372) * (-425.595) (-427.560) (-425.192) [-425.908] -- 0:00:22
656500 -- (-424.582) (-425.892) (-424.655) [-424.311] * [-424.723] (-427.235) (-424.966) (-425.074) -- 0:00:21
657000 -- [-427.865] (-424.161) (-424.457) (-426.343) * [-425.390] (-424.533) (-429.086) (-424.983) -- 0:00:21
657500 -- (-429.798) (-424.566) (-424.363) [-424.983] * (-424.324) (-425.534) (-432.599) [-424.454] -- 0:00:21
658000 -- (-427.762) (-423.796) [-424.697] (-427.210) * (-424.510) (-425.526) [-424.516] (-424.320) -- 0:00:21
658500 -- (-425.074) [-425.332] (-424.296) (-424.251) * (-424.142) (-426.017) (-426.824) [-424.174] -- 0:00:21
659000 -- [-425.181] (-424.727) (-425.343) (-425.052) * (-426.651) (-426.329) (-424.662) [-425.656] -- 0:00:21
659500 -- (-424.499) (-424.378) (-425.742) [-426.019] * (-426.146) [-424.906] (-426.551) (-426.166) -- 0:00:21
660000 -- (-424.518) (-425.498) (-425.616) [-424.231] * (-423.692) [-425.760] (-429.345) (-425.573) -- 0:00:21
Average standard deviation of split frequencies: 0.006689
660500 -- (-425.893) (-424.970) (-426.693) [-427.481] * (-424.895) [-426.263] (-425.167) (-426.201) -- 0:00:21
661000 -- [-424.939] (-425.219) (-430.750) (-428.066) * (-424.630) [-424.579] (-425.951) (-427.860) -- 0:00:21
661500 -- (-423.650) [-425.291] (-426.651) (-427.409) * (-424.629) [-424.030] (-432.063) (-425.215) -- 0:00:21
662000 -- [-426.811] (-427.873) (-426.128) (-428.023) * (-436.920) (-424.211) [-430.997] (-425.694) -- 0:00:21
662500 -- [-424.923] (-426.340) (-424.354) (-427.869) * (-425.341) (-424.388) [-425.436] (-429.169) -- 0:00:21
663000 -- (-429.052) (-426.299) [-424.538] (-427.297) * [-427.006] (-424.303) (-428.798) (-426.078) -- 0:00:21
663500 -- (-426.837) [-425.329] (-428.395) (-431.609) * (-424.765) (-431.867) (-426.139) [-423.808] -- 0:00:21
664000 -- (-425.258) (-426.934) [-424.649] (-424.519) * (-425.388) (-429.432) [-425.092] (-427.411) -- 0:00:21
664500 -- (-427.887) (-430.405) [-425.435] (-426.680) * (-424.351) (-426.579) [-424.939] (-428.522) -- 0:00:21
665000 -- [-426.637] (-426.563) (-424.655) (-426.375) * (-424.335) (-430.046) [-423.891] (-425.683) -- 0:00:21
Average standard deviation of split frequencies: 0.006990
665500 -- (-428.674) (-430.374) [-425.753] (-427.604) * (-424.242) (-431.785) (-429.896) [-425.872] -- 0:00:21
666000 -- [-426.840] (-428.793) (-427.554) (-426.895) * [-425.838] (-425.326) (-430.638) (-426.250) -- 0:00:21
666500 -- (-426.091) [-425.830] (-426.785) (-427.734) * (-426.320) (-432.804) [-425.903] (-425.675) -- 0:00:21
667000 -- (-425.086) (-427.080) [-424.425] (-424.454) * (-425.395) (-425.361) (-426.816) [-425.201] -- 0:00:20
667500 -- (-426.457) [-424.722] (-424.917) (-424.648) * (-424.670) [-425.019] (-428.842) (-427.194) -- 0:00:20
668000 -- (-426.854) (-428.554) [-423.925] (-424.887) * [-425.601] (-426.993) (-426.923) (-427.073) -- 0:00:20
668500 -- (-427.908) (-425.970) (-428.281) [-427.033] * (-426.994) [-424.639] (-426.444) (-426.179) -- 0:00:20
669000 -- (-425.932) [-424.006] (-423.895) (-424.133) * (-423.727) (-424.929) (-426.867) [-424.215] -- 0:00:20
669500 -- (-425.406) [-423.720] (-425.751) (-423.706) * [-424.786] (-424.263) (-425.785) (-431.362) -- 0:00:20
670000 -- [-425.282] (-425.453) (-425.294) (-426.826) * [-430.325] (-425.991) (-426.565) (-425.270) -- 0:00:20
Average standard deviation of split frequencies: 0.006677
670500 -- [-426.014] (-424.520) (-428.055) (-427.108) * (-426.443) (-425.014) (-424.759) [-427.264] -- 0:00:20
671000 -- (-431.727) [-425.106] (-425.342) (-424.414) * (-426.662) (-425.071) [-425.651] (-431.414) -- 0:00:20
671500 -- (-428.722) (-424.900) (-425.275) [-424.367] * (-427.769) [-425.900] (-423.423) (-424.507) -- 0:00:21
672000 -- (-428.846) [-425.249] (-424.837) (-427.160) * [-425.471] (-427.087) (-424.316) (-424.749) -- 0:00:20
672500 -- (-429.273) [-424.168] (-424.702) (-425.967) * (-425.740) [-426.409] (-427.691) (-431.522) -- 0:00:20
673000 -- (-427.375) (-426.241) (-426.192) [-424.814] * (-424.962) [-423.819] (-425.418) (-425.843) -- 0:00:20
673500 -- (-426.681) (-425.058) [-428.346] (-424.768) * (-423.940) (-427.104) [-425.512] (-428.024) -- 0:00:20
674000 -- (-424.836) (-426.071) (-427.420) [-425.431] * (-423.848) [-424.938] (-426.603) (-426.309) -- 0:00:20
674500 -- [-424.626] (-425.209) (-426.064) (-426.041) * [-424.769] (-425.299) (-425.888) (-426.561) -- 0:00:20
675000 -- [-424.114] (-425.872) (-425.963) (-424.867) * (-424.155) (-424.924) (-428.903) [-425.161] -- 0:00:20
Average standard deviation of split frequencies: 0.005971
675500 -- (-425.016) (-424.237) [-430.090] (-427.076) * (-426.378) (-424.396) [-425.523] (-427.009) -- 0:00:20
676000 -- [-424.931] (-425.798) (-428.059) (-428.944) * (-423.851) [-425.206] (-427.727) (-426.843) -- 0:00:20
676500 -- (-426.218) (-428.455) [-428.670] (-425.073) * (-425.121) [-424.349] (-425.869) (-430.867) -- 0:00:20
677000 -- (-426.386) [-427.305] (-426.493) (-423.972) * (-426.639) [-424.806] (-429.854) (-430.776) -- 0:00:20
677500 -- (-425.602) (-428.617) (-425.289) [-424.394] * [-426.958] (-424.264) (-425.796) (-425.294) -- 0:00:20
678000 -- (-427.499) (-426.766) [-424.467] (-427.644) * (-424.877) (-426.442) [-427.350] (-424.291) -- 0:00:20
678500 -- (-424.503) (-430.119) [-424.944] (-428.115) * (-424.186) (-425.748) (-428.063) [-424.821] -- 0:00:20
679000 -- [-425.706] (-424.705) (-426.528) (-427.897) * [-426.656] (-424.982) (-428.603) (-427.280) -- 0:00:20
679500 -- (-426.722) (-424.332) (-426.530) [-429.572] * (-424.310) (-427.237) [-428.790] (-428.514) -- 0:00:20
680000 -- (-425.385) (-427.249) [-423.903] (-424.725) * (-433.519) (-425.464) [-426.416] (-427.216) -- 0:00:20
Average standard deviation of split frequencies: 0.006233
680500 -- (-426.578) (-430.731) [-426.638] (-424.781) * (-424.832) (-427.507) [-424.672] (-426.929) -- 0:00:20
681000 -- (-424.094) [-426.869] (-425.891) (-427.083) * [-429.162] (-423.688) (-425.009) (-424.450) -- 0:00:20
681500 -- (-424.896) (-423.945) [-424.181] (-428.113) * (-424.890) (-424.611) (-425.657) [-424.191] -- 0:00:20
682000 -- (-425.844) [-424.573] (-428.636) (-424.502) * (-425.387) [-424.228] (-429.139) (-426.836) -- 0:00:20
682500 -- (-427.160) [-427.144] (-426.608) (-425.236) * [-424.479] (-424.747) (-426.205) (-424.648) -- 0:00:20
683000 -- [-425.290] (-425.684) (-425.652) (-424.139) * (-425.857) [-424.944] (-426.969) (-426.100) -- 0:00:19
683500 -- [-426.830] (-424.563) (-428.741) (-427.098) * (-425.929) (-424.324) [-431.763] (-428.945) -- 0:00:19
684000 -- (-427.432) (-425.414) (-425.077) [-426.568] * (-425.122) (-425.013) [-428.019] (-428.003) -- 0:00:19
684500 -- (-428.146) (-427.560) (-424.674) [-428.703] * [-425.124] (-423.958) (-426.083) (-424.657) -- 0:00:19
685000 -- (-423.828) (-425.126) [-424.175] (-426.956) * (-424.063) (-424.566) (-426.884) [-423.801] -- 0:00:19
Average standard deviation of split frequencies: 0.006614
685500 -- (-429.596) (-423.592) (-430.713) [-427.375] * (-427.051) (-429.460) (-427.883) [-427.304] -- 0:00:19
686000 -- (-428.146) (-423.934) (-424.514) [-425.863] * (-426.608) (-427.724) [-424.947] (-424.017) -- 0:00:19
686500 -- [-424.154] (-425.903) (-423.743) (-428.799) * (-425.945) [-425.237] (-426.848) (-427.923) -- 0:00:19
687000 -- [-425.266] (-426.577) (-426.951) (-427.644) * (-425.847) (-423.915) [-427.024] (-424.355) -- 0:00:19
687500 -- (-424.685) (-426.284) [-426.541] (-426.419) * [-428.276] (-426.082) (-426.011) (-424.206) -- 0:00:19
688000 -- (-424.024) (-430.103) [-425.041] (-427.251) * (-427.929) [-424.925] (-426.574) (-425.656) -- 0:00:19
688500 -- (-425.492) [-428.344] (-425.444) (-425.103) * (-425.195) [-428.896] (-427.345) (-429.462) -- 0:00:19
689000 -- (-424.978) [-426.593] (-424.913) (-423.528) * [-427.877] (-428.408) (-424.445) (-425.175) -- 0:00:19
689500 -- (-425.523) (-427.900) (-425.984) [-423.942] * [-427.713] (-427.604) (-424.707) (-425.461) -- 0:00:19
690000 -- (-426.457) [-423.659] (-428.448) (-428.801) * (-426.158) [-424.935] (-424.977) (-426.322) -- 0:00:19
Average standard deviation of split frequencies: 0.007081
690500 -- [-426.470] (-423.435) (-424.388) (-426.045) * (-423.633) (-427.551) (-423.934) [-431.026] -- 0:00:19
691000 -- (-427.548) [-426.227] (-424.351) (-429.977) * (-427.604) (-426.511) [-424.317] (-427.874) -- 0:00:19
691500 -- (-428.081) (-424.799) [-424.504] (-424.313) * (-424.418) [-424.890] (-428.110) (-427.499) -- 0:00:19
692000 -- (-428.517) (-426.627) (-424.534) [-424.520] * (-426.743) [-426.120] (-425.794) (-429.492) -- 0:00:19
692500 -- (-425.176) (-424.733) (-427.811) [-425.138] * (-431.826) [-427.372] (-426.322) (-425.551) -- 0:00:19
693000 -- (-424.744) (-425.923) [-424.321] (-423.697) * (-428.735) [-426.414] (-425.200) (-424.825) -- 0:00:19
693500 -- [-426.817] (-427.280) (-424.004) (-426.372) * (-431.062) [-432.190] (-425.283) (-430.093) -- 0:00:19
694000 -- (-423.622) [-429.192] (-425.059) (-423.997) * (-428.025) (-425.943) [-426.295] (-427.410) -- 0:00:19
694500 -- (-431.639) (-424.006) [-424.445] (-424.993) * (-429.416) (-426.208) [-426.502] (-430.373) -- 0:00:19
695000 -- (-431.072) (-427.510) [-423.553] (-429.094) * (-426.828) (-429.374) (-426.905) [-426.407] -- 0:00:19
Average standard deviation of split frequencies: 0.007112
695500 -- (-426.047) [-424.522] (-428.802) (-426.130) * (-424.620) [-424.331] (-424.756) (-425.888) -- 0:00:19
696000 -- (-427.605) (-423.560) (-426.443) [-423.539] * (-426.660) (-424.154) (-424.334) [-425.996] -- 0:00:19
696500 -- (-431.579) (-426.847) (-429.066) [-423.484] * (-427.748) [-425.272] (-427.022) (-425.703) -- 0:00:19
697000 -- (-423.722) [-426.341] (-426.906) (-425.480) * (-430.549) (-427.591) [-425.830] (-424.063) -- 0:00:19
697500 -- (-424.895) [-424.339] (-424.680) (-425.693) * (-427.342) [-424.999] (-425.465) (-427.183) -- 0:00:19
698000 -- (-424.869) [-425.718] (-425.615) (-425.177) * (-425.960) (-426.881) (-426.467) [-424.013] -- 0:00:19
698500 -- [-426.047] (-424.669) (-424.350) (-426.579) * (-425.623) (-426.600) (-424.721) [-424.188] -- 0:00:18
699000 -- (-427.220) (-425.536) [-424.517] (-428.636) * (-428.676) [-428.606] (-429.707) (-427.551) -- 0:00:18
699500 -- (-424.994) [-423.974] (-425.604) (-429.339) * [-424.563] (-424.990) (-427.573) (-432.639) -- 0:00:18
700000 -- (-425.513) [-425.802] (-427.314) (-427.183) * (-424.338) (-428.046) (-424.721) [-425.560] -- 0:00:18
Average standard deviation of split frequencies: 0.006602
700500 -- (-423.715) (-426.100) (-425.179) [-428.784] * (-424.422) (-425.669) (-431.293) [-426.092] -- 0:00:18
701000 -- [-425.369] (-428.652) (-429.056) (-424.681) * (-428.018) [-425.879] (-425.029) (-426.925) -- 0:00:18
701500 -- (-425.271) [-425.397] (-425.362) (-425.395) * (-427.254) (-423.602) [-425.811] (-427.410) -- 0:00:18
702000 -- (-425.111) [-424.479] (-424.728) (-428.100) * (-426.477) (-423.606) (-430.994) [-428.189] -- 0:00:18
702500 -- (-424.983) (-427.044) (-427.658) [-431.618] * (-426.192) (-423.610) (-426.663) [-426.055] -- 0:00:18
703000 -- [-428.388] (-425.145) (-424.357) (-425.246) * (-427.438) [-425.364] (-427.352) (-425.709) -- 0:00:18
703500 -- [-424.885] (-425.282) (-424.557) (-426.037) * (-424.090) (-425.819) [-431.821] (-425.181) -- 0:00:18
704000 -- (-424.067) (-427.939) (-428.665) [-424.083] * (-425.779) [-425.684] (-426.194) (-423.870) -- 0:00:18
704500 -- (-424.912) (-424.026) [-426.885] (-424.784) * [-429.499] (-424.735) (-428.026) (-429.140) -- 0:00:18
705000 -- (-425.095) [-426.995] (-424.560) (-425.206) * (-428.016) [-425.680] (-423.750) (-426.080) -- 0:00:18
Average standard deviation of split frequencies: 0.006260
705500 -- (-425.424) [-425.722] (-425.077) (-431.754) * (-425.234) (-425.005) (-428.001) [-425.715] -- 0:00:18
706000 -- [-426.363] (-424.148) (-425.153) (-426.342) * (-424.637) [-425.863] (-426.380) (-426.214) -- 0:00:18
706500 -- (-425.047) [-425.711] (-425.664) (-426.535) * (-427.896) (-424.752) (-425.883) [-427.016] -- 0:00:18
707000 -- (-426.216) [-424.710] (-425.408) (-425.116) * (-428.130) (-424.964) [-429.236] (-427.020) -- 0:00:18
707500 -- (-429.515) [-430.030] (-425.235) (-423.752) * [-427.730] (-431.169) (-430.097) (-425.776) -- 0:00:18
708000 -- (-427.257) (-425.324) [-426.161] (-429.339) * (-428.363) (-427.920) (-429.259) [-427.132] -- 0:00:18
708500 -- (-428.270) (-425.749) (-424.603) [-424.080] * (-426.321) [-424.176] (-427.354) (-427.082) -- 0:00:18
709000 -- (-433.887) (-430.965) [-424.380] (-426.854) * (-426.188) (-425.942) [-426.233] (-425.577) -- 0:00:18
709500 -- [-426.661] (-431.217) (-424.914) (-424.329) * [-425.521] (-427.721) (-427.878) (-426.330) -- 0:00:18
710000 -- (-426.807) (-426.809) (-426.701) [-425.857] * (-426.835) [-425.313] (-424.767) (-423.771) -- 0:00:18
Average standard deviation of split frequencies: 0.006426
710500 -- (-426.652) [-426.227] (-427.482) (-427.157) * (-424.373) (-430.807) (-427.229) [-424.484] -- 0:00:18
711000 -- [-426.605] (-425.670) (-425.392) (-428.472) * (-424.053) (-425.910) (-430.245) [-425.223] -- 0:00:18
711500 -- (-428.711) (-426.027) [-426.797] (-427.152) * (-427.188) (-424.040) [-429.002] (-425.653) -- 0:00:18
712000 -- (-426.615) (-424.466) (-426.092) [-427.835] * [-427.953] (-424.246) (-426.275) (-426.405) -- 0:00:18
712500 -- (-430.939) (-426.680) [-425.470] (-426.085) * (-425.546) [-429.194] (-425.967) (-424.716) -- 0:00:18
713000 -- (-430.516) (-425.702) (-425.623) [-426.246] * (-425.809) (-424.899) (-426.149) [-426.242] -- 0:00:18
713500 -- (-427.895) [-427.370] (-427.689) (-423.992) * (-425.101) [-426.186] (-426.538) (-427.280) -- 0:00:18
714000 -- (-426.355) (-425.517) (-427.976) [-426.617] * (-425.467) (-423.837) (-424.572) [-430.369] -- 0:00:18
714500 -- (-427.984) (-426.370) (-427.870) [-423.711] * (-428.116) (-423.469) (-426.749) [-425.556] -- 0:00:17
715000 -- [-424.112] (-430.504) (-425.344) (-424.860) * (-429.980) (-426.532) [-426.475] (-426.124) -- 0:00:17
Average standard deviation of split frequencies: 0.006502
715500 -- (-424.060) (-425.519) [-427.585] (-425.425) * (-427.116) (-428.155) [-428.413] (-424.169) -- 0:00:17
716000 -- (-425.820) (-424.790) (-427.326) [-424.777] * [-425.923] (-428.071) (-428.077) (-424.554) -- 0:00:17
716500 -- (-429.281) [-426.347] (-425.070) (-423.909) * (-426.566) (-430.130) (-427.527) [-425.610] -- 0:00:17
717000 -- [-427.357] (-426.544) (-426.944) (-424.250) * (-424.649) (-427.368) (-425.322) [-425.299] -- 0:00:17
717500 -- (-425.031) [-425.044] (-431.120) (-428.478) * (-424.789) (-424.615) (-425.298) [-425.912] -- 0:00:17
718000 -- (-428.185) [-425.832] (-424.665) (-424.357) * [-423.791] (-426.191) (-424.856) (-428.834) -- 0:00:17
718500 -- (-426.555) (-425.204) [-424.369] (-424.605) * [-427.538] (-426.236) (-425.019) (-427.681) -- 0:00:17
719000 -- (-432.475) (-427.856) [-426.125] (-425.201) * (-429.737) (-427.454) (-425.120) [-426.097] -- 0:00:17
719500 -- (-425.873) (-425.557) [-424.398] (-428.156) * [-424.785] (-428.427) (-426.559) (-425.840) -- 0:00:17
720000 -- (-425.379) (-428.520) [-424.922] (-429.580) * (-426.012) [-429.046] (-429.736) (-423.625) -- 0:00:17
Average standard deviation of split frequencies: 0.006296
720500 -- (-425.350) [-427.837] (-431.504) (-428.036) * (-434.690) [-424.400] (-429.117) (-423.958) -- 0:00:17
721000 -- [-426.203] (-426.755) (-425.507) (-425.341) * (-426.206) [-425.729] (-424.211) (-425.890) -- 0:00:17
721500 -- [-425.714] (-427.522) (-424.949) (-424.932) * [-427.421] (-424.792) (-426.231) (-427.468) -- 0:00:17
722000 -- (-424.424) (-426.311) (-425.724) [-425.262] * (-426.007) [-424.127] (-424.679) (-428.312) -- 0:00:17
722500 -- (-424.879) (-428.285) [-431.233] (-424.017) * [-424.205] (-427.964) (-428.312) (-424.566) -- 0:00:17
723000 -- [-424.068] (-427.449) (-432.236) (-428.795) * (-427.864) [-425.426] (-426.742) (-425.859) -- 0:00:17
723500 -- (-424.771) (-426.046) [-425.144] (-426.480) * (-424.741) (-425.813) (-429.015) [-424.377] -- 0:00:17
724000 -- (-424.503) (-424.269) (-426.503) [-425.895] * (-425.377) (-425.873) (-428.285) [-423.858] -- 0:00:17
724500 -- (-425.974) (-425.213) [-425.450] (-424.278) * (-430.811) (-428.462) (-425.241) [-426.905] -- 0:00:17
725000 -- (-424.481) (-424.793) (-429.668) [-425.520] * (-426.408) (-425.171) [-425.422] (-425.302) -- 0:00:17
Average standard deviation of split frequencies: 0.006574
725500 -- (-427.099) [-426.780] (-427.922) (-427.801) * (-426.597) (-425.919) [-424.040] (-424.415) -- 0:00:17
726000 -- (-426.893) (-430.389) (-429.420) [-425.960] * (-426.311) (-427.268) (-425.642) [-426.146] -- 0:00:17
726500 -- [-425.294] (-424.968) (-423.971) (-427.302) * (-429.077) (-424.968) [-424.069] (-424.254) -- 0:00:17
727000 -- (-425.149) (-425.326) [-428.707] (-423.886) * [-423.463] (-429.540) (-429.105) (-423.947) -- 0:00:17
727500 -- (-425.246) [-424.021] (-426.547) (-424.144) * [-423.793] (-425.638) (-425.531) (-423.372) -- 0:00:17
728000 -- [-425.820] (-424.048) (-424.396) (-425.305) * (-426.292) [-430.279] (-425.281) (-427.859) -- 0:00:17
728500 -- (-425.976) [-423.947] (-424.053) (-426.347) * (-428.320) (-427.093) [-423.798] (-428.426) -- 0:00:17
729000 -- (-427.068) [-425.056] (-424.285) (-424.578) * (-425.020) [-424.563] (-425.893) (-426.135) -- 0:00:17
729500 -- (-425.700) (-424.071) (-425.014) [-428.282] * (-428.307) (-426.898) [-424.523] (-423.966) -- 0:00:17
730000 -- (-425.001) [-423.983] (-425.343) (-426.350) * (-425.889) (-425.698) [-425.320] (-423.599) -- 0:00:17
Average standard deviation of split frequencies: 0.006734
730500 -- (-428.915) [-425.501] (-424.205) (-424.863) * (-425.817) (-426.913) [-423.775] (-424.228) -- 0:00:16
731000 -- [-427.493] (-427.534) (-426.609) (-424.863) * [-424.173] (-424.150) (-425.126) (-428.499) -- 0:00:16
731500 -- (-423.451) [-424.753] (-425.952) (-425.905) * (-425.886) (-427.030) [-428.078] (-427.673) -- 0:00:16
732000 -- (-424.091) (-424.780) [-426.573] (-423.635) * (-429.262) (-425.830) (-424.074) [-426.381] -- 0:00:16
732500 -- (-426.115) (-423.551) [-424.340] (-427.647) * (-425.999) (-428.757) [-423.739] (-430.388) -- 0:00:16
733000 -- (-430.813) [-425.245] (-429.433) (-427.616) * (-428.286) [-423.735] (-428.747) (-427.153) -- 0:00:16
733500 -- (-426.862) (-426.795) (-426.866) [-424.389] * (-424.123) (-428.690) [-433.240] (-424.132) -- 0:00:16
734000 -- (-424.182) (-425.925) (-427.847) [-425.424] * (-425.267) (-425.279) [-427.005] (-431.687) -- 0:00:16
734500 -- [-426.314] (-428.607) (-427.335) (-427.254) * (-425.306) [-426.379] (-425.879) (-426.039) -- 0:00:16
735000 -- (-425.690) [-426.361] (-425.624) (-431.161) * (-426.805) (-424.836) (-425.766) [-424.352] -- 0:00:16
Average standard deviation of split frequencies: 0.006605
735500 -- (-424.830) (-427.112) (-425.743) [-425.789] * (-426.984) [-425.780] (-425.219) (-424.859) -- 0:00:16
736000 -- [-424.826] (-426.957) (-426.979) (-424.595) * [-427.342] (-426.722) (-429.268) (-427.566) -- 0:00:16
736500 -- [-429.595] (-425.534) (-427.845) (-426.747) * (-427.330) [-424.820] (-426.690) (-424.488) -- 0:00:16
737000 -- (-424.437) (-427.493) (-424.934) [-427.990] * (-425.979) (-425.234) (-426.814) [-425.358] -- 0:00:16
737500 -- [-423.785] (-426.195) (-424.934) (-428.139) * (-426.411) (-426.193) (-425.470) [-424.144] -- 0:00:16
738000 -- (-425.304) [-424.788] (-424.898) (-425.423) * (-425.474) [-428.220] (-424.568) (-427.605) -- 0:00:16
738500 -- (-432.151) (-423.921) (-426.816) [-425.253] * (-425.127) (-424.624) [-428.289] (-426.607) -- 0:00:16
739000 -- (-425.909) (-427.105) [-423.930] (-424.696) * (-426.670) [-425.128] (-426.414) (-425.141) -- 0:00:16
739500 -- (-430.403) (-425.938) [-425.209] (-429.277) * (-424.950) (-424.390) (-427.248) [-427.749] -- 0:00:16
740000 -- (-431.029) (-425.583) (-426.461) [-424.146] * (-426.865) (-424.170) (-428.695) [-428.734] -- 0:00:16
Average standard deviation of split frequencies: 0.006086
740500 -- (-426.869) [-423.976] (-426.949) (-426.826) * (-425.114) (-423.832) (-425.059) [-427.510] -- 0:00:16
741000 -- (-423.454) [-423.976] (-425.341) (-425.940) * (-424.945) (-424.128) (-428.367) [-425.232] -- 0:00:16
741500 -- (-426.590) [-425.197] (-425.689) (-424.403) * (-426.512) [-428.179] (-426.167) (-425.489) -- 0:00:16
742000 -- (-423.686) [-425.215] (-425.553) (-425.062) * [-424.821] (-425.739) (-424.780) (-426.436) -- 0:00:16
742500 -- (-424.091) (-425.316) (-425.570) [-425.270] * [-427.885] (-425.017) (-424.284) (-427.546) -- 0:00:16
743000 -- (-425.473) (-431.739) (-426.548) [-425.524] * [-425.256] (-427.829) (-425.546) (-425.930) -- 0:00:16
743500 -- (-424.844) (-426.489) (-425.543) [-425.243] * (-424.940) (-425.885) (-429.137) [-426.470] -- 0:00:16
744000 -- (-425.418) (-426.707) [-425.380] (-425.813) * (-424.691) (-425.737) (-426.762) [-425.200] -- 0:00:16
744500 -- [-425.985] (-426.908) (-427.547) (-424.005) * (-425.840) (-428.212) (-428.145) [-428.443] -- 0:00:16
745000 -- (-424.605) (-425.310) [-426.419] (-425.929) * (-428.501) (-424.485) [-429.650] (-426.867) -- 0:00:16
Average standard deviation of split frequencies: 0.006240
745500 -- (-425.415) (-428.902) [-425.471] (-424.313) * (-428.306) (-427.108) (-424.760) [-426.165] -- 0:00:16
746000 -- (-429.744) (-424.666) [-424.841] (-426.863) * (-426.360) (-425.975) (-424.047) [-425.799] -- 0:00:16
746500 -- (-426.016) [-425.285] (-428.362) (-425.222) * (-425.116) (-426.866) (-423.929) [-423.709] -- 0:00:15
747000 -- (-424.912) (-427.026) (-427.469) [-431.843] * (-425.267) (-423.739) (-425.496) [-427.326] -- 0:00:15
747500 -- (-428.265) (-426.111) [-428.285] (-426.896) * (-426.516) [-425.170] (-425.738) (-426.591) -- 0:00:15
748000 -- [-424.593] (-423.523) (-425.238) (-425.933) * (-425.718) (-427.938) [-425.949] (-427.150) -- 0:00:15
748500 -- [-426.900] (-426.256) (-429.602) (-426.140) * (-429.237) [-426.828] (-425.917) (-424.162) -- 0:00:15
749000 -- [-424.593] (-424.043) (-425.856) (-427.764) * (-425.788) (-424.268) (-425.984) [-425.398] -- 0:00:15
749500 -- (-425.778) (-424.685) (-427.258) [-429.600] * (-426.424) (-430.251) (-426.962) [-426.199] -- 0:00:15
750000 -- (-424.755) (-427.278) (-424.297) [-424.994] * (-424.663) [-427.188] (-428.790) (-428.155) -- 0:00:15
Average standard deviation of split frequencies: 0.006123
750500 -- [-425.476] (-428.546) (-425.668) (-426.626) * (-424.525) [-423.933] (-428.286) (-425.992) -- 0:00:15
751000 -- (-426.166) (-426.560) (-424.065) [-426.164] * (-426.585) [-425.774] (-424.969) (-426.698) -- 0:00:15
751500 -- (-431.194) [-431.506] (-426.212) (-426.737) * (-426.764) [-425.971] (-425.052) (-429.509) -- 0:00:15
752000 -- (-425.191) (-424.828) [-426.461] (-430.682) * (-425.750) [-427.773] (-425.114) (-425.813) -- 0:00:15
752500 -- (-426.939) [-424.877] (-424.354) (-428.477) * (-423.988) (-431.898) (-428.394) [-423.609] -- 0:00:15
753000 -- (-423.936) [-424.733] (-423.698) (-425.845) * [-426.214] (-425.905) (-424.047) (-424.994) -- 0:00:15
753500 -- (-424.842) (-427.189) (-425.058) [-425.828] * (-425.707) [-425.792] (-426.745) (-426.780) -- 0:00:15
754000 -- (-428.280) [-426.273] (-425.946) (-427.151) * (-428.619) (-427.155) (-426.144) [-427.521] -- 0:00:15
754500 -- (-428.726) [-424.705] (-426.306) (-427.878) * (-426.610) [-424.372] (-425.506) (-425.180) -- 0:00:15
755000 -- (-424.869) [-427.537] (-425.192) (-425.289) * [-426.061] (-425.588) (-425.395) (-423.718) -- 0:00:15
Average standard deviation of split frequencies: 0.005885
755500 -- (-426.523) [-428.734] (-425.130) (-425.404) * (-426.068) (-428.421) [-423.912] (-425.588) -- 0:00:15
756000 -- [-425.931] (-426.773) (-427.364) (-426.921) * [-423.985] (-428.397) (-425.546) (-424.560) -- 0:00:15
756500 -- (-428.886) (-430.300) [-430.407] (-424.247) * (-424.289) (-431.989) (-426.617) [-426.006] -- 0:00:15
757000 -- (-426.710) (-429.119) (-425.232) [-423.776] * [-426.293] (-424.990) (-424.551) (-425.057) -- 0:00:15
757500 -- (-426.080) (-430.366) [-428.545] (-423.723) * (-425.537) (-427.103) [-426.459] (-425.859) -- 0:00:15
758000 -- [-428.088] (-429.544) (-426.563) (-423.580) * (-425.863) (-424.254) [-425.194] (-427.812) -- 0:00:15
758500 -- (-423.933) (-425.682) (-425.890) [-425.867] * (-425.758) (-423.832) [-427.550] (-427.929) -- 0:00:15
759000 -- (-426.735) [-427.139] (-424.189) (-425.810) * (-423.976) (-425.790) [-426.764] (-428.612) -- 0:00:15
759500 -- [-428.897] (-427.832) (-425.229) (-427.405) * [-425.512] (-425.046) (-429.450) (-428.094) -- 0:00:15
760000 -- [-424.714] (-426.623) (-425.006) (-424.235) * (-424.786) (-426.516) (-426.204) [-425.729] -- 0:00:15
Average standard deviation of split frequencies: 0.005887
760500 -- (-428.268) [-423.887] (-425.696) (-423.527) * [-424.738] (-425.543) (-426.440) (-426.772) -- 0:00:15
761000 -- (-424.021) [-431.114] (-428.010) (-423.353) * (-424.766) (-426.117) (-425.899) [-426.833] -- 0:00:15
761500 -- (-424.662) (-425.950) (-426.871) [-423.372] * (-425.404) [-425.170] (-425.959) (-427.306) -- 0:00:15
762000 -- [-425.692] (-428.661) (-427.624) (-425.518) * (-425.441) (-424.131) [-425.308] (-424.063) -- 0:00:14
762500 -- (-428.327) (-425.023) [-424.411] (-425.536) * (-426.398) (-425.507) (-426.478) [-426.340] -- 0:00:14
763000 -- [-428.476] (-425.234) (-427.341) (-426.665) * (-429.707) [-424.466] (-424.607) (-425.732) -- 0:00:14
763500 -- [-425.590] (-427.505) (-426.280) (-427.012) * [-428.686] (-427.028) (-427.120) (-429.768) -- 0:00:14
764000 -- (-424.956) [-424.579] (-430.235) (-424.745) * (-426.057) (-426.749) (-427.960) [-425.091] -- 0:00:14
764500 -- (-425.204) (-424.362) (-427.280) [-425.443] * (-423.983) (-427.678) (-426.588) [-426.846] -- 0:00:14
765000 -- (-425.126) [-425.578] (-429.022) (-425.599) * [-425.321] (-426.951) (-429.674) (-426.951) -- 0:00:14
Average standard deviation of split frequencies: 0.006193
765500 -- (-424.510) (-427.836) [-425.103] (-427.651) * [-424.433] (-425.771) (-424.593) (-427.578) -- 0:00:14
766000 -- (-426.603) (-423.480) (-423.676) [-425.292] * [-424.550] (-426.363) (-427.609) (-428.298) -- 0:00:14
766500 -- (-427.253) (-423.538) (-424.569) [-424.946] * (-427.530) (-423.890) (-425.076) [-424.115] -- 0:00:14
767000 -- (-427.611) (-423.527) [-425.301] (-428.387) * (-428.092) [-427.047] (-428.725) (-425.092) -- 0:00:14
767500 -- [-427.518] (-423.835) (-425.656) (-429.194) * (-426.529) (-427.535) (-427.344) [-424.029] -- 0:00:14
768000 -- (-427.507) (-430.624) (-424.091) [-424.913] * [-425.075] (-425.317) (-426.158) (-427.013) -- 0:00:14
768500 -- (-426.503) (-425.266) [-424.463] (-425.644) * (-428.326) (-424.093) (-424.624) [-425.389] -- 0:00:14
769000 -- (-432.091) (-425.893) (-424.456) [-426.354] * [-425.585] (-424.713) (-424.188) (-426.668) -- 0:00:14
769500 -- (-429.636) [-427.320] (-425.029) (-427.267) * (-426.583) [-425.843] (-427.404) (-425.317) -- 0:00:14
770000 -- (-426.699) (-426.911) [-424.519] (-425.430) * (-425.969) (-426.551) [-426.237] (-425.051) -- 0:00:14
Average standard deviation of split frequencies: 0.006040
770500 -- (-426.601) (-428.671) [-424.207] (-424.758) * (-423.902) (-427.560) [-428.043] (-424.764) -- 0:00:14
771000 -- (-427.580) (-425.805) (-424.960) [-424.493] * (-425.152) (-428.257) [-428.433] (-425.158) -- 0:00:14
771500 -- (-428.222) [-427.084] (-424.141) (-425.753) * [-426.804] (-423.811) (-428.634) (-423.848) -- 0:00:14
772000 -- [-425.202] (-433.678) (-423.586) (-426.066) * (-425.044) (-427.294) (-424.469) [-425.006] -- 0:00:14
772500 -- (-427.810) (-431.621) (-423.589) [-423.572] * (-430.578) (-425.556) [-424.168] (-423.655) -- 0:00:14
773000 -- [-425.648] (-428.875) (-425.633) (-424.731) * (-426.449) (-424.590) (-424.721) [-425.128] -- 0:00:14
773500 -- (-428.450) [-424.316] (-424.465) (-424.839) * (-425.135) [-423.586] (-424.771) (-424.855) -- 0:00:14
774000 -- [-427.163] (-424.210) (-425.702) (-431.191) * (-426.226) [-423.942] (-425.780) (-426.083) -- 0:00:14
774500 -- (-425.418) (-424.246) [-424.124] (-425.549) * [-428.319] (-426.831) (-425.482) (-425.955) -- 0:00:14
775000 -- (-425.480) (-424.419) (-427.127) [-426.036] * [-424.780] (-431.053) (-424.515) (-424.848) -- 0:00:14
Average standard deviation of split frequencies: 0.005885
775500 -- [-426.901] (-429.318) (-424.723) (-425.137) * (-427.498) (-425.934) [-423.485] (-424.327) -- 0:00:14
776000 -- (-425.744) (-424.298) [-427.726] (-424.633) * (-424.207) [-425.908] (-424.501) (-426.961) -- 0:00:14
776500 -- (-429.809) (-426.982) [-425.074] (-428.131) * (-428.110) (-427.698) (-424.731) [-425.647] -- 0:00:14
777000 -- (-423.912) (-425.922) [-425.868] (-424.960) * [-424.072] (-425.568) (-426.156) (-431.011) -- 0:00:14
777500 -- (-426.158) (-425.566) [-426.607] (-427.857) * [-425.038] (-423.991) (-425.214) (-424.504) -- 0:00:14
778000 -- [-425.258] (-424.726) (-424.481) (-426.399) * (-425.681) (-424.429) [-426.177] (-423.572) -- 0:00:13
778500 -- [-423.569] (-425.157) (-429.124) (-423.990) * (-425.401) [-427.589] (-425.257) (-423.996) -- 0:00:13
779000 -- (-425.338) (-423.969) (-425.377) [-423.964] * (-427.372) (-430.501) (-426.151) [-426.148] -- 0:00:13
779500 -- (-424.824) (-424.009) [-426.495] (-426.624) * [-426.030] (-425.118) (-424.957) (-424.270) -- 0:00:13
780000 -- (-426.024) (-429.727) (-425.729) [-425.396] * (-428.239) [-425.418] (-427.302) (-425.332) -- 0:00:13
Average standard deviation of split frequencies: 0.005284
780500 -- (-427.862) (-426.945) (-424.307) [-424.842] * (-426.806) (-426.630) [-425.212] (-426.684) -- 0:00:13
781000 -- (-425.550) (-426.164) (-423.751) [-426.181] * (-425.031) (-426.095) (-425.559) [-425.551] -- 0:00:13
781500 -- [-429.529] (-423.802) (-424.222) (-425.744) * [-427.777] (-425.319) (-426.201) (-426.960) -- 0:00:13
782000 -- (-425.715) (-425.040) (-427.627) [-426.360] * (-426.059) (-425.494) [-426.552] (-427.124) -- 0:00:13
782500 -- (-424.357) (-423.837) [-424.911] (-426.837) * [-424.458] (-426.139) (-427.456) (-426.803) -- 0:00:13
783000 -- [-425.593] (-424.418) (-424.376) (-435.461) * [-424.446] (-430.649) (-424.354) (-427.196) -- 0:00:13
783500 -- [-425.828] (-425.917) (-427.533) (-436.058) * [-427.810] (-424.614) (-425.499) (-424.151) -- 0:00:13
784000 -- (-424.589) (-428.329) [-430.791] (-429.434) * (-424.326) (-427.120) [-425.671] (-424.989) -- 0:00:13
784500 -- (-427.897) (-426.969) (-426.011) [-425.996] * (-424.106) (-430.098) (-426.635) [-428.135] -- 0:00:13
785000 -- (-426.258) (-425.481) (-424.569) [-425.376] * (-425.938) (-427.109) (-424.659) [-424.426] -- 0:00:13
Average standard deviation of split frequencies: 0.005623
785500 -- [-424.628] (-424.094) (-425.530) (-428.269) * [-426.338] (-427.563) (-427.439) (-424.751) -- 0:00:13
786000 -- (-424.392) [-424.591] (-426.557) (-426.116) * (-425.147) (-430.393) [-425.515] (-425.402) -- 0:00:13
786500 -- (-423.765) [-424.266] (-429.024) (-427.604) * [-424.531] (-427.582) (-433.769) (-425.647) -- 0:00:13
787000 -- (-425.881) [-425.037] (-424.318) (-424.854) * [-424.236] (-427.896) (-429.260) (-426.471) -- 0:00:13
787500 -- (-423.587) (-423.886) [-427.726] (-426.294) * [-426.901] (-425.046) (-428.851) (-423.847) -- 0:00:13
788000 -- (-427.854) [-424.477] (-427.081) (-427.438) * (-426.501) (-423.849) [-423.828] (-427.020) -- 0:00:13
788500 -- (-425.968) (-424.790) (-424.303) [-426.218] * (-425.134) (-425.841) (-424.095) [-425.681] -- 0:00:13
789000 -- (-427.659) (-424.150) [-425.530] (-424.472) * (-426.326) [-425.324] (-424.492) (-426.211) -- 0:00:13
789500 -- [-424.840] (-423.932) (-426.307) (-433.908) * [-425.924] (-425.873) (-425.563) (-427.720) -- 0:00:13
790000 -- (-424.717) (-423.839) [-425.533] (-426.736) * (-426.381) (-427.854) [-425.660] (-427.084) -- 0:00:13
Average standard deviation of split frequencies: 0.005888
790500 -- (-426.268) (-425.838) [-428.654] (-427.234) * (-426.192) [-426.185] (-424.136) (-431.795) -- 0:00:12
791000 -- [-427.507] (-425.857) (-426.584) (-424.862) * (-428.247) [-426.280] (-427.115) (-426.810) -- 0:00:13
791500 -- (-427.482) (-424.792) [-424.182] (-426.522) * [-429.306] (-425.839) (-425.533) (-425.933) -- 0:00:13
792000 -- (-427.555) [-425.583] (-427.172) (-425.751) * (-424.776) [-426.035] (-425.529) (-425.787) -- 0:00:13
792500 -- (-427.832) [-424.884] (-426.234) (-426.599) * [-426.161] (-423.969) (-426.381) (-426.715) -- 0:00:13
793000 -- (-427.226) [-423.827] (-425.596) (-426.695) * [-424.397] (-425.685) (-426.491) (-427.557) -- 0:00:13
793500 -- (-427.585) (-424.817) (-425.955) [-427.777] * (-424.872) [-425.847] (-427.156) (-427.034) -- 0:00:13
794000 -- (-427.714) (-427.379) (-425.588) [-425.439] * (-424.215) [-425.108] (-429.685) (-423.734) -- 0:00:12
794500 -- (-424.720) (-427.400) (-426.373) [-426.718] * (-424.174) (-424.276) (-428.518) [-425.567] -- 0:00:12
795000 -- [-424.725] (-425.229) (-429.507) (-423.505) * (-426.706) (-425.856) [-423.816] (-427.760) -- 0:00:12
Average standard deviation of split frequencies: 0.005885
795500 -- (-430.990) (-424.362) [-427.185] (-424.425) * (-425.105) [-425.445] (-424.199) (-426.633) -- 0:00:12
796000 -- (-424.408) [-425.464] (-424.335) (-427.109) * (-423.623) (-425.652) [-425.417] (-425.557) -- 0:00:12
796500 -- (-426.979) (-425.611) [-429.381] (-427.017) * (-425.366) [-427.482] (-425.840) (-425.588) -- 0:00:12
797000 -- (-434.416) [-425.511] (-424.000) (-425.490) * (-424.336) (-424.636) [-425.688] (-424.915) -- 0:00:12
797500 -- (-425.114) (-425.934) (-426.317) [-426.977] * (-426.518) [-424.360] (-425.545) (-426.911) -- 0:00:12
798000 -- (-427.545) [-424.048] (-427.079) (-427.103) * (-426.286) (-424.373) [-425.246] (-426.484) -- 0:00:12
798500 -- (-424.751) (-427.188) [-426.525] (-423.830) * (-425.655) [-424.525] (-425.608) (-425.216) -- 0:00:12
799000 -- (-429.439) (-430.485) (-425.621) [-424.656] * (-423.840) (-430.360) [-425.648] (-425.107) -- 0:00:12
799500 -- (-428.120) (-425.575) [-429.110] (-430.836) * [-428.027] (-426.643) (-424.018) (-424.564) -- 0:00:12
800000 -- [-428.859] (-425.315) (-429.322) (-429.448) * (-425.597) (-428.350) [-424.012] (-429.283) -- 0:00:12
Average standard deviation of split frequencies: 0.006366
800500 -- (-425.739) [-424.541] (-432.987) (-426.855) * (-426.550) (-426.402) (-425.250) [-426.491] -- 0:00:12
801000 -- (-426.630) (-427.542) (-424.546) [-426.196] * (-427.239) (-427.405) [-426.802] (-424.783) -- 0:00:12
801500 -- [-428.999] (-425.590) (-432.131) (-424.374) * (-426.038) (-427.872) (-425.821) [-426.874] -- 0:00:12
802000 -- [-426.890] (-425.526) (-428.783) (-424.783) * (-424.098) [-426.674] (-424.665) (-425.729) -- 0:00:12
802500 -- (-424.467) (-430.521) (-426.575) [-425.030] * (-425.188) (-425.001) [-424.482] (-426.532) -- 0:00:12
803000 -- [-423.905] (-433.480) (-429.901) (-428.151) * (-424.538) (-426.081) (-426.484) [-425.331] -- 0:00:12
803500 -- (-426.678) (-432.073) (-427.345) [-427.302] * (-431.229) (-425.770) (-426.383) [-427.485] -- 0:00:12
804000 -- (-424.519) (-430.823) [-424.202] (-423.966) * (-430.509) [-425.632] (-426.703) (-427.902) -- 0:00:12
804500 -- (-426.247) (-430.326) [-423.736] (-428.622) * (-429.148) (-424.335) (-427.206) [-425.588] -- 0:00:12
805000 -- (-428.979) [-427.201] (-423.796) (-424.307) * (-429.507) [-424.185] (-425.787) (-425.265) -- 0:00:12
Average standard deviation of split frequencies: 0.007225
805500 -- (-429.491) [-426.358] (-424.714) (-431.715) * (-426.659) (-425.695) [-424.969] (-426.932) -- 0:00:12
806000 -- (-425.610) (-428.778) [-426.839] (-426.572) * (-426.924) [-425.174] (-427.687) (-426.167) -- 0:00:12
806500 -- (-425.805) (-426.840) [-426.727] (-424.837) * (-426.430) [-425.004] (-425.699) (-427.202) -- 0:00:11
807000 -- (-425.242) (-426.776) [-430.059] (-428.413) * (-425.478) [-424.131] (-425.511) (-428.219) -- 0:00:11
807500 -- (-429.231) [-425.745] (-427.060) (-424.485) * (-426.034) [-425.369] (-427.190) (-432.158) -- 0:00:11
808000 -- (-428.793) (-423.766) (-423.896) [-424.377] * (-424.703) (-424.924) (-424.382) [-425.728] -- 0:00:11
808500 -- [-424.509] (-425.289) (-428.557) (-430.682) * (-427.159) [-424.277] (-428.542) (-424.989) -- 0:00:12
809000 -- (-424.405) (-427.294) (-424.796) [-425.773] * (-425.419) [-423.597] (-428.109) (-427.637) -- 0:00:12
809500 -- (-427.799) (-426.544) [-426.316] (-424.122) * (-428.610) (-423.945) [-426.310] (-425.463) -- 0:00:12
810000 -- (-423.758) [-426.249] (-426.168) (-429.247) * (-426.641) (-426.693) (-425.603) [-424.690] -- 0:00:11
Average standard deviation of split frequencies: 0.006324
810500 -- (-426.828) [-426.374] (-423.851) (-427.659) * (-424.074) (-427.356) (-425.557) [-426.185] -- 0:00:11
811000 -- (-427.736) [-425.696] (-423.821) (-426.818) * (-427.005) (-428.857) (-428.041) [-425.988] -- 0:00:11
811500 -- (-425.199) (-427.184) [-424.228] (-424.960) * (-423.936) (-429.155) [-425.095] (-427.888) -- 0:00:11
812000 -- [-425.216] (-425.109) (-426.459) (-423.794) * (-426.466) (-426.906) (-425.698) [-425.104] -- 0:00:11
812500 -- (-428.129) [-423.926] (-427.824) (-425.360) * (-426.457) (-425.087) [-424.622] (-424.571) -- 0:00:11
813000 -- (-429.646) (-425.355) [-425.637] (-424.762) * [-426.248] (-424.005) (-423.894) (-424.913) -- 0:00:11
813500 -- (-425.453) (-424.256) (-424.136) [-426.008] * (-426.697) (-425.954) [-424.760] (-426.121) -- 0:00:11
814000 -- (-424.891) (-425.926) [-423.896] (-425.786) * (-427.244) [-426.637] (-427.429) (-424.904) -- 0:00:11
814500 -- [-424.331] (-425.815) (-425.166) (-425.565) * (-424.486) (-426.898) [-426.539] (-427.160) -- 0:00:11
815000 -- [-424.795] (-424.121) (-427.342) (-426.354) * (-427.526) (-426.432) [-426.039] (-424.962) -- 0:00:11
Average standard deviation of split frequencies: 0.007034
815500 -- (-423.997) (-426.266) (-425.134) [-427.018] * [-424.756] (-427.102) (-426.536) (-426.825) -- 0:00:11
816000 -- (-426.731) (-425.953) [-425.560] (-425.419) * (-423.831) [-426.046] (-428.793) (-424.520) -- 0:00:11
816500 -- (-426.346) (-426.443) [-424.117] (-424.327) * (-428.025) [-428.212] (-424.650) (-425.409) -- 0:00:11
817000 -- (-426.508) [-425.500] (-425.373) (-425.737) * (-428.966) [-425.639] (-425.205) (-425.727) -- 0:00:11
817500 -- (-427.039) (-425.171) (-428.071) [-425.557] * (-428.967) [-424.268] (-424.430) (-428.283) -- 0:00:11
818000 -- (-425.597) (-425.272) [-429.453] (-425.871) * (-430.963) (-424.128) (-426.006) [-424.243] -- 0:00:11
818500 -- (-426.881) (-425.995) (-425.571) [-424.225] * (-426.639) [-424.711] (-427.018) (-425.446) -- 0:00:11
819000 -- (-424.290) (-427.337) [-424.546] (-426.298) * (-434.480) (-426.287) [-424.450] (-425.053) -- 0:00:11
819500 -- (-427.042) [-427.559] (-427.592) (-424.467) * [-430.298] (-426.899) (-424.644) (-425.994) -- 0:00:11
820000 -- [-427.101] (-430.832) (-425.732) (-428.820) * [-424.993] (-426.001) (-429.312) (-427.272) -- 0:00:11
Average standard deviation of split frequencies: 0.007028
820500 -- (-425.863) (-424.578) (-425.387) [-424.583] * (-425.755) [-430.747] (-428.440) (-424.230) -- 0:00:11
821000 -- [-426.587] (-426.867) (-430.257) (-425.175) * (-429.044) (-430.671) (-430.521) [-428.153] -- 0:00:11
821500 -- (-427.775) [-423.733] (-423.998) (-424.953) * (-431.124) [-427.738] (-427.656) (-427.309) -- 0:00:11
822000 -- (-428.004) (-426.486) [-428.060] (-424.333) * (-425.140) [-425.643] (-432.222) (-425.327) -- 0:00:11
822500 -- (-430.765) (-427.053) (-427.436) [-424.477] * (-424.848) (-427.945) (-429.583) [-425.559] -- 0:00:11
823000 -- (-425.915) [-424.906] (-424.992) (-426.538) * (-425.444) (-424.663) (-428.368) [-424.947] -- 0:00:10
823500 -- [-424.749] (-424.196) (-426.528) (-424.106) * (-423.877) (-423.519) [-426.624] (-424.111) -- 0:00:10
824000 -- (-426.888) [-425.343] (-426.542) (-426.611) * (-427.187) (-430.731) [-428.068] (-426.867) -- 0:00:10
824500 -- [-425.722] (-430.683) (-432.326) (-432.494) * (-426.319) (-425.259) [-424.022] (-428.427) -- 0:00:10
825000 -- [-424.048] (-426.446) (-427.294) (-426.054) * (-427.199) (-424.507) [-425.472] (-424.932) -- 0:00:10
Average standard deviation of split frequencies: 0.006714
825500 -- [-424.966] (-426.216) (-425.555) (-428.251) * (-425.724) [-425.801] (-424.364) (-427.879) -- 0:00:10
826000 -- (-424.606) (-433.786) (-424.276) [-425.143] * (-426.408) (-433.045) (-426.957) [-426.805] -- 0:00:10
826500 -- [-425.318] (-428.436) (-424.189) (-424.518) * (-426.077) (-425.839) [-423.668] (-426.813) -- 0:00:10
827000 -- [-427.148] (-430.917) (-426.012) (-425.351) * (-425.563) (-425.488) [-425.712] (-427.805) -- 0:00:10
827500 -- [-423.872] (-425.549) (-425.738) (-427.040) * (-427.159) (-428.645) [-426.230] (-424.894) -- 0:00:10
828000 -- (-424.352) (-425.440) [-428.956] (-426.316) * (-426.282) (-424.984) (-424.463) [-424.632] -- 0:00:10
828500 -- (-424.534) (-426.643) [-427.412] (-425.917) * (-424.449) (-425.910) [-423.939] (-426.369) -- 0:00:10
829000 -- (-429.262) (-429.293) (-425.367) [-428.216] * (-425.477) [-427.810] (-426.521) (-427.349) -- 0:00:10
829500 -- (-429.391) (-426.466) (-424.942) [-425.759] * (-428.849) (-432.116) (-426.111) [-425.289] -- 0:00:10
830000 -- (-425.310) (-424.288) (-425.101) [-427.309] * [-427.358] (-427.852) (-427.231) (-426.897) -- 0:00:10
Average standard deviation of split frequencies: 0.007010
830500 -- (-433.791) (-423.912) (-425.172) [-425.764] * [-425.489] (-432.960) (-424.055) (-426.934) -- 0:00:10
831000 -- [-428.246] (-424.675) (-425.620) (-424.527) * (-426.832) (-427.592) [-425.146] (-427.598) -- 0:00:10
831500 -- (-426.089) (-424.902) (-426.011) [-424.032] * (-423.814) (-427.678) [-424.071] (-427.267) -- 0:00:10
832000 -- (-425.841) (-425.964) (-425.224) [-425.085] * (-424.622) (-427.868) (-423.869) [-427.053] -- 0:00:10
832500 -- (-430.742) (-424.268) [-427.493] (-425.424) * [-424.563] (-425.745) (-425.521) (-427.198) -- 0:00:10
833000 -- (-427.297) (-425.732) (-426.349) [-429.560] * [-425.482] (-426.139) (-431.848) (-429.991) -- 0:00:10
833500 -- (-424.863) (-424.704) (-424.816) [-426.300] * (-426.101) (-425.998) (-426.850) [-426.933] -- 0:00:10
834000 -- [-425.121] (-425.269) (-426.143) (-424.298) * [-425.359] (-423.584) (-430.616) (-424.922) -- 0:00:10
834500 -- (-427.073) (-424.865) (-427.277) [-424.971] * (-423.898) (-428.967) (-427.827) [-425.295] -- 0:00:10
835000 -- [-428.590] (-423.992) (-427.559) (-425.245) * [-429.082] (-428.622) (-426.314) (-430.048) -- 0:00:10
Average standard deviation of split frequencies: 0.006026
835500 -- (-425.162) [-424.476] (-427.297) (-427.946) * [-426.346] (-425.184) (-425.327) (-425.091) -- 0:00:10
836000 -- (-426.869) (-424.034) [-424.800] (-424.671) * (-426.150) (-425.563) [-424.201] (-424.232) -- 0:00:10
836500 -- (-425.830) (-429.560) (-431.574) [-425.207] * [-425.722] (-426.200) (-424.223) (-426.034) -- 0:00:10
837000 -- (-424.786) [-424.862] (-424.726) (-425.222) * (-426.227) (-426.942) (-426.561) [-424.567] -- 0:00:10
837500 -- (-428.074) (-425.295) (-427.230) [-424.154] * (-426.135) [-427.980] (-427.217) (-425.308) -- 0:00:10
838000 -- [-426.247] (-425.984) (-427.876) (-425.135) * (-427.831) (-431.549) (-425.381) [-426.696] -- 0:00:10
838500 -- (-427.951) [-424.905] (-429.317) (-425.041) * (-427.468) (-428.631) (-428.052) [-424.707] -- 0:00:10
839000 -- (-424.696) (-426.253) (-426.979) [-424.280] * (-426.735) [-424.363] (-428.828) (-425.718) -- 0:00:09
839500 -- (-424.324) (-424.453) [-425.297] (-430.944) * (-423.980) (-424.414) (-429.355) [-425.182] -- 0:00:09
840000 -- (-425.592) (-427.397) (-425.606) [-425.880] * (-427.702) (-425.003) (-428.045) [-424.515] -- 0:00:09
Average standard deviation of split frequencies: 0.006960
840500 -- (-424.929) (-426.180) [-427.253] (-424.814) * (-426.917) (-426.266) [-427.026] (-423.805) -- 0:00:09
841000 -- (-424.262) (-425.649) (-428.247) [-428.046] * (-426.946) (-426.423) [-427.334] (-429.408) -- 0:00:09
841500 -- (-424.564) [-425.315] (-426.982) (-426.034) * (-426.773) [-424.332] (-425.790) (-427.187) -- 0:00:09
842000 -- (-424.472) (-424.594) [-427.408] (-426.174) * (-424.809) (-424.377) [-424.420] (-425.310) -- 0:00:09
842500 -- (-425.704) (-425.605) [-423.965] (-426.379) * (-429.883) (-423.933) (-424.433) [-426.850] -- 0:00:09
843000 -- (-430.099) (-426.949) (-424.445) [-424.935] * (-424.837) [-424.497] (-424.335) (-424.547) -- 0:00:09
843500 -- (-425.529) (-425.100) (-427.798) [-424.535] * (-424.026) [-426.141] (-426.512) (-423.942) -- 0:00:09
844000 -- (-426.303) (-423.887) (-427.924) [-425.884] * [-424.793] (-426.084) (-431.864) (-425.218) -- 0:00:09
844500 -- (-424.256) [-425.534] (-426.380) (-425.633) * (-425.569) (-429.614) [-425.694] (-426.837) -- 0:00:09
845000 -- (-426.831) (-424.691) (-426.986) [-424.922] * [-424.275] (-423.624) (-427.267) (-424.352) -- 0:00:09
Average standard deviation of split frequencies: 0.007539
845500 -- (-424.800) (-424.480) (-425.722) [-424.690] * [-426.054] (-424.660) (-426.189) (-427.071) -- 0:00:09
846000 -- (-427.650) [-425.066] (-426.081) (-430.235) * (-425.175) [-425.374] (-424.851) (-428.706) -- 0:00:09
846500 -- (-426.722) [-424.499] (-426.167) (-427.073) * [-424.227] (-428.518) (-424.573) (-424.468) -- 0:00:09
847000 -- (-427.229) (-427.467) (-426.415) [-428.457] * (-428.296) (-428.876) (-430.103) [-427.591] -- 0:00:09
847500 -- (-427.874) [-431.544] (-424.793) (-424.454) * (-428.704) (-429.236) (-426.510) [-424.182] -- 0:00:09
848000 -- (-431.637) (-429.256) (-424.692) [-423.928] * (-432.737) (-426.606) (-426.286) [-424.722] -- 0:00:09
848500 -- (-430.040) (-425.077) [-427.005] (-423.782) * (-430.839) (-429.118) [-427.574] (-423.979) -- 0:00:09
849000 -- [-428.535] (-424.667) (-425.531) (-424.390) * [-424.989] (-425.870) (-425.830) (-423.850) -- 0:00:09
849500 -- (-428.065) (-425.809) (-428.005) [-424.950] * (-425.236) [-424.926] (-425.377) (-424.695) -- 0:00:09
850000 -- (-425.120) [-429.096] (-425.029) (-425.695) * (-429.269) (-425.408) (-428.874) [-426.483] -- 0:00:09
Average standard deviation of split frequencies: 0.007302
850500 -- (-426.013) (-425.748) [-423.878] (-426.453) * (-428.984) (-427.217) [-428.304] (-424.981) -- 0:00:09
851000 -- [-424.856] (-427.917) (-425.321) (-427.508) * (-426.205) (-426.101) (-428.084) [-424.325] -- 0:00:09
851500 -- [-425.126] (-424.381) (-425.578) (-425.595) * [-425.011] (-425.726) (-430.259) (-424.883) -- 0:00:09
852000 -- (-424.336) (-424.395) (-426.096) [-424.625] * (-424.812) (-427.522) [-426.918] (-427.817) -- 0:00:09
852500 -- [-428.761] (-423.769) (-427.122) (-424.042) * (-426.911) (-427.248) [-424.746] (-425.165) -- 0:00:09
853000 -- (-427.705) [-426.908] (-427.165) (-428.262) * (-425.507) (-425.534) (-424.915) [-424.955] -- 0:00:09
853500 -- (-428.118) [-428.031] (-423.741) (-427.247) * (-423.887) [-426.486] (-426.991) (-424.718) -- 0:00:09
854000 -- [-428.244] (-429.504) (-424.851) (-425.084) * (-426.596) [-428.158] (-427.021) (-425.171) -- 0:00:09
854500 -- [-424.420] (-425.220) (-424.574) (-424.755) * (-424.847) [-426.576] (-424.748) (-426.094) -- 0:00:09
855000 -- (-426.949) (-425.366) (-429.536) [-426.173] * (-426.452) (-424.438) (-432.902) [-426.252] -- 0:00:09
Average standard deviation of split frequencies: 0.007062
855500 -- (-427.101) (-426.798) [-426.651] (-424.634) * (-425.480) (-426.031) [-425.029] (-426.303) -- 0:00:09
856000 -- (-425.790) (-428.286) (-424.527) [-424.969] * (-425.619) (-431.866) (-428.999) [-425.703] -- 0:00:09
856500 -- [-423.760] (-425.246) (-425.014) (-426.654) * (-426.474) [-428.104] (-427.693) (-427.152) -- 0:00:09
857000 -- [-424.349] (-425.912) (-427.328) (-427.887) * (-426.344) (-425.665) [-426.561] (-424.225) -- 0:00:09
857500 -- (-424.996) [-425.770] (-426.782) (-428.620) * (-424.517) (-427.393) [-423.582] (-425.428) -- 0:00:08
858000 -- (-424.928) [-428.882] (-426.818) (-425.335) * (-425.848) [-425.629] (-425.147) (-426.672) -- 0:00:08
858500 -- (-427.671) [-430.520] (-425.309) (-429.370) * (-429.239) (-430.236) (-423.856) [-429.628] -- 0:00:08
859000 -- [-424.987] (-428.100) (-424.079) (-424.028) * [-424.793] (-427.505) (-423.481) (-425.246) -- 0:00:08
859500 -- [-424.661] (-425.267) (-423.733) (-424.812) * (-425.720) (-425.793) (-427.451) [-429.528] -- 0:00:08
860000 -- [-424.259] (-426.029) (-427.448) (-425.352) * (-428.456) [-423.912] (-424.305) (-427.228) -- 0:00:08
Average standard deviation of split frequencies: 0.007507
860500 -- [-427.466] (-427.015) (-426.080) (-428.696) * [-426.764] (-426.149) (-424.284) (-425.191) -- 0:00:08
861000 -- (-427.835) (-428.308) [-429.155] (-427.316) * (-425.389) (-427.985) [-423.736] (-428.307) -- 0:00:08
861500 -- (-427.453) (-425.749) [-429.776] (-429.425) * (-425.634) (-424.242) (-424.845) [-424.916] -- 0:00:08
862000 -- (-426.248) (-424.645) (-426.583) [-426.886] * (-428.428) (-423.770) (-425.334) [-425.068] -- 0:00:08
862500 -- (-429.908) (-424.516) [-425.361] (-425.460) * (-426.379) (-427.244) [-424.304] (-425.210) -- 0:00:08
863000 -- (-425.116) (-423.480) (-425.634) [-430.059] * (-427.589) (-424.926) (-425.821) [-424.651] -- 0:00:08
863500 -- [-425.562] (-424.622) (-425.069) (-426.160) * (-428.125) [-428.333] (-424.335) (-424.703) -- 0:00:08
864000 -- [-426.470] (-425.267) (-425.009) (-428.001) * (-425.169) (-427.282) (-424.148) [-424.287] -- 0:00:08
864500 -- (-427.152) [-424.277] (-424.784) (-429.290) * (-425.205) (-430.193) (-424.383) [-428.887] -- 0:00:08
865000 -- (-426.402) [-425.808] (-426.179) (-427.209) * (-424.708) [-426.844] (-424.586) (-429.109) -- 0:00:08
Average standard deviation of split frequencies: 0.007749
865500 -- (-425.257) (-427.339) (-426.609) [-424.205] * [-425.654] (-428.639) (-425.909) (-430.060) -- 0:00:08
866000 -- (-426.311) (-430.851) [-429.644] (-424.689) * [-424.204] (-426.565) (-425.857) (-426.237) -- 0:00:08
866500 -- (-426.676) [-424.754] (-427.841) (-425.162) * (-426.335) (-426.378) (-424.156) [-424.186] -- 0:00:08
867000 -- (-433.246) (-428.243) [-428.884] (-425.114) * (-427.195) (-423.944) (-427.407) [-425.689] -- 0:00:08
867500 -- [-427.263] (-425.921) (-423.945) (-425.169) * [-427.934] (-425.178) (-430.176) (-426.766) -- 0:00:08
868000 -- [-427.698] (-425.046) (-426.361) (-427.471) * [-425.074] (-425.650) (-424.439) (-428.456) -- 0:00:08
868500 -- (-428.799) (-429.696) (-424.301) [-427.400] * (-426.704) [-425.233] (-426.193) (-427.152) -- 0:00:08
869000 -- (-428.379) [-423.594] (-425.490) (-425.227) * (-428.611) (-425.800) (-426.008) [-426.625] -- 0:00:08
869500 -- [-425.677] (-425.235) (-426.563) (-427.170) * (-426.048) (-423.908) (-426.287) [-424.811] -- 0:00:08
870000 -- (-428.877) (-424.926) [-424.652] (-424.809) * (-427.367) (-424.335) [-425.752] (-425.420) -- 0:00:08
Average standard deviation of split frequencies: 0.008153
870500 -- (-428.113) [-425.402] (-425.198) (-426.435) * (-430.858) [-426.933] (-423.932) (-428.966) -- 0:00:08
871000 -- (-425.735) (-426.950) (-427.127) [-428.220] * (-425.165) (-426.794) (-424.434) [-429.810] -- 0:00:08
871500 -- (-427.752) [-426.095] (-428.081) (-427.317) * [-425.907] (-429.859) (-424.716) (-425.431) -- 0:00:08
872000 -- (-424.807) [-425.173] (-426.070) (-424.922) * (-424.527) (-431.390) (-424.975) [-426.187] -- 0:00:08
872500 -- (-426.352) [-423.786] (-424.999) (-424.874) * (-425.815) [-429.855] (-425.259) (-427.261) -- 0:00:08
873000 -- [-425.255] (-427.059) (-423.685) (-425.007) * (-425.915) [-425.525] (-426.333) (-428.110) -- 0:00:08
873500 -- [-425.669] (-427.476) (-423.746) (-427.329) * [-424.241] (-425.042) (-427.282) (-427.156) -- 0:00:08
874000 -- [-425.134] (-425.743) (-424.071) (-428.382) * (-426.541) [-424.462] (-427.527) (-424.242) -- 0:00:08
874500 -- (-424.087) (-425.206) (-427.644) [-424.151] * (-426.668) [-424.499] (-429.124) (-427.145) -- 0:00:08
875000 -- (-425.297) [-425.492] (-424.279) (-423.981) * [-427.165] (-425.185) (-430.450) (-426.172) -- 0:00:08
Average standard deviation of split frequencies: 0.008357
875500 -- (-426.170) (-424.087) (-426.589) [-423.984] * (-428.668) [-426.509] (-432.690) (-423.709) -- 0:00:07
876000 -- [-425.865] (-426.967) (-426.178) (-426.243) * (-425.704) (-426.633) (-425.273) [-424.233] -- 0:00:07
876500 -- [-424.295] (-424.684) (-424.592) (-426.365) * (-423.702) (-424.940) [-423.672] (-426.708) -- 0:00:07
877000 -- (-431.261) (-425.911) (-425.453) [-427.871] * [-424.770] (-426.223) (-426.190) (-425.917) -- 0:00:07
877500 -- [-423.785] (-431.038) (-427.523) (-426.249) * [-424.313] (-425.805) (-426.558) (-425.439) -- 0:00:07
878000 -- (-426.299) [-428.621] (-426.949) (-427.637) * (-425.209) [-428.448] (-428.403) (-425.335) -- 0:00:07
878500 -- (-427.337) [-428.131] (-424.556) (-423.798) * [-426.617] (-428.239) (-429.133) (-423.851) -- 0:00:07
879000 -- (-426.939) (-424.957) (-427.490) [-427.768] * (-427.456) (-426.607) [-424.064] (-425.582) -- 0:00:07
879500 -- (-427.503) (-425.832) [-431.246] (-424.768) * [-427.645] (-426.351) (-423.775) (-425.723) -- 0:00:07
880000 -- [-426.701] (-425.997) (-434.237) (-427.116) * (-429.179) (-424.485) (-426.386) [-430.862] -- 0:00:07
Average standard deviation of split frequencies: 0.008344
880500 -- (-428.803) (-428.310) [-426.503] (-423.910) * [-424.865] (-427.312) (-425.481) (-426.700) -- 0:00:07
881000 -- (-427.160) (-427.673) (-427.757) [-423.910] * (-424.760) (-426.967) (-427.220) [-426.203] -- 0:00:07
881500 -- [-424.054] (-429.190) (-426.789) (-424.478) * (-425.095) (-428.120) (-423.884) [-429.448] -- 0:00:07
882000 -- [-425.531] (-426.166) (-428.224) (-426.074) * (-428.272) [-426.611] (-426.423) (-424.978) -- 0:00:07
882500 -- (-425.785) (-427.538) (-425.258) [-424.516] * (-424.481) (-427.714) [-424.370] (-424.314) -- 0:00:07
883000 -- [-428.980] (-428.084) (-424.787) (-425.640) * (-426.975) (-429.959) [-426.225] (-427.015) -- 0:00:07
883500 -- [-424.375] (-427.295) (-425.424) (-423.744) * [-424.635] (-425.570) (-424.863) (-431.261) -- 0:00:07
884000 -- (-425.725) [-424.631] (-423.996) (-424.326) * (-426.204) [-427.240] (-425.698) (-425.524) -- 0:00:07
884500 -- [-427.884] (-426.330) (-424.764) (-425.497) * [-427.178] (-426.917) (-425.561) (-425.427) -- 0:00:07
885000 -- [-428.863] (-425.495) (-426.131) (-425.064) * (-424.692) (-425.323) (-426.757) [-424.786] -- 0:00:07
Average standard deviation of split frequencies: 0.008231
885500 -- (-425.895) [-427.903] (-426.194) (-426.739) * (-424.835) [-424.712] (-427.413) (-426.746) -- 0:00:07
886000 -- (-429.018) (-425.853) [-425.796] (-424.599) * (-424.499) (-428.329) [-426.159] (-424.183) -- 0:00:07
886500 -- (-430.415) (-426.007) (-425.822) [-424.178] * (-426.961) (-428.014) (-424.683) [-430.281] -- 0:00:07
887000 -- [-426.124] (-427.868) (-426.620) (-427.294) * [-425.339] (-425.023) (-424.360) (-425.012) -- 0:00:07
887500 -- (-428.171) [-428.887] (-426.210) (-426.480) * (-429.755) (-425.347) [-426.604] (-425.746) -- 0:00:07
888000 -- (-426.063) (-424.572) (-425.535) [-424.868] * (-426.398) (-428.465) [-426.431] (-426.224) -- 0:00:07
888500 -- (-429.108) (-433.227) (-425.053) [-425.546] * (-424.657) (-425.097) (-425.557) [-429.270] -- 0:00:07
889000 -- [-424.905] (-425.829) (-425.361) (-428.421) * (-425.461) (-427.371) (-424.481) [-425.849] -- 0:00:07
889500 -- (-425.246) (-425.446) [-427.899] (-427.072) * (-424.929) (-427.261) [-424.415] (-426.217) -- 0:00:07
890000 -- [-423.773] (-424.558) (-427.269) (-424.304) * (-425.225) (-424.510) [-424.317] (-425.824) -- 0:00:07
Average standard deviation of split frequencies: 0.007877
890500 -- (-424.186) [-428.274] (-427.732) (-424.977) * (-427.896) (-425.062) [-424.468] (-430.254) -- 0:00:07
891000 -- (-428.251) (-429.035) [-424.022] (-424.873) * (-426.445) (-426.008) [-426.569] (-431.770) -- 0:00:07
891500 -- (-424.742) (-426.264) (-425.050) [-432.231] * (-423.749) (-423.987) [-425.421] (-427.649) -- 0:00:07
892000 -- (-428.200) (-426.793) (-428.295) [-425.025] * [-425.204] (-424.998) (-427.128) (-425.840) -- 0:00:07
892500 -- [-424.570] (-423.599) (-426.674) (-427.814) * [-425.806] (-427.457) (-424.443) (-426.120) -- 0:00:06
893000 -- [-424.202] (-425.831) (-426.919) (-425.019) * (-426.446) [-426.286] (-425.106) (-425.153) -- 0:00:06
893500 -- (-428.543) [-426.807] (-425.869) (-424.512) * (-426.866) (-424.711) (-426.459) [-425.593] -- 0:00:06
894000 -- (-426.404) (-426.297) (-426.155) [-429.165] * (-427.810) [-424.476] (-425.473) (-424.420) -- 0:00:06
894500 -- [-423.741] (-425.457) (-425.798) (-423.769) * (-426.369) (-427.478) (-426.547) [-424.528] -- 0:00:06
895000 -- (-426.769) [-427.143] (-426.761) (-424.435) * (-427.767) [-429.992] (-430.160) (-424.635) -- 0:00:06
Average standard deviation of split frequencies: 0.008356
895500 -- [-424.310] (-429.775) (-426.564) (-426.011) * (-424.806) [-426.826] (-426.004) (-424.364) -- 0:00:06
896000 -- (-423.885) (-430.824) [-427.867] (-433.151) * (-425.534) [-425.435] (-427.043) (-427.472) -- 0:00:06
896500 -- (-429.267) (-424.394) (-425.024) [-425.688] * (-430.973) (-425.195) (-426.772) [-426.728] -- 0:00:06
897000 -- (-424.956) (-425.060) [-424.773] (-425.818) * [-426.122] (-425.527) (-425.659) (-428.833) -- 0:00:06
897500 -- (-427.200) (-428.232) (-426.512) [-426.891] * (-424.524) (-424.360) (-425.701) [-424.385] -- 0:00:06
898000 -- (-427.308) [-425.187] (-425.382) (-424.087) * [-425.109] (-424.471) (-425.058) (-426.286) -- 0:00:06
898500 -- (-426.592) (-425.021) [-423.945] (-424.369) * (-427.042) (-425.244) [-424.517] (-428.997) -- 0:00:06
899000 -- (-429.048) (-435.290) (-425.066) [-430.137] * (-426.605) (-430.792) [-424.399] (-426.259) -- 0:00:06
899500 -- (-424.659) [-424.545] (-426.876) (-428.471) * (-426.239) (-427.502) (-424.556) [-424.043] -- 0:00:06
900000 -- (-425.709) [-426.426] (-427.566) (-424.554) * (-430.688) (-426.833) (-425.506) [-424.433] -- 0:00:06
Average standard deviation of split frequencies: 0.008128
900500 -- (-426.972) (-427.793) (-431.156) [-423.718] * (-426.230) (-427.872) [-424.875] (-426.792) -- 0:00:06
901000 -- [-426.714] (-425.117) (-432.658) (-424.276) * [-427.506] (-423.812) (-425.546) (-427.832) -- 0:00:06
901500 -- (-427.539) (-424.888) (-426.733) [-424.256] * (-426.889) (-426.925) [-424.462] (-427.276) -- 0:00:06
902000 -- (-426.587) [-424.841] (-426.997) (-424.132) * [-428.956] (-428.163) (-426.505) (-424.629) -- 0:00:06
902500 -- (-426.775) [-423.950] (-425.511) (-425.661) * (-424.584) (-425.908) [-428.335] (-426.508) -- 0:00:06
903000 -- [-427.919] (-429.909) (-424.450) (-424.585) * (-424.712) (-426.049) [-426.089] (-425.424) -- 0:00:06
903500 -- (-433.964) (-427.320) [-424.028] (-426.096) * [-423.767] (-429.050) (-426.431) (-426.992) -- 0:00:06
904000 -- (-432.127) (-425.567) [-428.135] (-426.799) * (-429.158) (-425.866) [-430.075] (-424.553) -- 0:00:06
904500 -- (-426.245) [-426.509] (-426.116) (-430.865) * (-426.700) [-424.928] (-431.042) (-426.586) -- 0:00:06
905000 -- (-425.509) (-428.515) (-429.884) [-428.481] * [-427.051] (-425.450) (-429.660) (-425.478) -- 0:00:06
Average standard deviation of split frequencies: 0.008019
905500 -- (-424.283) [-424.928] (-427.495) (-427.140) * [-429.424] (-428.638) (-426.365) (-426.399) -- 0:00:06
906000 -- (-425.671) (-428.135) (-426.691) [-428.271] * (-429.695) [-425.454] (-426.584) (-427.979) -- 0:00:06
906500 -- (-424.102) [-425.769] (-424.765) (-426.327) * (-430.761) (-426.900) (-428.099) [-429.040] -- 0:00:06
907000 -- (-424.110) (-426.118) [-427.003] (-429.239) * (-425.028) (-428.628) (-425.039) [-425.142] -- 0:00:06
907500 -- [-423.728] (-424.649) (-424.769) (-426.407) * (-424.157) [-423.769] (-424.882) (-425.875) -- 0:00:06
908000 -- (-425.771) (-425.907) (-425.607) [-428.947] * [-425.739] (-425.881) (-427.805) (-427.820) -- 0:00:05
908500 -- (-425.801) (-433.435) (-425.649) [-426.075] * (-430.855) (-427.012) (-426.119) [-424.285] -- 0:00:05
909000 -- (-426.622) (-428.344) [-424.253] (-426.235) * (-425.654) (-430.822) [-423.737] (-424.506) -- 0:00:05
909500 -- [-423.564] (-426.946) (-426.403) (-430.137) * (-426.641) (-431.072) (-424.454) [-425.861] -- 0:00:05
910000 -- (-424.981) [-427.218] (-426.239) (-426.810) * (-425.173) (-425.421) [-425.122] (-429.281) -- 0:00:05
Average standard deviation of split frequencies: 0.008100
910500 -- (-424.871) [-425.031] (-427.607) (-426.577) * (-425.568) [-427.204] (-425.070) (-426.770) -- 0:00:05
911000 -- (-424.994) (-425.766) [-425.378] (-425.321) * (-426.570) (-426.414) (-424.571) [-426.919] -- 0:00:05
911500 -- (-426.793) (-425.487) [-427.835] (-426.100) * (-424.143) (-424.603) (-424.296) [-427.078] -- 0:00:05
912000 -- (-426.989) [-425.810] (-425.736) (-426.939) * (-424.252) (-424.498) [-425.774] (-425.694) -- 0:00:05
912500 -- (-426.467) (-425.151) (-425.336) [-427.679] * [-424.422] (-425.620) (-426.120) (-427.480) -- 0:00:05
913000 -- (-425.511) (-424.711) (-425.768) [-427.416] * (-428.314) (-429.922) (-426.001) [-427.160] -- 0:00:05
913500 -- (-424.955) [-425.613] (-424.441) (-425.977) * (-428.314) (-424.556) [-424.500] (-427.152) -- 0:00:05
914000 -- (-425.146) (-423.857) [-425.288] (-427.456) * (-425.898) (-425.217) [-426.637] (-426.998) -- 0:00:05
914500 -- (-425.729) [-423.930] (-425.380) (-426.987) * [-425.796] (-428.108) (-424.761) (-425.718) -- 0:00:05
915000 -- (-425.558) (-427.567) [-428.740] (-423.619) * (-424.483) (-427.873) [-426.867] (-424.690) -- 0:00:05
Average standard deviation of split frequencies: 0.007720
915500 -- [-425.223] (-424.691) (-432.091) (-427.831) * (-425.757) (-424.935) (-425.872) [-426.715] -- 0:00:05
916000 -- (-426.870) [-426.270] (-430.574) (-427.357) * (-427.785) (-424.944) (-426.126) [-424.547] -- 0:00:05
916500 -- [-425.786] (-430.488) (-426.071) (-424.846) * (-425.135) (-427.478) (-423.966) [-426.852] -- 0:00:05
917000 -- (-430.230) (-428.740) (-425.802) [-427.034] * [-425.079] (-426.259) (-425.084) (-430.710) -- 0:00:05
917500 -- (-426.187) (-425.181) [-426.491] (-427.003) * [-424.041] (-427.760) (-429.875) (-425.510) -- 0:00:05
918000 -- (-427.754) [-425.582] (-429.538) (-424.885) * (-429.126) (-429.731) [-426.279] (-430.357) -- 0:00:05
918500 -- (-430.457) (-426.783) (-426.736) [-424.384] * (-426.707) [-425.911] (-425.699) (-426.105) -- 0:00:05
919000 -- [-425.404] (-426.713) (-424.872) (-425.572) * (-427.027) [-428.179] (-425.896) (-425.545) -- 0:00:05
919500 -- (-424.377) (-424.352) [-424.281] (-425.535) * (-425.960) [-426.198] (-426.467) (-424.579) -- 0:00:05
920000 -- (-424.615) (-425.216) [-423.801] (-425.450) * (-426.451) (-426.642) [-424.327] (-427.322) -- 0:00:05
Average standard deviation of split frequencies: 0.007741
920500 -- (-424.901) (-425.336) (-428.858) [-425.113] * (-424.438) (-424.971) [-423.991] (-424.748) -- 0:00:05
921000 -- (-424.085) [-424.249] (-426.681) (-426.063) * (-425.012) [-425.649] (-428.748) (-425.669) -- 0:00:05
921500 -- (-432.176) [-424.043] (-430.209) (-427.893) * (-426.422) (-424.656) [-425.587] (-425.165) -- 0:00:05
922000 -- [-426.282] (-424.236) (-426.792) (-424.039) * [-425.740] (-424.249) (-426.385) (-426.288) -- 0:00:05
922500 -- (-426.965) (-428.453) (-427.419) [-428.445] * (-424.069) [-426.939] (-424.900) (-429.775) -- 0:00:05
923000 -- (-427.993) (-424.652) (-426.995) [-423.895] * [-426.704] (-425.188) (-424.334) (-424.254) -- 0:00:05
923500 -- (-427.878) (-424.863) (-427.044) [-425.058] * (-428.088) [-427.028] (-423.910) (-429.554) -- 0:00:04
924000 -- (-426.945) [-424.852] (-427.553) (-428.571) * [-426.180] (-425.327) (-424.686) (-427.357) -- 0:00:04
924500 -- (-428.825) [-428.164] (-426.430) (-425.324) * (-424.542) (-425.865) (-423.616) [-425.769] -- 0:00:04
925000 -- (-424.644) (-426.593) (-424.391) [-424.110] * (-424.867) (-432.467) (-423.575) [-427.595] -- 0:00:04
Average standard deviation of split frequencies: 0.007816
925500 -- [-426.865] (-424.875) (-424.942) (-424.892) * (-425.456) (-424.622) (-424.585) [-425.816] -- 0:00:04
926000 -- [-429.588] (-424.642) (-425.926) (-424.022) * (-430.140) (-424.681) [-423.517] (-426.664) -- 0:00:04
926500 -- (-429.424) (-424.214) (-425.673) [-425.387] * (-426.426) (-424.813) [-424.056] (-429.412) -- 0:00:04
927000 -- [-424.318] (-427.198) (-425.586) (-430.590) * (-425.513) (-425.681) [-424.057] (-425.705) -- 0:00:04
927500 -- (-424.649) (-425.552) [-426.529] (-423.785) * (-425.394) (-424.706) [-424.261] (-427.585) -- 0:00:04
928000 -- (-425.623) (-428.065) [-425.199] (-427.298) * (-425.906) (-423.494) (-424.853) [-423.905] -- 0:00:04
928500 -- (-424.495) [-424.921] (-428.068) (-424.458) * [-426.806] (-428.384) (-427.400) (-425.958) -- 0:00:04
929000 -- [-424.508] (-427.517) (-424.577) (-427.207) * (-427.452) (-426.024) [-424.632] (-429.130) -- 0:00:04
929500 -- (-424.969) [-424.801] (-424.715) (-426.425) * (-424.751) [-428.673] (-428.718) (-424.654) -- 0:00:04
930000 -- (-426.069) (-425.448) [-424.751] (-426.378) * (-423.788) (-428.368) (-428.244) [-424.934] -- 0:00:04
Average standard deviation of split frequencies: 0.007985
930500 -- (-424.256) (-425.455) [-426.700] (-426.621) * (-423.985) (-425.667) [-430.502] (-424.992) -- 0:00:04
931000 -- [-424.064] (-426.055) (-427.539) (-429.862) * (-423.658) (-424.286) [-424.147] (-425.090) -- 0:00:04
931500 -- (-425.670) (-429.514) [-426.265] (-427.637) * [-426.204] (-426.914) (-428.275) (-425.088) -- 0:00:04
932000 -- (-426.910) [-425.305] (-427.648) (-424.100) * (-431.982) (-426.007) [-425.799] (-426.237) -- 0:00:04
932500 -- [-425.968] (-424.542) (-424.770) (-424.993) * (-428.889) (-424.768) [-425.703] (-427.382) -- 0:00:04
933000 -- (-424.854) (-425.524) [-425.392] (-429.240) * [-424.612] (-430.141) (-424.391) (-426.669) -- 0:00:04
933500 -- (-425.282) (-424.041) [-424.703] (-425.150) * [-425.088] (-425.600) (-430.638) (-430.607) -- 0:00:04
934000 -- (-424.933) (-425.113) (-433.017) [-426.578] * (-426.680) (-426.149) (-427.135) [-425.557] -- 0:00:04
934500 -- [-423.745] (-429.069) (-432.293) (-429.540) * (-427.134) (-424.818) (-427.202) [-425.976] -- 0:00:04
935000 -- (-428.195) [-425.138] (-427.209) (-425.223) * (-426.382) [-424.108] (-425.827) (-429.927) -- 0:00:04
Average standard deviation of split frequencies: 0.007584
935500 -- (-428.810) [-425.350] (-425.506) (-429.075) * [-426.271] (-425.730) (-424.448) (-426.908) -- 0:00:04
936000 -- (-427.690) [-424.901] (-426.409) (-428.107) * [-424.483] (-426.275) (-423.940) (-426.505) -- 0:00:04
936500 -- (-428.854) (-425.317) (-425.241) [-426.217] * (-426.510) [-426.338] (-428.245) (-424.813) -- 0:00:04
937000 -- (-429.526) (-426.090) (-424.372) [-424.334] * (-428.666) (-425.948) [-428.141] (-424.889) -- 0:00:04
937500 -- (-426.560) [-427.961] (-425.378) (-423.655) * (-426.439) (-426.615) (-425.427) [-425.058] -- 0:00:04
938000 -- (-432.157) (-425.522) [-424.659] (-424.510) * [-424.307] (-427.829) (-426.137) (-425.228) -- 0:00:04
938500 -- (-432.344) (-424.866) (-424.160) [-426.751] * (-425.513) [-426.971] (-427.475) (-430.624) -- 0:00:03
939000 -- (-429.360) (-424.851) (-424.350) [-426.924] * [-425.066] (-427.595) (-424.096) (-426.236) -- 0:00:03
939500 -- [-427.812] (-426.131) (-427.528) (-426.574) * (-425.162) (-427.664) [-427.895] (-425.611) -- 0:00:03
940000 -- [-429.091] (-427.617) (-425.941) (-426.503) * [-424.635] (-425.787) (-424.592) (-423.980) -- 0:00:03
Average standard deviation of split frequencies: 0.007664
940500 -- (-425.544) (-425.575) (-429.024) [-424.697] * (-423.766) (-429.005) [-423.436] (-425.631) -- 0:00:03
941000 -- (-426.376) (-424.554) (-430.121) [-426.061] * (-424.882) [-427.659] (-424.566) (-434.314) -- 0:00:03
941500 -- (-425.816) (-425.063) (-428.836) [-427.236] * (-425.279) (-424.112) [-425.707] (-425.279) -- 0:00:03
942000 -- (-425.475) (-426.997) [-428.124] (-423.935) * (-425.084) [-426.797] (-424.358) (-425.957) -- 0:00:03
942500 -- [-429.912] (-426.932) (-424.595) (-424.016) * (-426.845) (-424.403) [-425.509] (-424.642) -- 0:00:03
943000 -- (-431.372) (-425.272) (-426.162) [-426.219] * (-425.522) (-424.832) [-425.094] (-427.197) -- 0:00:03
943500 -- [-424.096] (-425.852) (-426.160) (-427.239) * [-427.495] (-424.063) (-430.809) (-432.199) -- 0:00:03
944000 -- [-426.334] (-423.888) (-428.402) (-426.334) * (-426.154) [-425.949] (-427.120) (-426.811) -- 0:00:03
944500 -- (-425.422) [-427.125] (-430.021) (-424.837) * [-425.936] (-426.770) (-426.997) (-425.806) -- 0:00:03
945000 -- (-425.284) (-427.942) [-423.969] (-430.918) * (-425.210) [-426.266] (-426.320) (-426.730) -- 0:00:03
Average standard deviation of split frequencies: 0.007328
945500 -- (-423.964) (-424.275) (-423.714) [-423.799] * (-428.477) [-424.552] (-426.830) (-424.496) -- 0:00:03
946000 -- (-424.367) (-424.291) (-423.440) [-425.226] * (-427.178) (-424.715) (-425.180) [-424.601] -- 0:00:03
946500 -- [-425.198] (-424.496) (-424.022) (-424.052) * [-426.338] (-426.486) (-425.583) (-428.157) -- 0:00:03
947000 -- (-425.554) [-424.521] (-424.676) (-425.295) * [-424.901] (-433.349) (-425.244) (-424.859) -- 0:00:03
947500 -- (-429.391) (-424.517) [-424.410] (-426.179) * (-424.420) [-432.517] (-428.234) (-425.952) -- 0:00:03
948000 -- (-426.690) (-427.941) (-424.513) [-424.941] * (-424.772) (-430.431) (-430.124) [-424.180] -- 0:00:03
948500 -- (-425.750) (-427.697) [-423.973] (-433.102) * (-427.997) (-426.035) (-426.949) [-423.846] -- 0:00:03
949000 -- (-425.748) (-424.506) (-424.835) [-424.397] * (-424.804) (-427.267) [-425.062] (-424.720) -- 0:00:03
949500 -- (-424.485) [-424.289] (-423.771) (-423.976) * (-427.629) [-425.810] (-423.736) (-424.625) -- 0:00:03
950000 -- (-427.642) (-424.832) (-425.043) [-423.913] * (-426.302) [-426.804] (-426.120) (-426.138) -- 0:00:03
Average standard deviation of split frequencies: 0.006694
950500 -- (-426.676) (-426.939) [-424.416] (-424.031) * (-426.552) (-427.980) [-424.582] (-425.191) -- 0:00:03
951000 -- (-427.250) (-429.654) (-423.903) [-425.459] * (-424.491) (-424.721) [-423.809] (-424.108) -- 0:00:03
951500 -- [-425.099] (-427.439) (-424.753) (-424.557) * (-425.270) (-426.775) (-426.603) [-425.917] -- 0:00:03
952000 -- (-427.690) (-429.667) (-425.752) [-423.767] * (-427.576) [-426.041] (-426.124) (-424.528) -- 0:00:03
952500 -- (-425.055) (-427.207) (-427.016) [-424.473] * (-429.962) (-426.463) (-425.977) [-424.244] -- 0:00:03
953000 -- (-426.423) [-427.395] (-425.393) (-424.658) * [-426.713] (-425.445) (-424.830) (-428.131) -- 0:00:03
953500 -- (-428.004) [-428.013] (-427.845) (-423.783) * [-425.186] (-427.399) (-425.680) (-424.734) -- 0:00:03
954000 -- (-432.227) (-426.129) [-425.422] (-423.672) * [-427.256] (-429.398) (-425.023) (-427.508) -- 0:00:02
954500 -- (-427.478) (-430.284) [-426.919] (-426.991) * (-424.578) (-427.470) (-425.106) [-425.529] -- 0:00:02
955000 -- [-424.888] (-429.082) (-423.533) (-426.578) * (-430.093) [-426.680] (-426.240) (-428.311) -- 0:00:02
Average standard deviation of split frequencies: 0.006441
955500 -- (-424.836) (-426.535) (-425.333) [-423.520] * [-426.065] (-426.350) (-426.202) (-428.611) -- 0:00:02
956000 -- (-429.480) (-428.996) [-425.263] (-430.655) * (-427.541) (-425.856) [-426.149] (-424.079) -- 0:00:02
956500 -- [-428.161] (-426.434) (-424.419) (-425.050) * (-427.713) (-425.346) (-427.496) [-424.344] -- 0:00:02
957000 -- (-427.857) (-424.300) (-427.278) [-425.138] * (-426.662) (-430.445) [-425.359] (-425.780) -- 0:00:02
957500 -- (-428.402) [-426.383] (-429.414) (-426.401) * (-425.031) [-426.973] (-430.296) (-425.006) -- 0:00:02
958000 -- (-424.947) (-426.765) (-426.375) [-425.154] * (-430.670) (-431.875) (-426.061) [-424.785] -- 0:00:02
958500 -- (-424.911) (-424.833) (-426.316) [-427.128] * [-425.946] (-430.565) (-424.862) (-424.643) -- 0:00:02
959000 -- [-425.074] (-426.148) (-425.175) (-424.619) * [-425.034] (-427.075) (-425.623) (-425.669) -- 0:00:02
959500 -- (-424.890) (-424.073) (-428.355) [-424.600] * (-431.034) (-427.986) [-425.086] (-424.571) -- 0:00:02
960000 -- [-424.079] (-429.642) (-424.993) (-425.196) * (-427.020) (-426.909) (-431.327) [-424.450] -- 0:00:02
Average standard deviation of split frequencies: 0.006134
960500 -- (-425.686) (-428.875) (-424.714) [-425.569] * (-425.374) [-424.539] (-425.496) (-426.202) -- 0:00:02
961000 -- (-425.633) (-427.248) [-425.701] (-426.444) * (-426.104) [-423.483] (-426.279) (-425.755) -- 0:00:02
961500 -- [-426.592] (-430.281) (-423.959) (-426.471) * [-428.074] (-424.696) (-426.396) (-429.326) -- 0:00:02
962000 -- (-424.449) (-425.998) [-425.234] (-428.235) * (-425.707) (-424.866) (-423.938) [-425.466] -- 0:00:02
962500 -- [-425.953] (-426.833) (-427.897) (-423.648) * (-425.967) (-426.279) (-424.214) [-425.499] -- 0:00:02
963000 -- (-425.681) [-424.627] (-428.294) (-425.954) * (-426.770) (-428.566) [-424.449] (-427.316) -- 0:00:02
963500 -- (-423.913) [-425.356] (-431.590) (-424.044) * (-425.560) (-425.613) (-425.593) [-427.009] -- 0:00:02
964000 -- (-427.436) [-426.089] (-426.066) (-426.908) * (-424.244) [-427.043] (-424.192) (-427.770) -- 0:00:02
964500 -- (-425.588) (-424.208) (-426.919) [-424.552] * (-425.076) [-424.207] (-424.198) (-426.144) -- 0:00:02
965000 -- (-425.066) [-424.468] (-425.164) (-424.691) * [-431.265] (-425.200) (-427.877) (-432.937) -- 0:00:02
Average standard deviation of split frequencies: 0.006130
965500 -- [-427.415] (-425.873) (-424.481) (-425.011) * (-425.497) (-423.961) (-424.644) [-425.614] -- 0:00:02
966000 -- (-426.283) (-425.475) [-424.317] (-426.160) * (-429.446) (-423.541) [-424.293] (-423.731) -- 0:00:02
966500 -- [-424.984] (-425.116) (-427.217) (-425.331) * (-429.736) (-426.563) [-425.719] (-424.586) -- 0:00:02
967000 -- (-425.220) [-426.867] (-425.757) (-426.896) * (-425.036) (-426.872) (-423.860) [-427.087] -- 0:00:02
967500 -- (-424.075) (-425.585) [-424.685] (-424.597) * (-425.679) [-429.656] (-428.828) (-426.358) -- 0:00:02
968000 -- (-424.461) [-426.771] (-424.404) (-429.027) * (-427.320) [-425.341] (-424.878) (-426.882) -- 0:00:02
968500 -- (-427.139) (-427.526) (-425.569) [-424.978] * (-426.816) [-426.332] (-425.596) (-427.560) -- 0:00:02
969000 -- (-431.042) (-424.595) (-425.963) [-429.093] * [-425.512] (-427.314) (-424.616) (-424.911) -- 0:00:02
969500 -- (-425.488) [-423.981] (-424.569) (-425.237) * (-427.468) (-426.754) [-424.882] (-424.498) -- 0:00:02
970000 -- (-427.860) (-423.743) [-423.846] (-424.249) * (-426.594) (-425.698) [-427.233] (-426.967) -- 0:00:01
Average standard deviation of split frequencies: 0.005949
970500 -- (-431.344) (-425.552) (-423.988) [-423.816] * (-425.520) (-425.618) (-426.159) [-425.370] -- 0:00:01
971000 -- (-431.271) (-426.010) (-426.663) [-425.443] * (-424.563) [-427.650] (-425.619) (-424.932) -- 0:00:01
971500 -- (-425.098) [-425.367] (-427.975) (-426.103) * (-424.996) (-426.598) (-424.196) [-426.926] -- 0:00:01
972000 -- [-425.405] (-424.599) (-426.171) (-428.266) * (-428.494) (-425.917) [-424.073] (-426.762) -- 0:00:01
972500 -- (-425.015) [-424.738] (-425.633) (-424.269) * (-426.660) (-424.000) (-425.311) [-425.537] -- 0:00:01
973000 -- [-423.997] (-423.800) (-423.986) (-424.708) * (-425.665) (-425.828) [-424.323] (-427.583) -- 0:00:01
973500 -- (-425.471) [-428.117] (-425.341) (-423.601) * [-427.378] (-425.444) (-426.451) (-429.262) -- 0:00:01
974000 -- (-424.961) [-424.645] (-431.071) (-424.564) * (-425.010) [-424.978] (-425.869) (-424.368) -- 0:00:01
974500 -- (-425.248) [-425.861] (-430.746) (-425.164) * (-425.830) [-427.004] (-425.026) (-427.197) -- 0:00:01
975000 -- (-424.321) [-424.631] (-428.952) (-430.478) * (-425.825) [-424.542] (-424.619) (-427.504) -- 0:00:01
Average standard deviation of split frequencies: 0.006506
975500 -- (-427.730) (-424.276) (-432.966) [-424.600] * [-425.997] (-423.761) (-426.408) (-425.570) -- 0:00:01
976000 -- (-424.760) [-426.633] (-433.294) (-427.322) * (-428.644) (-426.574) (-425.874) [-424.951] -- 0:00:01
976500 -- (-430.064) (-425.167) [-425.750] (-425.123) * (-426.919) (-428.836) (-426.035) [-425.369] -- 0:00:01
977000 -- (-428.741) (-426.655) (-425.377) [-427.913] * (-427.448) (-427.853) [-423.952] (-426.571) -- 0:00:01
977500 -- [-427.752] (-426.539) (-426.216) (-431.009) * (-423.697) (-432.340) [-423.697] (-428.968) -- 0:00:01
978000 -- [-426.635] (-425.272) (-425.402) (-428.746) * (-424.061) (-429.619) (-426.720) [-427.397] -- 0:00:01
978500 -- [-424.715] (-423.906) (-424.347) (-429.110) * [-426.069] (-431.808) (-426.163) (-425.683) -- 0:00:01
979000 -- (-429.921) (-425.189) (-428.124) [-427.795] * (-426.712) (-426.127) (-425.129) [-424.509] -- 0:00:01
979500 -- (-428.077) (-425.808) (-428.393) [-424.795] * (-427.688) (-424.822) [-428.746] (-426.792) -- 0:00:01
980000 -- [-423.874] (-427.048) (-427.961) (-425.087) * [-425.159] (-424.303) (-426.170) (-425.247) -- 0:00:01
Average standard deviation of split frequencies: 0.006447
980500 -- (-426.243) (-428.014) [-424.396] (-423.955) * (-425.116) (-425.481) (-424.994) [-425.166] -- 0:00:01
981000 -- [-425.693] (-424.845) (-424.710) (-423.692) * (-428.316) [-424.495] (-425.368) (-424.645) -- 0:00:01
981500 -- [-425.028] (-426.003) (-430.937) (-424.352) * (-426.937) (-425.533) (-424.492) [-426.067] -- 0:00:01
982000 -- (-424.467) [-426.386] (-428.285) (-423.629) * [-427.513] (-425.119) (-426.313) (-426.489) -- 0:00:01
982500 -- (-424.556) [-425.199] (-423.748) (-424.630) * (-424.763) (-424.723) [-425.863] (-427.759) -- 0:00:01
983000 -- [-429.456] (-428.699) (-424.944) (-426.957) * (-426.497) (-423.662) (-424.151) [-427.447] -- 0:00:01
983500 -- (-431.089) (-428.169) [-424.097] (-427.408) * [-426.038] (-424.527) (-426.094) (-426.397) -- 0:00:01
984000 -- (-425.065) (-428.075) [-424.005] (-423.995) * (-425.279) [-424.555] (-425.928) (-425.265) -- 0:00:01
984500 -- [-424.546] (-427.465) (-425.506) (-425.808) * [-425.309] (-423.874) (-423.988) (-426.340) -- 0:00:01
985000 -- (-427.202) (-426.792) (-426.189) [-429.382] * [-427.568] (-429.297) (-430.264) (-426.748) -- 0:00:00
Average standard deviation of split frequencies: 0.006609
985500 -- [-425.988] (-425.785) (-427.102) (-425.203) * [-426.602] (-429.734) (-426.326) (-425.149) -- 0:00:00
986000 -- [-425.198] (-425.195) (-426.620) (-424.391) * [-424.735] (-429.297) (-426.010) (-423.701) -- 0:00:00
986500 -- [-425.288] (-425.107) (-427.343) (-424.159) * (-424.391) (-426.010) (-424.891) [-426.685] -- 0:00:00
987000 -- (-428.405) (-424.201) [-424.510] (-425.828) * [-425.647] (-423.658) (-428.307) (-425.558) -- 0:00:00
987500 -- (-427.076) (-424.573) [-424.494] (-427.609) * (-428.059) [-426.393] (-426.428) (-424.580) -- 0:00:00
988000 -- (-425.314) (-432.764) [-425.491] (-429.997) * [-429.254] (-425.126) (-426.452) (-426.471) -- 0:00:00
988500 -- (-428.247) (-432.759) (-427.162) [-431.184] * (-426.651) [-425.126] (-427.669) (-428.870) -- 0:00:00
989000 -- (-426.496) (-426.813) (-428.739) [-424.825] * (-424.873) [-423.704] (-430.406) (-427.114) -- 0:00:00
989500 -- [-424.549] (-423.973) (-430.229) (-427.131) * (-424.714) (-423.692) (-428.332) [-425.676] -- 0:00:00
990000 -- (-424.680) (-426.928) [-426.743] (-431.062) * [-423.928] (-425.431) (-426.765) (-432.313) -- 0:00:00
Average standard deviation of split frequencies: 0.006802
990500 -- (-424.193) (-426.765) (-424.788) [-428.705] * [-428.401] (-426.713) (-424.210) (-430.683) -- 0:00:00
991000 -- (-425.861) [-424.781] (-424.164) (-424.908) * (-426.491) [-425.369] (-426.043) (-424.735) -- 0:00:00
991500 -- [-425.819] (-426.081) (-423.668) (-426.914) * (-426.954) [-428.127] (-425.399) (-427.540) -- 0:00:00
992000 -- (-427.826) (-426.321) (-425.393) [-428.023] * (-426.817) (-424.992) [-426.098] (-428.587) -- 0:00:00
992500 -- (-425.171) (-425.731) (-424.940) [-424.985] * [-424.555] (-427.259) (-425.028) (-427.806) -- 0:00:00
993000 -- (-426.995) (-431.628) (-426.759) [-428.034] * [-423.971] (-426.178) (-424.748) (-426.599) -- 0:00:00
993500 -- (-426.754) (-426.961) (-430.258) [-428.646] * (-425.408) (-426.232) [-426.376] (-428.209) -- 0:00:00
994000 -- [-426.032] (-425.948) (-427.204) (-424.184) * (-425.643) (-427.410) (-424.803) [-425.526] -- 0:00:00
994500 -- (-427.870) (-424.576) [-424.800] (-426.635) * (-431.336) (-427.229) [-425.137] (-428.328) -- 0:00:00
995000 -- (-427.530) (-426.598) [-427.422] (-426.273) * (-431.303) (-424.096) (-427.182) [-425.505] -- 0:00:00
Average standard deviation of split frequencies: 0.006765
995500 -- [-428.974] (-428.647) (-428.100) (-428.049) * (-426.256) [-423.998] (-428.018) (-425.019) -- 0:00:00
996000 -- (-426.176) (-425.888) (-426.027) [-424.116] * [-426.373] (-423.645) (-429.507) (-424.462) -- 0:00:00
996500 -- [-427.363] (-426.693) (-424.460) (-427.414) * (-426.698) (-423.769) (-428.397) [-424.011] -- 0:00:00
997000 -- (-429.175) (-430.166) (-425.928) [-424.416] * (-429.532) (-425.637) (-425.088) [-427.049] -- 0:00:00
997500 -- [-423.941] (-429.344) (-425.702) (-425.426) * (-427.787) (-426.782) (-427.366) [-424.588] -- 0:00:00
998000 -- (-425.254) (-426.381) (-429.115) [-425.984] * (-426.542) (-426.566) (-425.068) [-426.136] -- 0:00:00
998500 -- (-425.254) (-428.928) (-426.508) [-423.925] * (-426.230) [-429.876] (-424.892) (-426.233) -- 0:00:00
999000 -- (-424.837) (-423.603) (-423.997) [-424.217] * (-431.610) (-426.455) (-424.105) [-428.110] -- 0:00:00
999500 -- (-426.892) [-425.628] (-429.428) (-427.805) * (-431.786) (-424.685) (-423.660) [-427.398] -- 0:00:00
1000000 -- (-427.432) (-426.876) (-429.372) [-426.914] * (-428.592) [-426.174] (-424.376) (-423.714) -- 0:00:00
Average standard deviation of split frequencies: 0.007149
Analysis completed in 1 mins 6 seconds
Analysis used 64.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -423.32
Likelihood of best state for "cold" chain of run 2 was -423.32
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.8 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.3 % ( 29 %) Dirichlet(Pi{all})
38.0 % ( 23 %) Slider(Pi{all})
78.7 % ( 46 %) Multiplier(Alpha{1,2})
77.7 % ( 58 %) Multiplier(Alpha{3})
25.5 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
38.6 % ( 29 %) Dirichlet(Pi{all})
38.2 % ( 20 %) Slider(Pi{all})
78.9 % ( 51 %) Multiplier(Alpha{1,2})
78.0 % ( 54 %) Multiplier(Alpha{3})
26.0 % ( 25 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166862 0.82 0.67
3 | 166831 166384 0.84
4 | 166834 166966 166123
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 167053 0.82 0.67
3 | 167202 166388 0.84
4 | 166147 166560 166650
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -425.25
| 11 1 1 |
| 2 1 2 1 1 2 1 1 |
| 11 2 11 22 2 1 1 |
| 22 21 2 2 2 2 |
| 2 2 11 2 12 1 2 1 1 22 2 2 2 |
|2 2 1 2 2 2 2 2 2 1 * |
| 1 2 * 21 2 1 1 1 2 2 |
|1 2 2 1 12 1 1 1 |
| 1 1 1 * 1 2* 2|
| * 1 2 1 2 2 1 21 1 2 1|
| 2 1 2 2 |
| 1 1 1 |
| 1 1 |
| 1 2 1 2 2 2 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -426.65
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -425.04 -428.39
2 -425.07 -427.95
--------------------------------------
TOTAL -425.05 -428.19
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901669 0.089881 0.395678 1.497034 0.865119 1313.17 1326.21 1.000
r(A<->C){all} 0.153739 0.015728 0.000004 0.392968 0.124279 214.09 238.78 1.000
r(A<->G){all} 0.176741 0.018999 0.000008 0.446021 0.146492 178.17 248.36 1.009
r(A<->T){all} 0.168426 0.018659 0.000081 0.444462 0.135526 138.87 180.83 1.001
r(C<->G){all} 0.159379 0.017255 0.000154 0.436599 0.125881 187.98 244.51 1.000
r(C<->T){all} 0.169897 0.018890 0.000027 0.446860 0.134431 259.40 260.42 1.006
r(G<->T){all} 0.171817 0.019473 0.000020 0.437535 0.141044 173.25 177.63 1.000
pi(A){all} 0.225302 0.000567 0.179762 0.271619 0.224961 1195.36 1223.94 1.000
pi(C){all} 0.282571 0.000650 0.231698 0.329833 0.282023 1227.68 1286.29 1.000
pi(G){all} 0.340920 0.000738 0.291221 0.396605 0.340473 1163.59 1267.16 1.000
pi(T){all} 0.151207 0.000402 0.114472 0.191490 0.151234 1278.22 1339.65 1.000
alpha{1,2} 0.409079 0.219884 0.000112 1.372095 0.243418 1129.95 1184.52 1.001
alpha{3} 0.449978 0.222383 0.000198 1.351429 0.295672 1117.19 1309.09 1.000
pinvar{all} 0.994917 0.000039 0.982786 0.999997 0.996922 1133.69 1297.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .**.**
9 -- .**...
10 -- .*.*..
11 -- ....**
12 -- .*.***
13 -- .***.*
14 -- .*..*.
15 -- ..****
16 -- .*...*
17 -- ..*..*
18 -- ..*.*.
19 -- .****.
20 -- ...*.*
21 -- ..**..
22 -- .***..
23 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 454 0.151233 0.005653 0.147235 0.155230 2
8 445 0.148235 0.011777 0.139907 0.156562 2
9 444 0.147901 0.005653 0.143904 0.151899 2
10 434 0.144570 0.008480 0.138574 0.150566 2
11 434 0.144570 0.010364 0.137242 0.151899 2
12 434 0.144570 0.000942 0.143904 0.145237 2
13 432 0.143904 0.005653 0.139907 0.147901 2
14 430 0.143238 0.001884 0.141905 0.144570 2
15 428 0.142572 0.000000 0.142572 0.142572 2
16 426 0.141905 0.007537 0.136576 0.147235 2
17 420 0.139907 0.005653 0.135909 0.143904 2
18 416 0.138574 0.000942 0.137908 0.139241 2
19 414 0.137908 0.009422 0.131246 0.144570 2
20 411 0.136909 0.005182 0.133245 0.140573 2
21 409 0.136243 0.003298 0.133911 0.138574 2
22 275 0.091606 0.020257 0.077282 0.105929 2
23 270 0.089940 0.018844 0.076616 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099457 0.009549 0.000073 0.297672 0.070310 1.000 2
length{all}[2] 0.100917 0.010445 0.000002 0.308744 0.068197 1.000 2
length{all}[3] 0.099221 0.009961 0.000011 0.300807 0.068462 1.000 2
length{all}[4] 0.101501 0.010111 0.000007 0.305243 0.069520 1.000 2
length{all}[5] 0.098633 0.009610 0.000002 0.289865 0.069881 1.000 2
length{all}[6] 0.100469 0.010100 0.000008 0.301581 0.071098 1.000 2
length{all}[7] 0.094354 0.008562 0.000075 0.287901 0.065850 0.998 2
length{all}[8] 0.097274 0.009468 0.000127 0.288285 0.064703 0.998 2
length{all}[9] 0.104319 0.011053 0.000677 0.324321 0.071273 0.998 2
length{all}[10] 0.107842 0.012879 0.000541 0.322822 0.072485 1.012 2
length{all}[11] 0.098559 0.008955 0.000267 0.292832 0.074378 0.998 2
length{all}[12] 0.102444 0.011018 0.000089 0.298113 0.070155 1.003 2
length{all}[13] 0.099683 0.010326 0.000214 0.303076 0.069040 0.999 2
length{all}[14] 0.100112 0.010414 0.000015 0.308223 0.067163 1.004 2
length{all}[15] 0.098153 0.009112 0.000033 0.283133 0.073826 0.999 2
length{all}[16] 0.103350 0.010652 0.000064 0.309174 0.069454 0.998 2
length{all}[17] 0.101504 0.010584 0.000449 0.308310 0.067344 1.004 2
length{all}[18] 0.091383 0.009397 0.000172 0.265430 0.057772 1.003 2
length{all}[19] 0.101066 0.009832 0.000171 0.302723 0.069333 1.002 2
length{all}[20] 0.102761 0.011945 0.000063 0.310588 0.068915 0.998 2
length{all}[21] 0.101015 0.011461 0.000406 0.307658 0.068117 0.998 2
length{all}[22] 0.100536 0.011015 0.000044 0.312365 0.064123 1.003 2
length{all}[23] 0.105189 0.012432 0.000176 0.300934 0.072274 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007149
Maximum standard deviation of split frequencies = 0.020257
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 315
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 35 patterns at 105 / 105 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 35 patterns at 105 / 105 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
34160 bytes for conP
3080 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082502 0.068098 0.055963 0.062928 0.013064 0.011615 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -436.027220
Iterating by ming2
Initial: fx= 436.027220
x= 0.08250 0.06810 0.05596 0.06293 0.01306 0.01162 0.30000 1.30000
1 h-m-p 0.0000 0.0001 250.2469 ++ 428.953045 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0059 48.5850 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 228.6211 ++ 428.216979 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0079 40.7743 ---------.. | 2/8
5 h-m-p 0.0000 0.0004 204.1106 +++ 410.626516 m 0.0004 74 | 3/8
6 h-m-p 0.0021 0.0106 30.5274 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 178.1011 ++ 408.456679 m 0.0001 106 | 4/8
8 h-m-p 0.0005 0.0169 19.9332 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 145.4984 ++ 407.380948 m 0.0001 137 | 5/8
10 h-m-p 0.0004 0.0258 13.1942 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 102.8421 ++ 405.877797 m 0.0001 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 405.877797 m 8.0000 178 | 6/8
13 h-m-p 0.2055 8.0000 0.0000 --Y 405.877797 0 0.0032 193 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 405.877797 m 8.0000 233 | 6/8
16 h-m-p 0.0026 1.3250 2.3348 ---------Y 405.877797 0 0.0000 255 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 405.877797 m 8.0000 269 | 6/8
18 h-m-p 0.0160 8.0000 0.0471 +++++ 405.877794 m 8.0000 285 | 6/8
19 h-m-p 0.5366 8.0000 0.7019 ++ 405.877785 m 8.0000 298 | 6/8
20 h-m-p 1.6000 8.0000 0.4116 ++ 405.877784 m 8.0000 311 | 6/8
21 h-m-p 1.0035 8.0000 3.2810 ++ 405.877782 m 8.0000 324 | 6/8
22 h-m-p 1.6000 8.0000 5.8260 ++ 405.877782 m 8.0000 335 | 6/8
23 h-m-p 1.6000 8.0000 20.3935 ++ 405.877781 m 8.0000 346 | 6/8
24 h-m-p 0.0163 0.0817 3017.7734 ---------Y 405.877781 0 0.0000 366 | 6/8
25 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 6/8
26 h-m-p 0.0160 8.0000 0.0000 ---------Y 405.877781 0 0.0000 413 | 6/8
27 h-m-p 0.0160 8.0000 0.0000 ---------Y 405.877781 0 0.0000 435
Out..
lnL = -405.877781
436 lfun, 436 eigenQcodon, 2616 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064426 0.067016 0.029886 0.031973 0.089593 0.088395 15.467395 0.672376 0.396107
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 1.361231
np = 9
lnL0 = -444.489268
Iterating by ming2
Initial: fx= 444.489268
x= 0.06443 0.06702 0.02989 0.03197 0.08959 0.08839 15.46739 0.67238 0.39611
1 h-m-p 0.0000 0.0003 248.0989 +++ 426.331755 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0003 73.1447 ++ 425.103888 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 9606.8381 ++ 410.503702 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 1021.9979 ++ 409.756879 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0001 551.4682 ++ 409.438580 m 0.0001 63 | 4/9
6 h-m-p 0.0000 0.0000 206.8963
h-m-p: 1.29721159e-21 6.48605794e-21 2.06896274e+02 409.438580
.. | 4/9
7 h-m-p 0.0000 0.0002 149.2235 ++ 405.980184 m 0.0002 84 | 5/9
8 h-m-p 0.0026 0.0778 6.2486 ------------.. | 5/9
9 h-m-p 0.0000 0.0000 107.5962 ++ 405.877907 m 0.0000 118 | 6/9
10 h-m-p 0.0641 8.0000 0.0000 ++++ 405.877907 m 8.0000 132 | 6/9
11 h-m-p 0.0510 0.2548 0.0000 -Y 405.877907 0 0.0032 148
Out..
lnL = -405.877907
149 lfun, 447 eigenQcodon, 1788 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.072865 0.030462 0.068077 0.023317 0.087998 0.074157 15.467043 1.709487 0.282025 0.311975 254.505520
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.041092
np = 11
lnL0 = -418.809471
Iterating by ming2
Initial: fx= 418.809471
x= 0.07286 0.03046 0.06808 0.02332 0.08800 0.07416 15.46704 1.70949 0.28202 0.31197 254.50552
1 h-m-p 0.0000 0.0018 29.6074 ++++ 416.711431 m 0.0018 18 | 1/11
2 h-m-p 0.0050 0.0750 9.6953 ++ 410.920358 m 0.0750 32 | 2/11
3 h-m-p 0.0000 0.0000 2778.8156 ++ 409.892821 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0004 189.2345 ++ 409.678468 m 0.0004 60 | 4/11
5 h-m-p 0.0000 0.0000 15554.7035 ++ 409.250585 m 0.0000 74 | 5/11
6 h-m-p 0.0005 0.0023 460.3069 ++ 408.158377 m 0.0023 88 | 6/11
7 h-m-p 1.1018 8.0000 0.9520 CCC 408.046673 2 0.4264 106 | 6/11
8 h-m-p 1.6000 8.0000 0.1301 ----------------.. | 6/11
9 h-m-p 0.0000 0.0054 14.9570 +++++ 405.877809 m 0.0054 161 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 405.877809 m 8.0000 175 | 7/11
11 h-m-p 0.0160 8.0000 0.0119 ------Y 405.877809 0 0.0000 199 | 7/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 405.877809 m 8.0000 220 | 7/11
13 h-m-p 0.0160 8.0000 3.2608 +++++ 405.877781 m 8.0000 241 | 7/11
14 h-m-p 1.6000 8.0000 0.0001 ++ 405.877781 m 8.0000 255 | 7/11
15 h-m-p 0.9565 8.0000 0.0010 -Y 405.877781 0 0.0986 274 | 7/11
16 h-m-p 0.1901 8.0000 0.0005 ---------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 ---C 405.877781 0 0.0001 326
Out..
lnL = -405.877781
327 lfun, 1308 eigenQcodon, 5886 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -405.875351 S = -405.875327 -0.000009
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:03
did 20 / 35 patterns 0:03
did 30 / 35 patterns 0:03
did 35 / 35 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069298 0.045157 0.039003 0.034724 0.100418 0.091602 17.275585 0.559348 1.807464
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.922880
np = 9
lnL0 = -445.789874
Iterating by ming2
Initial: fx= 445.789874
x= 0.06930 0.04516 0.03900 0.03472 0.10042 0.09160 17.27558 0.55935 1.80746
1 h-m-p 0.0000 0.0003 247.0530 +++ 424.672412 m 0.0003 15 | 1/9
2 h-m-p 0.0065 0.1939 11.6594 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 235.3460 ++ 422.408789 m 0.0000 49 | 2/9
4 h-m-p 0.0008 0.2671 10.9936 -----------.. | 2/9
5 h-m-p 0.0000 0.0001 210.6075 ++ 419.796650 m 0.0001 82 | 3/9
6 h-m-p 0.0011 0.3280 9.2648 -----------.. | 3/9
7 h-m-p 0.0000 0.0002 182.4173 +++ 411.942672 m 0.0002 116 | 4/9
8 h-m-p 0.0043 0.4473 8.1104 ------------.. | 4/9
9 h-m-p 0.0000 0.0002 151.8214 +++ 406.902685 m 0.0002 151 | 5/9
10 h-m-p 0.0031 0.6659 7.4608 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 109.2859 ++ 405.877964 m 0.0001 185 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 405.877964 m 8.0000 197 | 6/9
13 h-m-p 0.0652 8.0000 0.0001 ----Y 405.877964 0 0.0001 216
Out..
lnL = -405.877964
217 lfun, 2387 eigenQcodon, 13020 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.084208 0.015896 0.049442 0.055593 0.102928 0.029462 17.275581 0.900000 1.089916 1.610324 246.120419
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.048834
np = 11
lnL0 = -416.654359
Iterating by ming2
Initial: fx= 416.654359
x= 0.08421 0.01590 0.04944 0.05559 0.10293 0.02946 17.27558 0.90000 1.08992 1.61032 246.12042
1 h-m-p 0.0000 0.0014 73.6897 +++YCCCCCC 411.929578 6 0.0011 31 | 0/11
2 h-m-p 0.0001 0.0003 36.0199 ++ 411.624954 m 0.0003 45 | 1/11
3 h-m-p 0.0044 0.1360 2.0319 +++ 411.025728 m 0.1360 60 | 2/11
4 h-m-p 0.0004 0.0021 129.7481 ++ 410.314408 m 0.0021 74 | 3/11
5 h-m-p 0.0022 0.0112 9.2047 ++ 408.589904 m 0.0112 88 | 4/11
6 h-m-p 0.0006 0.0031 53.9793 ++ 407.353693 m 0.0031 102 | 5/11
7 h-m-p 0.0086 0.0432 4.1875 ++ 405.877803 m 0.0432 116 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 405.877803 m 8.0000 130 | 6/11
9 h-m-p 0.0022 1.0971 0.0529 ---------Y 405.877803 0 0.0000 158 | 6/11
10 h-m-p 0.0160 8.0000 0.0042 +++++ 405.877794 m 8.0000 180 | 6/11
11 h-m-p 1.6000 8.0000 0.0184 ++ 405.877786 m 8.0000 199 | 6/11
12 h-m-p 1.6000 8.0000 0.0220 ++ 405.877784 m 8.0000 218 | 6/11
13 h-m-p 1.6000 8.0000 0.0832 ++ 405.877782 m 8.0000 237 | 6/11
14 h-m-p 1.6000 8.0000 0.1116 ++ 405.877782 m 8.0000 256 | 6/11
15 h-m-p 0.2895 1.4477 0.3778 ++ 405.877781 m 1.4477 275 | 7/11
16 h-m-p 0.4057 3.1613 1.2362 ++ 405.877781 m 3.1613 294 | 7/11
17 h-m-p 0.8962 8.0000 4.3606 ------------C 405.877781 0 0.0000 320 | 7/11
18 h-m-p 0.1675 8.0000 0.0000 Y 405.877781 0 0.1675 334
QuantileBeta(0.85, 0.88231, 0.00494) = 1.000000e+00 2000 rounds
| 7/11
19 h-m-p 1.3647 8.0000 0.0000 ---Y 405.877781 0 0.0053 355
Out..
lnL = -405.877781
356 lfun, 4272 eigenQcodon, 23496 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -405.875359 S = -405.875327 -0.000014
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:14
did 20 / 35 patterns 0:14
did 30 / 35 patterns 0:15
did 35 / 35 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=105
NC_011896_1_WP_010907783_1_559_MLBR_RS02650 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
NC_002677_1_NP_301459_1_331_mihF VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
**************************************************
NC_011896_1_WP_010907783_1_559_MLBR_RS02650 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
NC_002677_1_NP_301459_1_331_mihF VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
**************************************************
NC_011896_1_WP_010907783_1_559_MLBR_RS02650 KFGSA
NC_002677_1_NP_301459_1_331_mihF KFGSA
NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410 KFGSA
NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815 KFGSA
NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925 KFGSA
NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015 KFGSA
*****
>NC_011896_1_WP_010907783_1_559_MLBR_RS02650 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT >NC_002677_1_NP_301459_1_331_mihF GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT >NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT >NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT >NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT >NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA AAGTTCGGCTCCGCT
>NC_011896_1_WP_010907783_1_559_MLBR_RS02650 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA >NC_002677_1_NP_301459_1_331_mihF VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA >NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA >NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA >NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA >NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE KFGSA
#NEXUS
[ID: 0010583267]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907783_1_559_MLBR_RS02650
NC_002677_1_NP_301459_1_331_mihF
NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410
NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815
NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925
NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907783_1_559_MLBR_RS02650,
2 NC_002677_1_NP_301459_1_331_mihF,
3 NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410,
4 NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815,
5 NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925,
6 NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07031008,2:0.06819721,3:0.0684619,4:0.06952011,5:0.06988053,6:0.07109788);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07031008,2:0.06819721,3:0.0684619,4:0.06952011,5:0.06988053,6:0.07109788);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -425.04 -428.39
2 -425.07 -427.95
--------------------------------------
TOTAL -425.05 -428.19
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901669 0.089881 0.395678 1.497034 0.865119 1313.17 1326.21 1.000
r(A<->C){all} 0.153739 0.015728 0.000004 0.392968 0.124279 214.09 238.78 1.000
r(A<->G){all} 0.176741 0.018999 0.000008 0.446021 0.146492 178.17 248.36 1.009
r(A<->T){all} 0.168426 0.018659 0.000081 0.444462 0.135526 138.87 180.83 1.001
r(C<->G){all} 0.159379 0.017255 0.000154 0.436599 0.125881 187.98 244.51 1.000
r(C<->T){all} 0.169897 0.018890 0.000027 0.446860 0.134431 259.40 260.42 1.006
r(G<->T){all} 0.171817 0.019473 0.000020 0.437535 0.141044 173.25 177.63 1.000
pi(A){all} 0.225302 0.000567 0.179762 0.271619 0.224961 1195.36 1223.94 1.000
pi(C){all} 0.282571 0.000650 0.231698 0.329833 0.282023 1227.68 1286.29 1.000
pi(G){all} 0.340920 0.000738 0.291221 0.396605 0.340473 1163.59 1267.16 1.000
pi(T){all} 0.151207 0.000402 0.114472 0.191490 0.151234 1278.22 1339.65 1.000
alpha{1,2} 0.409079 0.219884 0.000112 1.372095 0.243418 1129.95 1184.52 1.001
alpha{3} 0.449978 0.222383 0.000198 1.351429 0.295672 1117.19 1309.09 1.000
pinvar{all} 0.994917 0.000039 0.982786 0.999997 0.996922 1133.69 1297.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/mihF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 105
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 0 0 0 0 0 0 | CGC 5 5 5 5 5 5
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 5 5 5 5 5 5 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 4 4 4 4 4 4 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 0 0 0 0 0 0 | AAG 9 9 9 9 9 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 2 2 | GCC 3 3 3 3 3 3 | GAC 2 2 2 2 2 2 | GGC 6 6 6 6 6 6
GTA 0 0 0 0 0 0 | GCA 5 5 5 5 5 5 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 4 4 4 4 4 4 | GCG 6 6 6 6 6 6 | GAG 6 6 6 6 6 6 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907783_1_559_MLBR_RS02650
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
#2: NC_002677_1_NP_301459_1_331_mihF
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
#3: NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
#4: NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
#5: NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
#6: NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 18 | CCC 6 | CAC 0 | CGC 30
CTA 18 | CCA 0 | Gln Q CAA 0 | CGA 12
CTG 24 | CCG 12 | CAG 30 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 12 | ACC 24 | AAC 6 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 0 | AAG 54 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 18 | Asp D GAT 18 | Gly G GGT 6
GTC 12 | GCC 18 | GAC 12 | GGC 36
GTA 0 | GCA 30 | Glu E GAA 24 | GGA 0
GTG 24 | GCG 36 | GAG 36 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06667 C:0.29524 A:0.20952 G:0.42857
position 2: T:0.25714 C:0.25714 A:0.30476 G:0.18095
position 3: T:0.12381 C:0.29524 A:0.16190 G:0.41905
Average T:0.14921 C:0.28254 A:0.22540 G:0.34286
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -405.877781 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.467395 246.120419
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907783_1_559_MLBR_RS02650: 0.000004, NC_002677_1_NP_301459_1_331_mihF: 0.000004, NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410: 0.000004, NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815: 0.000004, NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925: 0.000004, NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.46739
omega (dN/dS) = 246.12042
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
7..2 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
7..3 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
7..4 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
7..5 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
7..6 0.000 223.6 91.4 246.1204 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -405.877907 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 15.467043 0.482805 0.000009
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907783_1_559_MLBR_RS02650: 0.000004, NC_002677_1_NP_301459_1_331_mihF: 0.000004, NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410: 0.000004, NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815: 0.000004, NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925: 0.000004, NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 15.46704
MLEs of dN/dS (w) for site classes (K=2)
p: 0.48280 0.51720
w: 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
7..2 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
7..3 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
7..4 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
7..5 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
7..6 0.000 223.6 91.4 0.5172 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -405.877781 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 17.275585 0.010600 0.000000 0.000001 256.519895
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907783_1_559_MLBR_RS02650: 0.000004, NC_002677_1_NP_301459_1_331_mihF: 0.000004, NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410: 0.000004, NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815: 0.000004, NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925: 0.000004, NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 17.27558
MLEs of dN/dS (w) for site classes (K=3)
p: 0.01060 0.00000 0.98940
w: 0.00000 1.00000 256.51990
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
7..2 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
7..3 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
7..4 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
7..5 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
7..6 0.000 223.3 91.7 253.8008 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907783_1_559_MLBR_RS02650)
Pr(w>1) post mean +- SE for w
1 V 0.989* 253.801
2 A 0.989* 253.801
3 L 0.989* 253.801
4 P 0.989* 253.801
5 Q 0.989* 253.801
6 L 0.989* 253.801
7 T 0.989* 253.801
8 D 0.989* 253.801
9 E 0.989* 253.801
10 Q 0.989* 253.801
11 R 0.989* 253.801
12 A 0.989* 253.801
13 A 0.989* 253.801
14 A 0.989* 253.801
15 L 0.989* 253.801
16 E 0.989* 253.801
17 K 0.989* 253.801
18 A 0.989* 253.801
19 A 0.989* 253.801
20 A 0.989* 253.801
21 A 0.989* 253.801
22 R 0.989* 253.801
23 R 0.989* 253.801
24 A 0.989* 253.801
25 R 0.989* 253.801
26 A 0.989* 253.801
27 E 0.989* 253.801
28 L 0.989* 253.801
29 K 0.989* 253.801
30 D 0.989* 253.801
31 R 0.989* 253.801
32 L 0.989* 253.801
33 K 0.989* 253.801
34 R 0.989* 253.801
35 G 0.989* 253.801
36 G 0.989* 253.801
37 T 0.989* 253.801
38 N 0.989* 253.801
39 L 0.989* 253.801
40 T 0.989* 253.801
41 Q 0.989* 253.801
42 V 0.989* 253.801
43 L 0.989* 253.801
44 K 0.989* 253.801
45 D 0.989* 253.801
46 A 0.989* 253.801
47 E 0.989* 253.801
48 S 0.989* 253.801
49 D 0.989* 253.801
50 E 0.989* 253.801
51 V 0.989* 253.801
52 L 0.989* 253.801
53 G 0.989* 253.801
54 K 0.989* 253.801
55 M 0.989* 253.801
56 K 0.989* 253.801
57 V 0.989* 253.801
58 S 0.989* 253.801
59 A 0.989* 253.801
60 L 0.989* 253.801
61 L 0.989* 253.801
62 E 0.989* 253.801
63 A 0.989* 253.801
64 L 0.989* 253.801
65 P 0.989* 253.801
66 K 0.989* 253.801
67 V 0.989* 253.801
68 G 0.989* 253.801
69 K 0.989* 253.801
70 V 0.989* 253.801
71 K 0.989* 253.801
72 A 0.989* 253.801
73 Q 0.989* 253.801
74 E 0.989* 253.801
75 I 0.989* 253.801
76 M 0.989* 253.801
77 T 0.989* 253.801
78 E 0.989* 253.801
79 L 0.989* 253.801
80 D 0.989* 253.801
81 I 0.989* 253.801
82 A 0.989* 253.801
83 P 0.989* 253.801
84 T 0.989* 253.801
85 R 0.989* 253.801
86 R 0.989* 253.801
87 L 0.989* 253.801
88 R 0.989* 253.801
89 G 0.989* 253.801
90 L 0.989* 253.801
91 G 0.989* 253.801
92 E 0.989* 253.801
93 R 0.989* 253.801
94 Q 0.989* 253.801
95 R 0.989* 253.801
96 K 0.989* 253.801
97 A 0.989* 253.801
98 L 0.989* 253.801
99 L 0.989* 253.801
100 E 0.989* 253.801
101 K 0.989* 253.801
102 F 0.989* 253.801
103 G 0.989* 253.801
104 S 0.989* 253.801
105 A 0.989* 253.801
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907783_1_559_MLBR_RS02650)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -405.877964 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 17.275581 0.559759 1.807177
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907783_1_559_MLBR_RS02650: 0.000004, NC_002677_1_NP_301459_1_331_mihF: 0.000004, NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410: 0.000004, NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815: 0.000004, NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925: 0.000004, NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 17.27558
Parameters in M7 (beta):
p = 0.55976 q = 1.80718
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00240 0.01722 0.04348 0.08090 0.13017 0.19289 0.27201 0.37313 0.50851 0.71919
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
7..2 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
7..3 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
7..4 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
7..5 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
7..6 0.000 223.3 91.7 0.2340 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -405.877781 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 17.211604 0.000010 0.882314 0.005000 245.889582
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907783_1_559_MLBR_RS02650: 0.000004, NC_002677_1_NP_301459_1_331_mihF: 0.000004, NZ_LVXE01000008_1_WP_010907783_1_2723_A3216_RS04410: 0.000004, NZ_LYPH01000055_1_WP_010907783_1_2050_A8144_RS09815: 0.000004, NZ_CP029543_1_WP_010907783_1_573_DIJ64_RS02925: 0.000004, NZ_AP014567_1_WP_010907783_1_591_JK2ML_RS03015: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 17.21160
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.88231 q = 0.00500
(p1 = 0.99999) w = 245.88958
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99996 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 245.88958
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
7..2 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
7..3 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
7..4 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
7..5 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
7..6 0.000 223.3 91.7 245.8871 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907783_1_559_MLBR_RS02650)
Pr(w>1) post mean +- SE for w
1 V 1.000** 245.887
2 A 1.000** 245.887
3 L 1.000** 245.887
4 P 1.000** 245.887
5 Q 1.000** 245.887
6 L 1.000** 245.887
7 T 1.000** 245.887
8 D 1.000** 245.887
9 E 1.000** 245.887
10 Q 1.000** 245.887
11 R 1.000** 245.887
12 A 1.000** 245.887
13 A 1.000** 245.887
14 A 1.000** 245.887
15 L 1.000** 245.887
16 E 1.000** 245.887
17 K 1.000** 245.887
18 A 1.000** 245.887
19 A 1.000** 245.887
20 A 1.000** 245.887
21 A 1.000** 245.887
22 R 1.000** 245.887
23 R 1.000** 245.887
24 A 1.000** 245.887
25 R 1.000** 245.887
26 A 1.000** 245.887
27 E 1.000** 245.887
28 L 1.000** 245.887
29 K 1.000** 245.887
30 D 1.000** 245.887
31 R 1.000** 245.887
32 L 1.000** 245.887
33 K 1.000** 245.887
34 R 1.000** 245.887
35 G 1.000** 245.887
36 G 1.000** 245.887
37 T 1.000** 245.887
38 N 1.000** 245.887
39 L 1.000** 245.887
40 T 1.000** 245.887
41 Q 1.000** 245.887
42 V 1.000** 245.887
43 L 1.000** 245.887
44 K 1.000** 245.887
45 D 1.000** 245.887
46 A 1.000** 245.887
47 E 1.000** 245.887
48 S 1.000** 245.887
49 D 1.000** 245.887
50 E 1.000** 245.887
51 V 1.000** 245.887
52 L 1.000** 245.887
53 G 1.000** 245.887
54 K 1.000** 245.887
55 M 1.000** 245.887
56 K 1.000** 245.887
57 V 1.000** 245.887
58 S 1.000** 245.887
59 A 1.000** 245.887
60 L 1.000** 245.887
61 L 1.000** 245.887
62 E 1.000** 245.887
63 A 1.000** 245.887
64 L 1.000** 245.887
65 P 1.000** 245.887
66 K 1.000** 245.887
67 V 1.000** 245.887
68 G 1.000** 245.887
69 K 1.000** 245.887
70 V 1.000** 245.887
71 K 1.000** 245.887
72 A 1.000** 245.887
73 Q 1.000** 245.887
74 E 1.000** 245.887
75 I 1.000** 245.887
76 M 1.000** 245.887
77 T 1.000** 245.887
78 E 1.000** 245.887
79 L 1.000** 245.887
80 D 1.000** 245.887
81 I 1.000** 245.887
82 A 1.000** 245.887
83 P 1.000** 245.887
84 T 1.000** 245.887
85 R 1.000** 245.887
86 R 1.000** 245.887
87 L 1.000** 245.887
88 R 1.000** 245.887
89 G 1.000** 245.887
90 L 1.000** 245.887
91 G 1.000** 245.887
92 E 1.000** 245.887
93 R 1.000** 245.887
94 Q 1.000** 245.887
95 R 1.000** 245.887
96 K 1.000** 245.887
97 A 1.000** 245.887
98 L 1.000** 245.887
99 L 1.000** 245.887
100 E 1.000** 245.887
101 K 1.000** 245.887
102 F 1.000** 245.887
103 G 1.000** 245.887
104 S 1.000** 245.887
105 A 1.000** 245.887
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907783_1_559_MLBR_RS02650)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -405.877907 Model 2: PositiveSelection -405.877781 Model 0: one-ratio -405.877781 Model 7: beta -405.877964 Model 8: beta&w>1 -405.877781 Model 0 vs 1 2.5199999993219535E-4 Model 2 vs 1 2.5199999993219535E-4 Model 8 vs 7 3.6599999998543353E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
