--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:29:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/mihF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -425.04 -428.39
2 -425.07 -427.95
--------------------------------------
TOTAL -425.05 -428.19
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901669 0.089881 0.395678 1.497034 0.865119 1313.17 1326.21 1.000
r(A<->C){all} 0.153739 0.015728 0.000004 0.392968 0.124279 214.09 238.78 1.000
r(A<->G){all} 0.176741 0.018999 0.000008 0.446021 0.146492 178.17 248.36 1.009
r(A<->T){all} 0.168426 0.018659 0.000081 0.444462 0.135526 138.87 180.83 1.001
r(C<->G){all} 0.159379 0.017255 0.000154 0.436599 0.125881 187.98 244.51 1.000
r(C<->T){all} 0.169897 0.018890 0.000027 0.446860 0.134431 259.40 260.42 1.006
r(G<->T){all} 0.171817 0.019473 0.000020 0.437535 0.141044 173.25 177.63 1.000
pi(A){all} 0.225302 0.000567 0.179762 0.271619 0.224961 1195.36 1223.94 1.000
pi(C){all} 0.282571 0.000650 0.231698 0.329833 0.282023 1227.68 1286.29 1.000
pi(G){all} 0.340920 0.000738 0.291221 0.396605 0.340473 1163.59 1267.16 1.000
pi(T){all} 0.151207 0.000402 0.114472 0.191490 0.151234 1278.22 1339.65 1.000
alpha{1,2} 0.409079 0.219884 0.000112 1.372095 0.243418 1129.95 1184.52 1.001
alpha{3} 0.449978 0.222383 0.000198 1.351429 0.295672 1117.19 1309.09 1.000
pinvar{all} 0.994917 0.000039 0.982786 0.999997 0.996922 1133.69 1297.37 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -405.877907
Model 2: PositiveSelection -405.877781
Model 0: one-ratio -405.877781
Model 7: beta -405.877964
Model 8: beta&w>1 -405.877781
Model 0 vs 1 2.5199999993219535E-4
Model 2 vs 1 2.5199999993219535E-4
Model 8 vs 7 3.6599999998543353E-4
>C1
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C2
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C3
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C4
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C5
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C6
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=105
C1 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C2 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C3 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C4 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C5 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C6 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
**************************************************
C1 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C2 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C3 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C4 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C5 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C6 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
**************************************************
C1 KFGSA
C2 KFGSA
C3 KFGSA
C4 KFGSA
C5 KFGSA
C6 KFGSA
*****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 105 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 105 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3150]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3150]--->[3150]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.455 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C2 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C3 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C4 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C5 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
C6 VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
**************************************************
C1 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C2 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C3 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C4 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C5 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
C6 VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
**************************************************
C1 KFGSA
C2 KFGSA
C3 KFGSA
C4 KFGSA
C5 KFGSA
C6 KFGSA
*****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C2 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C3 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C4 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C5 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
C6 GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
**************************************************
C1 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C2 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C3 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C4 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C5 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
C6 GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
**************************************************
C1 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C2 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C3 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C4 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C5 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
C6 GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
**************************************************
C1 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C2 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C3 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C4 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C5 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
C6 GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
**************************************************
C1 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C2 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C3 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C4 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C5 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
C6 GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
**************************************************
C1 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C2 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C3 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C4 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C5 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
C6 CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
**************************************************
C1 AAGTTCGGCTCCGCT
C2 AAGTTCGGCTCCGCT
C3 AAGTTCGGCTCCGCT
C4 AAGTTCGGCTCCGCT
C5 AAGTTCGGCTCCGCT
C6 AAGTTCGGCTCCGCT
***************
>C1
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C2
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C3
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C4
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C5
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C6
GTGGCCCTTCCCCAGTTGACCGACGAGCAGCGCGCGGCCGCGTTGGAGAA
GGCTGCTGCCGCACGTCGAGCACGAGCAGAGCTTAAGGATCGGCTCAAGC
GCGGCGGCACCAACCTCACACAGGTGCTAAAGGATGCGGAAAGTGATGAA
GTCTTGGGTAAGATGAAGGTGTCTGCGCTACTGGAGGCATTGCCGAAGGT
GGGCAAGGTCAAAGCGCAGGAAATCATGACCGAGCTGGACATCGCACCGA
CCCGCCGGCTGCGCGGCCTCGGCGAGCGTCAGCGCAAAGCGCTACTGGAA
AAGTTCGGCTCCGCT
>C1
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C2
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C3
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C4
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C5
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
>C6
VALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDE
VLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLE
KFGSA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 315 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579793297
Setting output file names to "/data/3res/mihF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1407008590
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0010583267
Seed = 102108396
Swapseed = 1579793297
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -704.985062 -- -24.965149
Chain 2 -- -704.985102 -- -24.965149
Chain 3 -- -704.984995 -- -24.965149
Chain 4 -- -704.985102 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -704.985102 -- -24.965149
Chain 2 -- -704.985102 -- -24.965149
Chain 3 -- -704.985062 -- -24.965149
Chain 4 -- -704.984995 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-704.985] (-704.985) (-704.985) (-704.985) * [-704.985] (-704.985) (-704.985) (-704.985)
500 -- [-430.189] (-444.597) (-435.498) (-450.390) * [-433.379] (-437.476) (-438.126) (-433.862) -- 0:00:00
1000 -- (-431.087) [-435.407] (-436.839) (-446.981) * (-432.753) (-441.773) [-437.956] (-446.367) -- 0:00:00
1500 -- (-439.218) [-430.685] (-437.724) (-437.704) * (-437.172) (-434.799) (-437.753) [-436.280] -- 0:00:00
2000 -- (-433.963) (-437.440) [-436.641] (-437.187) * (-433.342) [-437.541] (-436.414) (-434.867) -- 0:00:00
2500 -- (-433.962) (-436.302) [-439.990] (-429.649) * (-439.135) [-428.202] (-435.727) (-440.061) -- 0:00:00
3000 -- (-438.914) [-437.777] (-438.907) (-439.306) * [-429.579] (-438.309) (-435.682) (-431.418) -- 0:00:00
3500 -- (-441.618) (-437.690) (-433.374) [-431.564] * (-430.738) (-445.517) [-438.692] (-437.735) -- 0:00:00
4000 -- [-436.167] (-439.249) (-441.047) (-437.124) * [-429.089] (-443.320) (-448.831) (-431.509) -- 0:00:00
4500 -- (-434.317) [-432.947] (-433.890) (-434.394) * [-431.527] (-448.091) (-436.184) (-434.057) -- 0:00:00
5000 -- (-437.490) (-440.417) [-443.312] (-435.189) * [-431.303] (-436.798) (-434.501) (-429.982) -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-435.043) (-441.771) [-432.844] (-435.939) * (-435.020) [-426.878] (-437.007) (-440.896) -- 0:00:00
6000 -- (-439.068) [-435.411] (-429.862) (-429.668) * (-434.220) (-429.829) (-436.340) [-433.957] -- 0:00:00
6500 -- (-436.617) (-434.052) [-436.598] (-436.579) * [-430.893] (-424.538) (-436.674) (-437.094) -- 0:00:00
7000 -- (-436.846) [-431.907] (-434.941) (-439.035) * (-431.713) [-424.670] (-446.539) (-436.538) -- 0:00:00
7500 -- [-433.595] (-444.832) (-433.993) (-442.618) * (-432.722) (-424.530) [-435.536] (-436.207) -- 0:00:00
8000 -- [-434.141] (-432.521) (-432.452) (-435.192) * (-443.877) [-425.669] (-431.076) (-434.203) -- 0:00:00
8500 -- (-435.515) (-439.921) (-434.950) [-433.838] * (-433.695) (-427.650) [-431.939] (-438.423) -- 0:00:00
9000 -- (-435.829) (-457.551) (-443.493) [-432.794] * [-437.237] (-426.976) (-436.852) (-434.036) -- 0:00:00
9500 -- (-437.270) (-447.336) (-432.513) [-437.855] * (-433.769) (-426.567) [-434.466] (-439.037) -- 0:00:00
10000 -- (-436.439) [-436.144] (-428.221) (-436.474) * [-432.955] (-424.862) (-437.710) (-438.424) -- 0:00:00
Average standard deviation of split frequencies: 0.057452
10500 -- (-430.045) (-427.883) [-424.722] (-439.086) * (-434.585) [-425.748] (-438.240) (-436.295) -- 0:00:00
11000 -- (-436.683) [-424.921] (-424.340) (-438.299) * (-430.950) (-425.160) (-431.012) [-431.078] -- 0:00:00
11500 -- (-431.886) (-426.336) [-424.837] (-432.049) * [-431.105] (-423.921) (-429.149) (-431.295) -- 0:00:00
12000 -- (-439.746) [-426.233] (-425.128) (-429.461) * (-438.344) [-424.945] (-434.544) (-439.211) -- 0:00:00
12500 -- [-433.529] (-429.042) (-424.435) (-424.153) * [-429.883] (-432.136) (-436.788) (-440.323) -- 0:00:00
13000 -- [-434.606] (-425.264) (-425.236) (-426.692) * (-434.290) (-424.598) [-431.476] (-436.654) -- 0:00:00
13500 -- (-435.969) (-426.689) (-428.287) [-424.952] * (-437.403) [-426.056] (-436.176) (-436.208) -- 0:01:13
14000 -- (-436.305) (-426.118) (-425.822) [-426.361] * [-438.268] (-427.148) (-435.021) (-439.918) -- 0:01:10
14500 -- (-432.316) (-425.908) (-425.414) [-430.118] * [-427.164] (-428.176) (-440.616) (-437.515) -- 0:01:07
15000 -- (-436.391) (-425.471) [-425.045] (-424.819) * [-432.928] (-425.938) (-441.454) (-430.233) -- 0:01:05
Average standard deviation of split frequencies: 0.060562
15500 -- [-433.815] (-425.310) (-424.687) (-425.876) * (-431.248) [-428.097] (-430.907) (-442.698) -- 0:01:03
16000 -- [-430.699] (-425.586) (-428.050) (-426.502) * (-432.351) (-426.152) (-430.912) [-433.997] -- 0:01:01
16500 -- [-435.836] (-425.137) (-428.700) (-428.494) * (-435.306) (-426.806) (-441.656) [-434.818] -- 0:00:59
17000 -- (-440.192) [-426.539] (-429.457) (-429.277) * (-433.863) (-424.983) [-435.140] (-435.643) -- 0:00:57
17500 -- (-434.957) (-430.874) [-425.357] (-425.436) * (-434.427) (-425.885) (-447.205) [-448.220] -- 0:00:56
18000 -- (-434.931) (-428.961) [-424.356] (-425.100) * [-431.708] (-425.265) (-449.057) (-444.738) -- 0:00:54
18500 -- (-436.440) (-426.718) [-424.382] (-424.302) * (-435.325) (-425.782) (-432.406) [-434.228] -- 0:00:53
19000 -- (-436.383) (-424.548) [-425.110] (-426.134) * (-436.275) (-427.445) (-437.220) [-433.905] -- 0:00:51
19500 -- [-434.040] (-428.519) (-424.751) (-426.748) * (-435.546) [-428.173] (-437.975) (-434.026) -- 0:00:50
20000 -- (-432.568) (-425.354) (-424.746) [-425.519] * (-435.419) [-424.400] (-448.426) (-431.500) -- 0:00:49
Average standard deviation of split frequencies: 0.061721
20500 -- (-436.391) [-425.565] (-424.656) (-427.382) * (-435.138) [-425.891] (-437.661) (-435.888) -- 0:00:47
21000 -- (-435.967) (-424.881) [-423.572] (-428.436) * (-429.990) [-425.187] (-434.120) (-442.348) -- 0:00:46
21500 -- (-432.343) [-424.241] (-427.379) (-427.118) * (-435.027) (-424.749) [-436.115] (-427.573) -- 0:00:45
22000 -- (-443.362) (-423.844) [-425.121] (-424.633) * (-442.478) [-423.422] (-428.639) (-424.483) -- 0:00:44
22500 -- (-434.047) (-426.203) (-426.346) [-426.828] * (-439.869) (-424.109) [-424.284] (-427.268) -- 0:00:43
23000 -- [-437.279] (-426.006) (-427.403) (-426.468) * (-433.635) [-424.797] (-424.892) (-424.138) -- 0:00:42
23500 -- (-432.305) [-427.661] (-430.502) (-424.801) * [-433.117] (-426.403) (-424.236) (-425.082) -- 0:00:41
24000 -- (-431.066) (-428.322) [-424.436] (-425.728) * (-437.965) [-424.789] (-425.512) (-424.771) -- 0:00:40
24500 -- (-433.725) [-425.073] (-425.966) (-423.813) * (-430.950) (-427.492) (-425.124) [-424.704] -- 0:00:39
25000 -- (-436.576) (-425.567) [-429.461] (-424.457) * (-433.344) (-423.430) (-428.251) [-425.852] -- 0:00:39
Average standard deviation of split frequencies: 0.050767
25500 -- (-438.597) (-427.597) [-424.741] (-423.320) * (-438.823) (-426.106) [-424.810] (-423.747) -- 0:00:38
26000 -- (-435.719) (-427.402) [-423.642] (-432.750) * [-434.982] (-425.434) (-424.827) (-426.994) -- 0:00:37
26500 -- (-443.584) (-426.513) [-424.312] (-429.985) * (-435.200) (-424.589) [-427.156] (-424.295) -- 0:00:36
27000 -- (-430.132) [-424.178] (-425.189) (-425.010) * (-432.993) [-424.551] (-424.767) (-424.203) -- 0:00:36
27500 -- (-427.429) (-426.618) [-424.536] (-424.600) * [-435.314] (-424.688) (-424.656) (-426.646) -- 0:00:35
28000 -- (-426.310) (-425.380) [-424.360] (-425.095) * (-434.052) (-423.964) (-425.792) [-425.264] -- 0:00:34
28500 -- (-424.085) (-428.131) [-423.901] (-424.753) * [-435.657] (-427.576) (-427.060) (-424.349) -- 0:00:34
29000 -- (-425.234) (-425.397) (-425.959) [-425.865] * (-439.477) (-426.466) [-427.514] (-428.995) -- 0:00:33
29500 -- (-426.926) (-425.866) [-424.770] (-425.256) * (-434.995) [-427.752] (-427.435) (-424.836) -- 0:01:05
30000 -- (-426.312) [-426.505] (-425.155) (-424.363) * (-433.246) (-425.250) [-427.629] (-429.031) -- 0:01:04
Average standard deviation of split frequencies: 0.054570
30500 -- (-431.102) (-425.038) [-424.559] (-426.309) * (-437.342) (-430.064) [-425.479] (-425.706) -- 0:01:03
31000 -- (-427.742) [-424.182] (-425.235) (-424.918) * (-436.383) (-427.998) (-425.974) [-425.148] -- 0:01:02
31500 -- (-431.745) (-430.572) (-424.053) [-424.723] * (-432.729) (-424.570) [-426.829] (-424.305) -- 0:01:01
32000 -- (-425.193) (-426.328) [-428.353] (-427.958) * (-440.160) [-428.626] (-427.359) (-428.364) -- 0:01:00
32500 -- [-423.647] (-430.112) (-424.786) (-427.746) * (-442.579) (-426.352) [-426.302] (-424.059) -- 0:00:59
33000 -- (-424.679) [-430.446] (-425.435) (-425.494) * (-434.560) [-426.422] (-426.143) (-426.517) -- 0:00:58
33500 -- (-426.520) (-425.049) (-427.032) [-427.009] * [-430.792] (-425.047) (-424.298) (-427.421) -- 0:00:57
34000 -- [-424.886] (-424.001) (-424.383) (-426.158) * [-429.784] (-424.858) (-431.236) (-427.199) -- 0:00:56
34500 -- (-424.339) (-427.384) [-424.660] (-425.124) * (-440.332) [-427.787] (-432.534) (-428.390) -- 0:00:55
35000 -- (-425.187) (-425.787) [-425.364] (-424.829) * (-441.571) (-424.220) (-429.482) [-426.421] -- 0:00:55
Average standard deviation of split frequencies: 0.047795
35500 -- (-424.968) [-428.017] (-423.608) (-426.154) * (-443.183) (-425.368) [-425.055] (-424.300) -- 0:00:54
36000 -- (-424.750) (-425.929) (-424.621) [-426.154] * [-433.147] (-429.551) (-432.656) (-424.851) -- 0:00:53
36500 -- (-424.999) (-427.650) (-424.100) [-424.491] * [-430.286] (-426.082) (-428.601) (-425.354) -- 0:00:52
37000 -- (-426.675) (-428.911) (-425.805) [-427.586] * (-433.994) (-426.267) [-431.946] (-425.500) -- 0:00:52
37500 -- (-424.421) (-432.601) [-424.488] (-426.021) * (-432.741) (-426.507) (-428.818) [-426.566] -- 0:00:51
38000 -- (-425.697) [-425.305] (-425.757) (-425.117) * (-436.558) (-426.034) (-425.642) [-424.521] -- 0:00:50
38500 -- (-424.999) (-426.191) [-426.576] (-423.552) * [-438.116] (-425.346) (-424.396) (-432.774) -- 0:00:49
39000 -- (-425.617) [-425.890] (-424.871) (-424.530) * (-441.226) (-424.388) (-426.589) [-430.795] -- 0:00:49
39500 -- [-426.942] (-425.362) (-425.031) (-424.000) * (-433.400) (-425.290) [-424.847] (-424.963) -- 0:00:48
40000 -- (-426.953) (-425.880) [-424.468] (-424.167) * (-442.660) (-425.002) [-423.484] (-425.150) -- 0:00:48
Average standard deviation of split frequencies: 0.037937
40500 -- (-430.290) [-425.046] (-423.671) (-429.010) * (-432.725) [-427.066] (-427.265) (-426.401) -- 0:00:47
41000 -- (-426.978) (-424.828) (-423.775) [-425.699] * (-442.537) (-427.451) [-424.525] (-425.643) -- 0:00:46
41500 -- (-427.024) (-425.662) (-426.092) [-425.111] * [-435.898] (-428.031) (-424.472) (-426.166) -- 0:00:46
42000 -- (-427.278) (-423.962) (-425.834) [-424.452] * [-439.845] (-427.469) (-423.561) (-425.340) -- 0:00:45
42500 -- [-427.119] (-428.188) (-427.154) (-424.988) * (-429.392) (-425.454) (-423.926) [-426.865] -- 0:00:45
43000 -- (-426.429) (-424.648) (-427.318) [-425.356] * (-438.324) (-425.464) [-424.536] (-424.366) -- 0:00:44
43500 -- [-431.176] (-425.113) (-426.904) (-424.688) * (-431.055) (-427.973) (-425.269) [-425.361] -- 0:00:43
44000 -- [-425.696] (-425.906) (-425.078) (-424.780) * (-443.311) [-423.741] (-425.258) (-429.322) -- 0:00:43
44500 -- (-428.204) (-425.766) [-427.462] (-427.687) * (-449.287) [-426.733] (-428.903) (-428.868) -- 0:00:42
45000 -- (-425.994) (-424.612) [-425.053] (-425.643) * (-446.318) (-426.915) (-424.704) [-424.649] -- 0:01:03
Average standard deviation of split frequencies: 0.038552
45500 -- (-432.975) (-428.835) [-425.008] (-424.322) * (-433.060) [-426.005] (-428.505) (-428.619) -- 0:01:02
46000 -- (-433.220) [-427.313] (-424.619) (-425.300) * (-425.353) (-427.811) (-428.013) [-426.401] -- 0:01:02
46500 -- [-427.347] (-426.993) (-425.501) (-423.590) * (-428.290) (-425.481) (-427.625) [-424.679] -- 0:01:01
47000 -- (-425.377) (-427.855) (-425.430) [-430.635] * (-427.991) [-427.661] (-426.171) (-425.329) -- 0:01:00
47500 -- (-426.753) (-426.714) [-424.313] (-425.716) * (-428.448) [-424.506] (-425.069) (-424.523) -- 0:01:00
48000 -- (-426.607) (-426.529) (-425.495) [-427.950] * (-425.602) [-427.570] (-426.545) (-424.379) -- 0:00:59
48500 -- [-424.118] (-426.557) (-424.516) (-424.021) * (-426.026) (-432.553) (-428.075) [-423.864] -- 0:00:58
49000 -- [-424.298] (-427.570) (-427.027) (-424.008) * (-428.918) [-425.561] (-427.002) (-423.972) -- 0:00:58
49500 -- (-427.482) (-428.613) [-426.799] (-426.843) * (-427.128) (-430.095) (-426.125) [-424.961] -- 0:00:57
50000 -- (-426.389) (-424.839) (-424.568) [-426.336] * (-430.081) (-425.412) (-425.739) [-425.319] -- 0:00:57
Average standard deviation of split frequencies: 0.044748
50500 -- (-427.327) (-423.981) [-428.861] (-424.736) * (-428.005) (-427.293) (-425.654) [-425.104] -- 0:00:56
51000 -- [-424.618] (-424.775) (-427.343) (-426.012) * [-427.803] (-425.540) (-425.617) (-427.071) -- 0:00:55
51500 -- (-424.000) (-424.572) [-427.859] (-424.401) * (-426.975) (-426.518) (-424.289) [-424.650] -- 0:00:55
52000 -- (-426.144) [-424.632] (-430.645) (-424.354) * (-423.702) [-425.904] (-424.166) (-424.397) -- 0:00:54
52500 -- (-427.245) (-424.125) (-425.643) [-424.406] * (-427.200) (-428.057) [-425.305] (-427.021) -- 0:00:54
53000 -- (-425.632) (-425.055) [-425.373] (-424.485) * (-425.423) [-425.677] (-425.050) (-424.456) -- 0:00:53
53500 -- (-426.761) (-424.403) [-424.207] (-426.836) * (-424.577) (-425.417) (-424.423) [-425.459] -- 0:00:53
54000 -- (-425.640) (-428.611) [-424.217] (-428.318) * (-424.507) (-424.901) (-424.324) [-426.390] -- 0:00:52
54500 -- [-424.751] (-431.123) (-428.271) (-425.904) * (-424.712) (-426.719) [-425.089] (-427.281) -- 0:00:52
55000 -- (-428.312) [-425.011] (-425.012) (-424.335) * (-424.958) (-428.941) [-427.953] (-424.401) -- 0:00:51
Average standard deviation of split frequencies: 0.042511
55500 -- (-426.014) (-427.725) (-427.082) [-428.335] * (-427.079) (-429.329) [-426.044] (-425.816) -- 0:00:51
56000 -- (-424.539) [-425.076] (-426.517) (-424.890) * (-428.834) (-425.336) (-424.662) [-424.937] -- 0:00:50
56500 -- (-432.979) (-424.536) (-425.305) [-425.421] * (-424.348) [-423.827] (-429.041) (-426.143) -- 0:00:50
57000 -- (-426.296) [-424.042] (-426.540) (-424.776) * (-425.341) (-424.103) (-429.495) [-424.797] -- 0:00:49
57500 -- [-427.083] (-425.004) (-424.949) (-426.452) * [-427.942] (-427.226) (-425.353) (-426.923) -- 0:00:49
58000 -- (-426.938) (-428.035) [-425.515] (-424.996) * (-425.568) (-423.887) [-427.681] (-426.648) -- 0:00:48
58500 -- (-425.167) (-424.121) [-426.905] (-426.752) * (-425.615) (-424.591) [-425.235] (-427.411) -- 0:00:48
59000 -- (-425.444) (-425.650) (-424.657) [-425.159] * [-427.820] (-424.620) (-426.358) (-426.810) -- 0:00:47
59500 -- [-424.758] (-424.478) (-424.866) (-425.266) * (-425.532) [-423.971] (-424.313) (-425.944) -- 0:00:47
60000 -- (-425.508) [-428.803] (-427.522) (-426.242) * (-425.479) (-428.040) (-431.385) [-425.536] -- 0:00:47
Average standard deviation of split frequencies: 0.036807
60500 -- (-425.653) [-426.772] (-427.369) (-427.782) * (-427.102) [-426.398] (-426.890) (-427.289) -- 0:00:46
61000 -- (-423.953) [-429.293] (-427.270) (-425.791) * [-425.255] (-425.823) (-429.319) (-430.637) -- 0:01:01
61500 -- (-423.763) (-428.252) (-424.609) [-426.457] * (-425.424) [-426.343] (-427.461) (-432.146) -- 0:01:01
62000 -- (-424.951) (-425.936) (-426.097) [-425.394] * [-425.790] (-426.127) (-426.834) (-425.880) -- 0:01:00
62500 -- [-425.245] (-428.371) (-426.440) (-423.537) * [-425.503] (-424.161) (-425.674) (-423.613) -- 0:01:00
63000 -- (-425.323) (-429.370) (-425.700) [-425.254] * [-425.644] (-423.829) (-426.678) (-425.735) -- 0:00:59
63500 -- [-427.225] (-426.683) (-429.616) (-429.416) * (-425.755) (-423.989) [-425.966] (-426.501) -- 0:00:58
64000 -- [-425.813] (-427.150) (-426.217) (-428.435) * (-425.216) [-423.983] (-426.875) (-425.907) -- 0:00:58
64500 -- (-425.110) (-425.193) (-428.887) [-425.993] * (-425.069) (-426.053) (-423.844) [-424.480] -- 0:00:58
65000 -- [-424.491] (-424.307) (-424.194) (-425.919) * [-427.277] (-425.311) (-425.032) (-424.822) -- 0:00:57
Average standard deviation of split frequencies: 0.027856
65500 -- [-428.004] (-426.387) (-425.523) (-427.982) * (-427.508) (-425.895) (-425.512) [-425.637] -- 0:00:57
66000 -- (-426.165) [-424.040] (-425.750) (-424.937) * (-426.225) [-428.484] (-425.945) (-426.377) -- 0:00:56
66500 -- [-427.905] (-425.268) (-430.038) (-430.461) * (-425.282) [-424.929] (-425.080) (-424.457) -- 0:00:56
67000 -- [-425.494] (-425.434) (-428.726) (-425.342) * [-424.029] (-426.757) (-424.663) (-426.748) -- 0:00:55
67500 -- [-427.823] (-427.469) (-429.867) (-424.379) * (-424.814) [-425.152] (-427.497) (-427.072) -- 0:00:55
68000 -- (-425.868) (-426.765) [-425.052] (-424.517) * (-426.714) [-424.768] (-425.896) (-427.641) -- 0:00:54
68500 -- (-428.812) (-424.731) (-427.423) [-426.716] * (-426.640) (-426.454) (-424.290) [-427.776] -- 0:00:54
69000 -- [-427.122] (-425.162) (-424.908) (-427.596) * (-427.509) [-424.374] (-424.255) (-429.359) -- 0:00:53
69500 -- (-428.213) (-426.218) (-427.078) [-425.322] * (-427.075) [-426.401] (-428.280) (-427.248) -- 0:00:53
70000 -- (-425.506) (-424.787) [-424.546] (-426.395) * (-428.618) (-430.426) [-429.715] (-426.649) -- 0:00:53
Average standard deviation of split frequencies: 0.025279
70500 -- (-424.123) (-427.673) (-424.054) [-424.655] * (-426.446) (-430.498) [-427.457] (-426.624) -- 0:00:52
71000 -- (-426.820) (-426.371) (-427.454) [-424.542] * (-426.615) (-425.619) (-425.015) [-425.257] -- 0:00:52
71500 -- (-429.523) (-425.940) (-427.352) [-425.230] * (-428.242) [-426.994] (-425.571) (-424.071) -- 0:00:51
72000 -- (-427.982) (-427.371) [-425.080] (-427.519) * (-424.172) (-423.743) (-426.366) [-424.716] -- 0:00:51
72500 -- (-426.906) (-425.967) (-429.753) [-426.311] * (-430.114) (-426.564) (-427.395) [-426.379] -- 0:00:51
73000 -- (-424.547) [-427.935] (-427.770) (-426.878) * [-424.773] (-425.516) (-426.095) (-427.591) -- 0:00:50
73500 -- (-427.240) [-423.842] (-425.544) (-424.403) * (-427.878) [-425.919] (-425.842) (-425.051) -- 0:00:50
74000 -- (-426.179) (-424.236) [-425.709] (-425.246) * (-435.082) (-424.156) (-426.971) [-427.067] -- 0:00:50
74500 -- (-427.130) (-424.587) [-425.506] (-424.079) * [-425.136] (-426.044) (-426.777) (-424.955) -- 0:00:49
75000 -- (-424.868) (-429.559) (-425.007) [-426.112] * (-425.430) (-426.467) [-426.387] (-428.794) -- 0:00:49
Average standard deviation of split frequencies: 0.024811
75500 -- (-424.945) (-426.509) (-424.238) [-426.661] * (-425.474) (-424.581) (-426.798) [-428.014] -- 0:00:48
76000 -- (-428.866) [-424.244] (-425.167) (-425.093) * (-427.843) [-427.082] (-427.572) (-425.145) -- 0:00:48
76500 -- [-425.097] (-431.758) (-430.173) (-425.438) * (-426.832) [-428.351] (-425.618) (-427.677) -- 0:00:48
77000 -- (-425.988) [-428.417] (-427.974) (-425.563) * [-426.725] (-427.658) (-428.712) (-425.006) -- 0:00:47
77500 -- [-423.630] (-424.569) (-424.544) (-426.874) * (-424.683) (-427.054) (-429.457) [-425.771] -- 0:00:47
78000 -- (-424.600) (-425.767) [-424.667] (-428.041) * [-424.963] (-425.177) (-425.173) (-428.592) -- 0:00:59
78500 -- (-430.278) [-425.961] (-427.230) (-425.552) * (-423.624) [-425.847] (-426.526) (-424.785) -- 0:00:58
79000 -- [-427.147] (-424.642) (-425.458) (-426.732) * [-425.530] (-425.080) (-424.175) (-424.425) -- 0:00:58
79500 -- (-423.922) (-424.217) [-425.224] (-425.228) * (-426.998) [-425.363] (-424.698) (-424.864) -- 0:00:57
80000 -- (-424.102) (-426.047) [-425.653] (-429.146) * (-425.995) [-424.233] (-425.166) (-429.511) -- 0:00:57
Average standard deviation of split frequencies: 0.022453
80500 -- [-424.851] (-423.813) (-425.325) (-427.156) * (-426.201) [-430.188] (-426.091) (-424.392) -- 0:00:57
81000 -- [-424.641] (-423.606) (-431.094) (-430.552) * (-426.428) [-427.494] (-426.007) (-428.271) -- 0:00:56
81500 -- (-427.697) [-426.999] (-426.058) (-425.328) * (-427.475) (-426.136) [-425.120] (-425.638) -- 0:00:56
82000 -- (-423.871) (-429.600) (-427.750) [-428.195] * (-425.809) [-426.827] (-426.155) (-427.000) -- 0:00:55
82500 -- (-427.955) (-425.211) (-426.642) [-427.268] * (-425.096) (-428.457) [-426.092] (-425.557) -- 0:00:55
83000 -- (-425.257) (-427.974) (-423.647) [-424.346] * (-426.497) (-426.336) [-430.435] (-426.065) -- 0:00:55
83500 -- [-426.963] (-429.682) (-423.762) (-426.396) * [-426.185] (-426.773) (-427.510) (-425.926) -- 0:00:54
84000 -- (-427.650) [-424.281] (-425.978) (-424.306) * (-424.756) (-426.596) (-425.840) [-424.575] -- 0:00:54
84500 -- (-427.755) (-425.394) (-424.046) [-426.953] * [-425.623] (-427.436) (-424.367) (-424.693) -- 0:00:54
85000 -- (-425.737) (-426.385) [-424.935] (-425.371) * (-425.097) [-426.041] (-428.088) (-424.666) -- 0:00:53
Average standard deviation of split frequencies: 0.022503
85500 -- (-425.097) (-425.817) [-425.639] (-424.036) * [-424.677] (-426.373) (-427.686) (-430.747) -- 0:00:53
86000 -- (-426.694) [-426.295] (-428.248) (-425.860) * (-427.823) (-425.132) (-425.772) [-425.994] -- 0:00:53
86500 -- (-430.312) (-424.244) (-430.282) [-428.339] * (-427.543) [-423.880] (-424.058) (-424.400) -- 0:00:52
87000 -- (-426.932) [-428.313] (-427.787) (-427.764) * (-427.335) (-429.173) (-428.168) [-424.703] -- 0:00:52
87500 -- (-425.189) (-425.075) (-425.704) [-424.788] * [-423.472] (-432.153) (-425.723) (-424.852) -- 0:00:52
88000 -- (-424.153) (-428.194) [-424.161] (-424.161) * (-424.172) [-428.741] (-425.269) (-426.974) -- 0:00:51
88500 -- (-424.363) (-425.920) [-426.122] (-428.008) * (-427.836) (-424.909) [-429.806] (-426.582) -- 0:00:51
89000 -- [-424.375] (-426.388) (-424.332) (-425.532) * (-424.887) (-424.961) (-426.848) [-424.513] -- 0:00:51
89500 -- (-425.389) (-424.990) [-425.994] (-424.211) * (-423.785) (-424.470) (-425.708) [-426.234] -- 0:00:50
90000 -- (-424.620) [-426.692] (-429.269) (-426.658) * (-425.831) (-424.343) [-425.079] (-426.058) -- 0:00:50
Average standard deviation of split frequencies: 0.020797
90500 -- [-424.006] (-430.780) (-430.991) (-428.436) * (-426.920) [-426.234] (-425.396) (-426.568) -- 0:00:50
91000 -- [-426.662] (-426.471) (-424.424) (-427.932) * [-426.298] (-426.101) (-426.426) (-426.701) -- 0:00:49
91500 -- (-427.630) (-427.658) (-427.082) [-424.530] * (-424.337) (-428.064) (-426.435) [-426.206] -- 0:00:49
92000 -- (-427.182) [-426.550] (-425.409) (-424.145) * (-427.185) (-424.749) [-425.721] (-425.413) -- 0:00:49
92500 -- [-425.793] (-425.748) (-425.757) (-427.071) * (-427.377) [-424.596] (-426.486) (-430.359) -- 0:00:49
93000 -- (-426.975) (-427.248) [-426.468] (-430.036) * [-424.844] (-426.449) (-430.441) (-427.603) -- 0:00:48
93500 -- (-427.232) (-424.630) [-424.986] (-426.703) * (-425.358) (-429.081) [-429.229] (-427.624) -- 0:00:48
94000 -- (-425.854) [-425.580] (-423.889) (-425.084) * [-427.792] (-430.481) (-424.103) (-425.990) -- 0:00:48
94500 -- (-424.323) (-427.443) (-429.200) [-424.872] * (-427.880) (-426.448) [-427.607] (-427.998) -- 0:00:57
95000 -- (-427.868) (-427.335) [-426.622] (-424.861) * (-424.469) [-425.442] (-430.802) (-426.836) -- 0:00:57
Average standard deviation of split frequencies: 0.020110
95500 -- [-425.540] (-425.530) (-424.250) (-427.142) * [-426.450] (-430.258) (-424.157) (-423.879) -- 0:00:56
96000 -- (-427.699) (-426.127) [-425.180] (-424.239) * [-429.119] (-425.798) (-425.593) (-423.773) -- 0:00:56
96500 -- [-428.300] (-429.390) (-423.764) (-428.941) * (-426.814) [-426.275] (-431.667) (-426.135) -- 0:00:56
97000 -- (-426.046) (-425.519) [-425.235] (-424.095) * (-428.707) (-431.387) [-426.717] (-426.173) -- 0:00:55
97500 -- (-424.811) (-423.948) [-425.165] (-425.335) * (-424.845) [-424.617] (-425.547) (-427.411) -- 0:00:55
98000 -- (-429.835) (-424.300) (-428.897) [-429.972] * [-429.137] (-428.579) (-426.520) (-425.016) -- 0:00:55
98500 -- [-429.978] (-425.425) (-425.499) (-427.201) * (-428.343) (-427.828) (-429.095) [-425.345] -- 0:00:54
99000 -- (-429.208) (-426.485) [-427.029] (-424.282) * (-427.640) (-427.425) (-425.838) [-428.674] -- 0:00:54
99500 -- (-425.233) (-427.216) [-423.725] (-425.489) * (-424.419) [-428.433] (-428.763) (-425.374) -- 0:00:54
100000 -- (-426.302) [-426.832] (-423.566) (-425.839) * (-424.853) (-427.848) (-425.603) [-426.075] -- 0:00:54
Average standard deviation of split frequencies: 0.019400
100500 -- (-424.765) (-430.872) [-424.822] (-424.071) * (-424.340) (-426.150) [-428.011] (-425.779) -- 0:00:53
101000 -- [-424.308] (-424.786) (-424.043) (-428.208) * (-425.910) [-427.518] (-424.926) (-424.597) -- 0:00:53
101500 -- (-426.474) (-425.393) [-425.242] (-425.881) * [-424.207] (-426.204) (-425.049) (-427.759) -- 0:00:53
102000 -- (-425.549) (-424.518) [-423.693] (-424.451) * (-426.833) (-427.608) (-425.056) [-426.986] -- 0:00:52
102500 -- [-428.911] (-424.090) (-430.763) (-425.525) * [-426.884] (-424.904) (-426.487) (-425.293) -- 0:00:52
103000 -- [-430.074] (-427.787) (-431.152) (-424.687) * [-428.623] (-425.265) (-426.860) (-426.726) -- 0:00:52
103500 -- [-425.702] (-425.679) (-429.600) (-426.120) * [-424.455] (-423.662) (-426.871) (-426.025) -- 0:00:51
104000 -- (-426.546) (-425.738) [-428.987] (-424.557) * (-425.382) (-425.365) (-429.540) [-426.336] -- 0:00:51
104500 -- (-424.879) [-423.520] (-427.653) (-425.266) * [-423.572] (-424.675) (-427.870) (-426.158) -- 0:00:51
105000 -- [-425.269] (-425.306) (-428.438) (-424.225) * (-426.180) [-425.260] (-424.959) (-424.943) -- 0:00:51
Average standard deviation of split frequencies: 0.019271
105500 -- [-426.514] (-425.066) (-425.693) (-424.603) * [-425.229] (-427.556) (-424.754) (-428.630) -- 0:00:50
106000 -- (-425.096) (-424.863) (-424.603) [-423.986] * [-428.187] (-424.340) (-425.902) (-426.693) -- 0:00:50
106500 -- (-424.224) [-426.247] (-427.606) (-424.491) * (-427.019) [-424.371] (-426.564) (-426.218) -- 0:00:50
107000 -- (-425.493) (-427.957) (-426.609) [-424.366] * (-430.527) (-426.100) (-427.015) [-427.033] -- 0:00:50
107500 -- (-425.643) (-423.521) [-426.073] (-424.104) * [-424.409] (-427.581) (-425.482) (-425.843) -- 0:00:49
108000 -- (-427.417) (-425.835) (-424.235) [-427.352] * (-427.959) (-424.453) (-426.700) [-424.165] -- 0:00:49
108500 -- (-428.527) [-425.747] (-428.299) (-427.555) * (-425.830) [-424.787] (-425.338) (-424.530) -- 0:00:49
109000 -- (-428.313) (-426.596) [-429.390] (-428.701) * (-424.695) (-426.205) (-429.030) [-425.683] -- 0:00:49
109500 -- (-424.635) [-428.549] (-428.037) (-426.977) * (-424.895) (-425.499) (-427.496) [-424.303] -- 0:00:48
110000 -- [-424.787] (-427.455) (-425.849) (-424.723) * (-425.382) (-428.351) [-427.857] (-426.159) -- 0:00:48
Average standard deviation of split frequencies: 0.020233
110500 -- (-428.506) (-424.747) [-424.768] (-424.783) * (-427.210) [-428.737] (-430.855) (-427.582) -- 0:00:48
111000 -- (-429.610) [-427.130] (-425.805) (-428.493) * (-428.096) [-426.204] (-425.530) (-426.761) -- 0:00:48
111500 -- (-426.515) (-428.550) [-426.148] (-426.670) * (-426.174) (-425.984) (-425.095) [-425.142] -- 0:00:55
112000 -- (-426.225) (-429.227) [-424.334] (-428.484) * (-424.910) [-423.994] (-424.654) (-423.974) -- 0:00:55
112500 -- (-425.279) (-425.410) (-425.088) [-424.927] * (-424.068) (-427.041) [-425.915] (-425.017) -- 0:00:55
113000 -- (-425.577) (-426.463) [-424.361] (-428.403) * [-425.067] (-426.024) (-427.784) (-427.143) -- 0:00:54
113500 -- (-424.401) [-427.822] (-425.145) (-426.714) * (-424.582) [-426.498] (-425.968) (-424.429) -- 0:00:54
114000 -- (-425.154) (-428.562) [-425.758] (-424.615) * (-431.826) (-423.564) [-425.243] (-429.983) -- 0:00:54
114500 -- (-425.041) (-424.901) (-425.008) [-426.590] * [-427.222] (-425.717) (-426.981) (-429.296) -- 0:00:54
115000 -- (-424.872) (-427.847) (-424.155) [-425.232] * (-424.911) (-424.591) [-427.794] (-425.434) -- 0:00:53
Average standard deviation of split frequencies: 0.015828
115500 -- (-424.016) (-425.909) (-424.717) [-427.307] * (-425.443) [-424.665] (-423.660) (-426.184) -- 0:00:53
116000 -- (-424.454) [-423.962] (-426.279) (-425.827) * (-427.357) [-426.271] (-427.622) (-423.919) -- 0:00:53
116500 -- [-424.503] (-425.408) (-424.485) (-427.301) * (-427.155) (-427.141) [-427.220] (-428.912) -- 0:00:53
117000 -- (-425.088) [-424.319] (-424.825) (-424.875) * (-426.110) (-424.553) (-426.237) [-426.368] -- 0:00:52
117500 -- (-426.633) (-424.826) (-424.312) [-425.203] * [-424.471] (-428.228) (-426.052) (-426.493) -- 0:00:52
118000 -- (-428.433) (-424.616) (-424.683) [-426.355] * (-423.882) [-424.659] (-426.381) (-426.851) -- 0:00:52
118500 -- [-427.684] (-425.294) (-425.694) (-425.828) * (-428.289) [-424.385] (-425.933) (-424.562) -- 0:00:52
119000 -- (-428.001) [-424.722] (-425.094) (-429.632) * (-425.270) (-426.765) [-424.518] (-425.709) -- 0:00:51
119500 -- (-427.655) (-427.089) [-426.259] (-424.715) * (-427.820) (-427.744) (-423.896) [-426.541] -- 0:00:51
120000 -- [-425.800] (-425.143) (-430.183) (-426.794) * (-425.157) (-424.287) [-424.263] (-426.468) -- 0:00:51
Average standard deviation of split frequencies: 0.015215
120500 -- (-427.424) (-425.562) [-428.586] (-425.577) * (-426.092) (-424.452) [-424.914] (-426.816) -- 0:00:51
121000 -- (-425.588) (-425.509) (-426.952) [-424.795] * [-424.081] (-427.162) (-424.711) (-425.131) -- 0:00:50
121500 -- (-425.933) [-426.429] (-426.689) (-426.673) * (-424.900) (-425.229) (-428.715) [-424.851] -- 0:00:50
122000 -- [-426.724] (-425.323) (-423.781) (-426.200) * (-426.549) [-424.656] (-426.625) (-423.791) -- 0:00:50
122500 -- (-429.317) [-424.288] (-426.141) (-427.378) * (-432.221) [-427.002] (-426.629) (-425.707) -- 0:00:50
123000 -- (-427.831) [-425.501] (-426.235) (-424.326) * (-426.007) [-425.329] (-425.399) (-425.517) -- 0:00:49
123500 -- (-425.481) (-426.606) [-425.821] (-425.012) * [-428.358] (-426.983) (-424.649) (-424.819) -- 0:00:49
124000 -- (-424.171) (-426.067) (-423.703) [-424.330] * (-426.544) [-425.789] (-427.246) (-428.294) -- 0:00:49
124500 -- (-426.383) (-424.784) (-426.140) [-432.966] * (-423.641) [-425.184] (-424.059) (-426.231) -- 0:00:49
125000 -- (-426.656) [-427.726] (-424.397) (-427.957) * (-427.712) (-424.900) (-424.242) [-429.032] -- 0:00:49
Average standard deviation of split frequencies: 0.015322
125500 -- (-424.303) (-427.839) (-424.781) [-425.882] * (-424.395) [-424.888] (-427.371) (-426.390) -- 0:00:48
126000 -- [-423.988] (-425.281) (-427.057) (-429.549) * (-424.657) [-425.195] (-424.849) (-425.827) -- 0:00:48
126500 -- (-426.459) [-424.594] (-424.053) (-430.105) * [-425.274] (-424.683) (-426.861) (-425.563) -- 0:00:48
127000 -- (-425.171) (-424.157) [-424.920] (-427.686) * [-426.437] (-425.002) (-424.784) (-426.564) -- 0:00:48
127500 -- [-425.331] (-425.836) (-424.968) (-424.702) * (-430.045) [-427.149] (-425.507) (-426.424) -- 0:00:47
128000 -- (-427.633) [-424.398] (-424.953) (-424.636) * [-425.282] (-425.009) (-429.513) (-432.853) -- 0:00:47
128500 -- [-427.524] (-426.554) (-426.329) (-426.411) * (-433.182) (-426.381) [-428.034] (-426.961) -- 0:00:47
129000 -- [-426.972] (-424.939) (-427.330) (-425.732) * (-429.662) (-425.301) [-427.939] (-426.697) -- 0:00:54
129500 -- (-426.744) [-425.847] (-424.971) (-425.594) * (-425.765) [-425.942] (-430.230) (-428.435) -- 0:00:53
130000 -- (-425.330) (-424.777) [-424.578] (-423.679) * (-429.530) [-428.443] (-425.976) (-430.599) -- 0:00:53
Average standard deviation of split frequencies: 0.013291
130500 -- (-426.403) (-425.210) (-423.877) [-425.354] * [-424.871] (-424.909) (-426.110) (-428.466) -- 0:00:53
131000 -- (-427.746) (-425.992) [-425.303] (-425.261) * (-424.322) [-429.193] (-424.262) (-425.147) -- 0:00:53
131500 -- (-427.949) (-426.180) [-429.479] (-423.689) * (-425.306) [-425.871] (-425.424) (-426.034) -- 0:00:52
132000 -- [-423.770] (-426.922) (-429.131) (-424.923) * (-425.895) (-424.969) (-426.705) [-423.869] -- 0:00:52
132500 -- (-430.904) (-427.043) (-430.564) [-425.556] * (-430.630) (-427.409) [-423.657] (-426.276) -- 0:00:52
133000 -- (-424.189) (-424.467) (-428.197) [-424.862] * (-429.471) (-425.447) [-424.508] (-425.771) -- 0:00:52
133500 -- (-426.591) [-424.588] (-426.817) (-425.702) * (-430.250) [-425.196] (-425.926) (-423.744) -- 0:00:51
134000 -- (-426.346) [-429.745] (-431.476) (-428.617) * (-428.494) (-424.294) (-430.872) [-426.402] -- 0:00:51
134500 -- (-426.470) (-423.989) (-427.224) [-431.608] * (-426.514) (-427.929) (-427.148) [-425.737] -- 0:00:51
135000 -- [-425.998] (-424.245) (-425.607) (-426.815) * (-427.710) (-424.474) (-425.309) [-427.369] -- 0:00:51
Average standard deviation of split frequencies: 0.011361
135500 -- [-424.087] (-427.897) (-423.718) (-425.478) * (-424.010) (-425.578) [-426.952] (-424.036) -- 0:00:51
136000 -- (-424.019) (-425.839) [-428.760] (-430.410) * (-424.370) [-425.576] (-425.412) (-425.659) -- 0:00:50
136500 -- (-425.141) (-424.755) (-424.742) [-424.814] * [-424.428] (-425.140) (-425.187) (-426.072) -- 0:00:50
137000 -- [-425.189] (-425.039) (-424.168) (-425.504) * (-424.240) (-428.929) (-426.774) [-425.778] -- 0:00:50
137500 -- (-427.230) [-424.972] (-425.963) (-425.876) * [-424.758] (-427.791) (-425.816) (-425.626) -- 0:00:50
138000 -- (-427.296) (-426.207) [-424.812] (-424.397) * (-425.185) [-428.035] (-426.496) (-424.574) -- 0:00:49
138500 -- [-424.775] (-425.975) (-428.972) (-425.792) * (-425.325) (-423.494) (-426.722) [-424.384] -- 0:00:49
139000 -- (-432.572) [-427.013] (-426.416) (-425.477) * (-427.462) (-430.580) [-423.675] (-424.398) -- 0:00:49
139500 -- (-425.231) (-424.490) [-424.506] (-425.084) * (-426.882) (-433.695) (-425.952) [-425.462] -- 0:00:49
140000 -- (-426.007) [-426.665] (-425.150) (-425.379) * (-424.266) (-426.925) [-425.589] (-424.825) -- 0:00:49
Average standard deviation of split frequencies: 0.013033
140500 -- (-427.754) [-424.984] (-426.557) (-430.092) * (-425.106) (-426.085) [-425.545] (-428.656) -- 0:00:48
141000 -- (-426.510) [-425.894] (-425.848) (-427.321) * [-424.228] (-428.293) (-424.266) (-424.499) -- 0:00:48
141500 -- (-424.107) (-426.661) [-427.508] (-428.527) * (-424.481) (-426.012) (-424.728) [-425.097] -- 0:00:48
142000 -- [-424.643] (-427.282) (-427.091) (-425.601) * (-425.366) (-425.660) [-424.956] (-425.411) -- 0:00:48
142500 -- [-425.948] (-429.550) (-423.587) (-426.905) * (-425.074) (-425.000) (-425.168) [-426.019] -- 0:00:48
143000 -- [-425.867] (-424.948) (-424.495) (-430.724) * (-424.247) (-430.265) [-428.266] (-425.116) -- 0:00:47
143500 -- (-428.167) (-429.089) [-425.818] (-427.089) * (-425.989) (-425.502) (-430.220) [-426.405] -- 0:00:47
144000 -- (-425.319) [-424.894] (-424.999) (-429.895) * [-425.555] (-427.368) (-430.284) (-428.886) -- 0:00:47
144500 -- [-425.295] (-426.431) (-425.325) (-426.082) * (-424.672) (-427.172) [-425.494] (-426.641) -- 0:00:47
145000 -- (-426.004) (-426.931) (-427.479) [-425.645] * (-426.667) [-424.831] (-424.338) (-427.166) -- 0:00:47
Average standard deviation of split frequencies: 0.016314
145500 -- (-428.284) (-425.217) [-425.616] (-428.334) * (-426.103) [-429.845] (-424.580) (-429.125) -- 0:00:46
146000 -- (-424.379) (-425.906) (-427.256) [-423.512] * (-427.024) (-427.519) (-426.465) [-425.252] -- 0:00:52
146500 -- (-423.856) (-424.313) [-425.919] (-429.490) * (-425.819) (-425.863) (-426.928) [-426.461] -- 0:00:52
147000 -- (-426.058) [-428.590] (-425.253) (-426.813) * [-426.460] (-429.653) (-424.774) (-425.540) -- 0:00:52
147500 -- (-427.135) (-425.105) [-424.356] (-429.149) * [-425.950] (-427.250) (-428.658) (-424.566) -- 0:00:52
148000 -- (-427.972) (-425.475) (-426.120) [-425.761] * (-428.255) [-426.921] (-427.084) (-426.056) -- 0:00:51
148500 -- (-424.669) [-426.474] (-428.609) (-425.936) * (-427.854) (-427.493) (-424.531) [-425.025] -- 0:00:51
149000 -- (-429.050) (-426.167) (-426.978) [-425.192] * (-424.952) (-430.584) [-427.169] (-425.000) -- 0:00:51
149500 -- [-433.005] (-426.592) (-428.270) (-424.519) * (-427.191) [-425.727] (-427.448) (-428.327) -- 0:00:51
150000 -- (-426.378) (-424.514) (-424.724) [-424.334] * [-424.932] (-425.774) (-424.832) (-428.969) -- 0:00:51
Average standard deviation of split frequencies: 0.014985
150500 -- (-430.906) (-431.915) (-424.899) [-425.045] * [-426.469] (-423.747) (-425.221) (-426.575) -- 0:00:50
151000 -- (-428.611) (-427.363) (-425.289) [-424.222] * [-428.240] (-426.296) (-424.041) (-425.872) -- 0:00:50
151500 -- (-425.073) (-426.112) [-426.271] (-426.043) * [-426.903] (-426.595) (-424.187) (-424.880) -- 0:00:50
152000 -- (-425.327) [-427.045] (-434.296) (-424.911) * [-426.545] (-425.547) (-425.027) (-425.715) -- 0:00:50
152500 -- (-427.169) [-431.079] (-426.870) (-428.628) * (-424.119) (-423.935) (-426.340) [-425.368] -- 0:00:50
153000 -- [-424.923] (-429.153) (-425.123) (-426.422) * [-425.638] (-424.370) (-425.183) (-429.513) -- 0:00:49
153500 -- (-424.511) (-425.467) (-424.134) [-424.847] * (-428.436) (-425.250) (-427.319) [-427.231] -- 0:00:49
154000 -- (-425.033) (-424.899) [-425.752] (-434.137) * [-425.476] (-425.783) (-427.453) (-428.705) -- 0:00:49
154500 -- (-425.638) (-424.317) [-424.583] (-435.444) * (-429.370) (-427.710) [-428.641] (-432.539) -- 0:00:49
155000 -- [-426.928] (-426.836) (-427.899) (-433.719) * (-425.608) (-425.450) (-426.202) [-424.597] -- 0:00:49
Average standard deviation of split frequencies: 0.012265
155500 -- (-425.707) [-424.946] (-426.556) (-425.038) * [-426.530] (-426.616) (-424.658) (-424.451) -- 0:00:48
156000 -- (-425.829) (-428.451) [-425.127] (-424.557) * (-423.503) [-424.957] (-423.382) (-426.621) -- 0:00:48
156500 -- (-427.188) (-426.654) (-426.445) [-428.171] * [-430.372] (-424.484) (-425.550) (-424.335) -- 0:00:48
157000 -- (-425.140) [-425.995] (-424.957) (-424.394) * [-424.659] (-423.641) (-427.256) (-423.731) -- 0:00:48
157500 -- (-426.902) [-424.155] (-425.779) (-424.267) * (-426.905) (-423.988) (-424.821) [-424.400] -- 0:00:48
158000 -- [-423.518] (-425.237) (-424.582) (-428.390) * [-428.523] (-423.947) (-425.049) (-426.291) -- 0:00:47
158500 -- [-425.148] (-425.520) (-424.714) (-425.015) * (-424.137) [-426.632] (-425.133) (-428.088) -- 0:00:47
159000 -- (-425.325) (-426.056) [-425.015] (-427.273) * (-427.848) [-424.829] (-423.790) (-424.923) -- 0:00:47
159500 -- (-425.332) (-426.066) [-430.032] (-425.659) * (-423.642) (-431.127) [-428.986] (-425.893) -- 0:00:47
160000 -- (-426.441) (-425.366) (-429.546) [-425.852] * (-423.846) (-426.144) (-427.319) [-426.022] -- 0:00:47
Average standard deviation of split frequencies: 0.010528
160500 -- (-431.147) (-424.292) [-427.338] (-427.839) * (-426.104) (-424.586) (-425.305) [-426.111] -- 0:00:47
161000 -- (-425.512) [-425.890] (-428.604) (-425.113) * [-424.302] (-424.856) (-429.278) (-424.659) -- 0:00:46
161500 -- (-425.453) (-430.561) (-429.024) [-425.715] * [-424.898] (-426.499) (-425.793) (-426.847) -- 0:00:46
162000 -- (-424.951) [-428.235] (-425.011) (-425.417) * (-425.036) (-426.752) [-425.615] (-425.021) -- 0:00:46
162500 -- (-425.144) (-425.632) [-424.779] (-424.209) * (-425.162) (-424.437) [-424.454] (-428.080) -- 0:00:46
163000 -- (-425.678) [-429.353] (-424.801) (-423.962) * [-424.553] (-423.920) (-423.668) (-425.941) -- 0:00:46
163500 -- [-425.996] (-427.532) (-424.771) (-425.776) * [-424.692] (-424.979) (-427.446) (-425.583) -- 0:00:51
164000 -- (-428.251) [-424.304] (-430.770) (-428.555) * (-427.484) [-426.780] (-426.306) (-426.963) -- 0:00:50
164500 -- (-426.379) (-426.582) [-427.125] (-426.872) * (-424.998) (-426.845) [-427.258] (-426.563) -- 0:00:50
165000 -- (-423.933) (-426.301) (-424.468) [-424.830] * (-426.463) (-426.449) [-427.940] (-430.431) -- 0:00:50
Average standard deviation of split frequencies: 0.010097
165500 -- (-427.205) (-426.925) [-426.581] (-427.800) * (-426.056) [-425.001] (-425.474) (-425.451) -- 0:00:50
166000 -- (-430.713) (-426.813) [-428.700] (-426.675) * (-424.413) (-427.282) (-425.808) [-424.983] -- 0:00:50
166500 -- (-428.760) (-426.516) (-432.539) [-425.903] * [-424.999] (-423.791) (-426.092) (-426.076) -- 0:00:50
167000 -- (-425.944) (-424.853) (-427.557) [-427.231] * (-425.935) (-424.752) (-424.622) [-425.059] -- 0:00:49
167500 -- (-425.570) [-427.640] (-424.135) (-424.123) * [-427.871] (-424.288) (-425.255) (-426.180) -- 0:00:49
168000 -- (-429.140) (-426.456) (-426.418) [-423.735] * [-424.237] (-423.463) (-426.851) (-425.500) -- 0:00:49
168500 -- (-428.190) [-424.159] (-425.941) (-428.452) * (-424.230) [-424.189] (-427.513) (-424.302) -- 0:00:49
169000 -- (-424.957) (-423.906) [-424.030] (-426.399) * (-425.628) (-424.868) [-424.032] (-426.742) -- 0:00:49
169500 -- [-425.334] (-423.957) (-424.448) (-425.808) * (-425.685) (-424.939) (-427.488) [-428.546] -- 0:00:48
170000 -- (-424.624) (-425.240) [-424.147] (-426.522) * (-424.245) (-424.143) [-426.265] (-427.326) -- 0:00:48
Average standard deviation of split frequencies: 0.009667
170500 -- (-424.893) (-424.134) [-425.514] (-427.192) * [-426.043] (-426.685) (-428.448) (-425.444) -- 0:00:48
171000 -- (-429.026) (-428.090) (-426.722) [-425.924] * (-425.608) [-425.661] (-426.243) (-426.143) -- 0:00:48
171500 -- (-427.638) (-425.998) (-424.872) [-425.230] * (-425.576) (-425.090) [-424.389] (-425.476) -- 0:00:48
172000 -- (-428.942) (-424.172) (-426.732) [-425.886] * (-425.378) [-429.437] (-426.874) (-425.296) -- 0:00:48
172500 -- [-424.985] (-428.579) (-424.416) (-426.038) * (-424.680) (-427.986) (-424.472) [-425.509] -- 0:00:47
173000 -- (-425.924) (-431.819) [-423.617] (-429.339) * (-428.473) (-428.017) [-427.096] (-424.352) -- 0:00:47
173500 -- [-423.760] (-424.585) (-430.210) (-428.285) * (-425.130) (-425.943) [-424.901] (-426.193) -- 0:00:47
174000 -- (-425.624) (-426.819) (-428.132) [-426.048] * (-426.570) (-427.400) [-428.260] (-431.184) -- 0:00:47
174500 -- (-427.348) (-425.410) (-428.655) [-425.936] * (-424.896) (-427.091) [-424.691] (-428.605) -- 0:00:47
175000 -- [-426.007] (-424.236) (-425.787) (-424.346) * (-428.224) (-425.120) (-425.966) [-424.965] -- 0:00:47
Average standard deviation of split frequencies: 0.012289
175500 -- [-424.290] (-425.849) (-424.713) (-430.377) * (-428.387) [-424.092] (-425.563) (-425.025) -- 0:00:46
176000 -- (-424.353) (-425.470) [-423.823] (-430.528) * (-424.703) (-425.263) (-428.549) [-427.043] -- 0:00:46
176500 -- (-425.280) (-423.620) [-428.106] (-428.089) * (-425.012) (-423.782) (-424.195) [-424.736] -- 0:00:46
177000 -- (-424.874) [-426.067] (-438.633) (-427.249) * (-426.431) (-426.500) [-426.629] (-424.363) -- 0:00:46
177500 -- [-425.824] (-424.408) (-433.176) (-424.180) * (-428.933) (-429.551) (-427.583) [-423.669] -- 0:00:46
178000 -- [-425.081] (-425.910) (-430.360) (-427.689) * (-426.710) (-427.650) (-427.644) [-424.128] -- 0:00:46
178500 -- (-427.848) (-425.699) (-430.073) [-424.503] * (-427.089) [-432.386] (-424.283) (-424.480) -- 0:00:46
179000 -- [-425.939] (-426.193) (-427.189) (-425.573) * (-424.614) (-428.899) [-425.983] (-431.885) -- 0:00:45
179500 -- (-426.278) (-428.508) (-428.391) [-425.857] * (-425.457) (-427.620) [-425.019] (-428.680) -- 0:00:45
180000 -- (-427.140) (-429.017) [-429.043] (-425.935) * [-424.806] (-425.073) (-425.406) (-425.808) -- 0:00:45
Average standard deviation of split frequencies: 0.012739
180500 -- (-428.048) (-425.893) [-425.184] (-427.670) * [-425.060] (-425.290) (-423.536) (-425.648) -- 0:00:49
181000 -- (-425.693) (-424.751) [-425.813] (-428.627) * (-424.603) [-424.607] (-425.123) (-424.040) -- 0:00:49
181500 -- (-423.934) (-425.308) [-423.853] (-429.984) * [-423.929] (-425.960) (-423.758) (-425.923) -- 0:00:49
182000 -- [-425.680] (-424.225) (-425.665) (-425.061) * (-426.492) [-426.564] (-424.892) (-427.053) -- 0:00:49
182500 -- (-425.762) (-424.824) [-425.655] (-424.701) * (-426.466) (-425.066) [-423.890] (-426.121) -- 0:00:49
183000 -- (-427.079) [-426.863] (-426.059) (-426.485) * (-425.914) [-425.335] (-427.540) (-428.321) -- 0:00:49
183500 -- (-427.454) (-425.934) [-427.509] (-426.853) * (-425.430) [-424.855] (-426.375) (-424.464) -- 0:00:48
184000 -- (-427.363) [-425.061] (-423.754) (-424.325) * [-427.228] (-425.879) (-425.658) (-424.141) -- 0:00:48
184500 -- (-426.368) (-425.049) (-425.090) [-424.639] * (-433.015) (-425.633) [-424.508] (-425.419) -- 0:00:48
185000 -- (-425.605) (-424.082) (-424.312) [-424.663] * (-426.192) [-426.615] (-426.081) (-426.845) -- 0:00:48
Average standard deviation of split frequencies: 0.013095
185500 -- (-425.268) (-423.993) [-425.322] (-424.575) * (-427.942) [-424.884] (-425.677) (-424.384) -- 0:00:48
186000 -- (-424.928) (-423.533) (-427.108) [-423.812] * (-427.053) (-425.024) [-427.273] (-426.367) -- 0:00:48
186500 -- (-425.447) (-426.461) [-424.683] (-424.589) * [-427.467] (-424.606) (-425.659) (-428.680) -- 0:00:47
187000 -- (-429.496) (-428.354) [-428.319] (-425.067) * (-427.047) (-426.082) (-424.131) [-427.220] -- 0:00:47
187500 -- (-431.632) (-424.722) (-425.759) [-424.616] * (-423.979) (-425.761) [-425.370] (-426.187) -- 0:00:47
188000 -- (-426.171) [-427.281] (-428.230) (-426.179) * (-426.030) (-424.728) [-426.940] (-427.798) -- 0:00:47
188500 -- (-426.615) [-426.631] (-425.667) (-427.476) * (-430.499) (-426.028) (-424.595) [-428.603] -- 0:00:47
189000 -- [-426.521] (-426.355) (-428.352) (-427.557) * (-424.300) (-426.182) (-425.299) [-426.972] -- 0:00:47
189500 -- (-424.426) [-425.545] (-425.713) (-425.456) * [-424.603] (-427.562) (-425.222) (-426.073) -- 0:00:47
190000 -- (-423.917) (-428.400) [-429.380] (-430.651) * (-426.995) (-424.239) (-424.863) [-429.566] -- 0:00:46
Average standard deviation of split frequencies: 0.011926
190500 -- (-426.433) [-427.610] (-424.550) (-424.980) * (-426.944) (-426.505) (-425.336) [-426.072] -- 0:00:46
191000 -- (-426.213) (-426.716) [-428.579] (-428.590) * [-424.491] (-426.179) (-426.825) (-425.734) -- 0:00:46
191500 -- (-425.843) [-424.774] (-426.556) (-424.399) * [-423.804] (-425.138) (-426.303) (-425.025) -- 0:00:46
192000 -- (-424.482) [-424.695] (-424.658) (-424.659) * [-424.970] (-426.094) (-424.096) (-424.929) -- 0:00:46
192500 -- (-425.818) (-424.763) [-424.494] (-429.446) * (-426.037) [-423.936] (-423.777) (-426.982) -- 0:00:46
193000 -- [-424.654] (-424.483) (-427.481) (-426.779) * (-426.176) (-425.774) (-428.798) [-427.225] -- 0:00:45
193500 -- [-424.610] (-427.794) (-427.661) (-430.341) * (-425.138) [-426.170] (-426.067) (-427.888) -- 0:00:45
194000 -- (-426.611) (-424.731) [-426.642] (-426.630) * [-427.212] (-427.093) (-425.571) (-425.602) -- 0:00:45
194500 -- (-425.484) (-424.201) [-425.438] (-427.163) * (-427.256) [-427.087] (-426.774) (-425.243) -- 0:00:45
195000 -- [-425.325] (-425.813) (-424.944) (-426.278) * [-424.930] (-431.299) (-425.752) (-424.331) -- 0:00:45
Average standard deviation of split frequencies: 0.012928
195500 -- [-424.433] (-424.418) (-426.047) (-425.931) * [-425.462] (-423.738) (-426.398) (-428.870) -- 0:00:45
196000 -- (-425.813) (-427.213) [-423.813] (-425.457) * [-423.781] (-425.974) (-424.667) (-427.844) -- 0:00:45
196500 -- [-424.141] (-426.620) (-424.802) (-426.639) * [-424.495] (-426.617) (-426.666) (-427.394) -- 0:00:44
197000 -- (-425.720) (-426.208) [-424.414] (-424.441) * (-423.400) (-427.433) [-427.881] (-426.837) -- 0:00:44
197500 -- (-424.478) [-424.732] (-432.977) (-426.644) * (-426.187) (-427.669) [-424.051] (-427.551) -- 0:00:48
198000 -- (-425.268) (-426.224) (-424.565) [-427.637] * (-432.216) (-426.300) (-424.130) [-424.035] -- 0:00:48
198500 -- (-426.556) [-425.692] (-426.933) (-428.335) * (-427.087) (-424.843) [-423.441] (-427.591) -- 0:00:48
199000 -- [-424.727] (-425.463) (-425.171) (-426.566) * (-427.921) [-424.643] (-425.610) (-426.944) -- 0:00:48
199500 -- [-428.752] (-424.072) (-425.851) (-436.961) * (-425.875) [-425.439] (-427.144) (-423.481) -- 0:00:48
200000 -- (-425.443) [-424.699] (-425.164) (-426.332) * [-425.524] (-423.535) (-427.495) (-424.934) -- 0:00:48
Average standard deviation of split frequencies: 0.012713
200500 -- (-427.373) (-428.348) [-424.760] (-428.043) * (-426.532) [-424.580] (-427.772) (-423.724) -- 0:00:47
201000 -- (-428.717) [-425.220] (-427.083) (-425.040) * (-424.216) (-425.813) (-425.685) [-424.507] -- 0:00:47
201500 -- (-426.411) (-427.512) (-425.145) [-425.864] * (-424.565) [-425.592] (-425.619) (-425.575) -- 0:00:47
202000 -- (-426.152) (-428.709) (-424.888) [-425.632] * (-425.584) [-425.529] (-431.588) (-428.766) -- 0:00:47
202500 -- [-425.685] (-426.649) (-426.002) (-428.549) * (-425.916) [-427.032] (-433.297) (-426.127) -- 0:00:47
203000 -- (-425.990) [-426.123] (-424.439) (-426.567) * (-427.891) (-424.164) [-427.330] (-425.327) -- 0:00:47
203500 -- [-427.987] (-424.107) (-425.294) (-424.822) * (-424.351) [-426.971] (-426.092) (-426.115) -- 0:00:46
204000 -- (-429.226) (-424.457) [-425.673] (-424.035) * (-424.184) (-426.858) (-430.121) [-424.749] -- 0:00:46
204500 -- [-425.742] (-425.052) (-425.996) (-424.424) * (-429.665) (-426.401) [-428.833] (-423.697) -- 0:00:46
205000 -- (-426.952) (-424.796) [-428.735] (-424.985) * (-425.636) [-425.423] (-424.527) (-424.894) -- 0:00:46
Average standard deviation of split frequencies: 0.011315
205500 -- (-425.398) [-427.841] (-425.098) (-426.908) * (-427.009) (-427.688) [-425.665] (-423.774) -- 0:00:46
206000 -- (-426.553) (-431.043) (-425.780) [-429.270] * (-431.057) (-429.064) [-425.024] (-425.431) -- 0:00:46
206500 -- [-427.982] (-426.739) (-425.015) (-425.614) * (-428.187) [-423.509] (-424.311) (-429.510) -- 0:00:46
207000 -- (-425.528) [-425.601] (-425.013) (-423.895) * (-430.006) [-427.940] (-432.143) (-425.277) -- 0:00:45
207500 -- (-424.800) (-424.788) [-424.161] (-426.561) * (-428.635) (-427.779) [-433.090] (-424.117) -- 0:00:45
208000 -- (-424.125) (-428.041) [-426.385] (-423.999) * (-431.891) (-430.382) (-430.955) [-428.144] -- 0:00:45
208500 -- (-425.053) [-428.748] (-427.418) (-424.172) * (-429.801) [-428.233] (-424.569) (-427.086) -- 0:00:45
209000 -- (-428.771) (-429.666) (-427.487) [-426.071] * (-428.510) (-432.392) [-425.452] (-427.197) -- 0:00:45
209500 -- [-429.885] (-427.673) (-425.893) (-427.088) * (-425.968) (-423.909) (-426.001) [-423.867] -- 0:00:45
210000 -- (-428.380) (-425.029) (-428.046) [-424.930] * (-425.664) (-425.470) (-425.036) [-424.224] -- 0:00:45
Average standard deviation of split frequencies: 0.009930
210500 -- (-425.823) [-425.789] (-427.834) (-427.001) * (-424.280) (-424.982) [-427.160] (-425.977) -- 0:00:45
211000 -- (-425.571) [-425.171] (-426.306) (-426.405) * [-425.793] (-426.341) (-425.673) (-424.228) -- 0:00:44
211500 -- [-423.746] (-425.246) (-427.123) (-425.650) * [-424.534] (-426.996) (-424.808) (-424.193) -- 0:00:44
212000 -- [-427.596] (-426.476) (-424.910) (-424.879) * (-429.176) (-426.854) [-424.485] (-426.056) -- 0:00:44
212500 -- (-426.703) (-426.450) (-424.900) [-426.367] * [-426.036] (-430.194) (-426.716) (-426.366) -- 0:00:44
213000 -- (-425.019) (-425.093) (-424.994) [-426.557] * [-426.278] (-432.133) (-426.932) (-425.088) -- 0:00:44
213500 -- (-423.784) (-425.808) (-426.507) [-424.444] * (-425.847) (-426.656) (-427.527) [-424.711] -- 0:00:44
214000 -- (-428.970) (-425.761) (-425.490) [-426.543] * (-430.171) [-427.279] (-425.939) (-427.323) -- 0:00:44
214500 -- (-425.912) (-424.770) (-425.689) [-427.104] * (-426.257) (-425.911) (-425.456) [-423.797] -- 0:00:47
215000 -- (-424.783) [-424.836] (-424.219) (-426.473) * (-423.918) [-424.072] (-431.454) (-423.849) -- 0:00:47
Average standard deviation of split frequencies: 0.010503
215500 -- [-434.840] (-426.598) (-429.350) (-425.304) * (-428.118) (-428.835) (-425.111) [-424.960] -- 0:00:47
216000 -- (-427.730) [-425.812] (-426.850) (-428.825) * [-426.582] (-429.974) (-429.345) (-425.330) -- 0:00:47
216500 -- (-426.742) (-425.421) (-426.119) [-424.240] * (-424.340) (-431.653) (-426.713) [-427.835] -- 0:00:47
217000 -- (-424.175) (-423.717) (-426.450) [-426.706] * (-425.460) [-427.818] (-428.034) (-425.189) -- 0:00:46
217500 -- [-426.665] (-426.040) (-426.469) (-426.362) * (-424.802) (-428.772) [-425.176] (-424.249) -- 0:00:46
218000 -- (-425.649) [-426.339] (-427.811) (-427.575) * (-424.124) (-424.479) (-426.229) [-424.163] -- 0:00:46
218500 -- (-431.195) (-429.917) [-425.482] (-423.483) * [-423.910] (-424.545) (-424.048) (-423.980) -- 0:00:46
219000 -- (-430.439) (-426.513) [-426.708] (-427.953) * (-425.870) (-425.712) [-427.274] (-424.195) -- 0:00:46
219500 -- (-428.503) (-427.396) (-424.073) [-425.525] * [-425.315] (-427.385) (-425.636) (-424.385) -- 0:00:46
220000 -- [-427.225] (-426.444) (-425.266) (-426.325) * (-423.591) [-424.355] (-426.327) (-424.988) -- 0:00:46
Average standard deviation of split frequencies: 0.008946
220500 -- [-426.056] (-427.055) (-427.879) (-424.817) * (-423.792) (-426.962) (-424.592) [-424.946] -- 0:00:45
221000 -- [-425.300] (-424.908) (-426.308) (-424.849) * (-425.199) (-427.311) [-427.166] (-425.727) -- 0:00:45
221500 -- (-425.714) (-427.323) (-426.704) [-423.762] * (-425.808) (-425.681) [-427.051] (-425.137) -- 0:00:45
222000 -- (-425.512) (-430.502) [-428.038] (-426.247) * [-427.393] (-425.428) (-424.170) (-423.656) -- 0:00:45
222500 -- (-425.126) [-424.770] (-432.644) (-423.821) * (-426.964) (-425.661) (-425.304) [-425.696] -- 0:00:45
223000 -- (-425.672) [-423.798] (-426.600) (-429.364) * [-426.784] (-423.662) (-428.368) (-425.032) -- 0:00:45
223500 -- [-424.255] (-425.067) (-428.563) (-426.333) * (-428.137) [-424.392] (-423.904) (-429.954) -- 0:00:45
224000 -- (-424.276) [-425.637] (-425.138) (-425.804) * (-425.227) (-429.519) [-424.791] (-428.190) -- 0:00:45
224500 -- (-424.008) (-425.433) [-423.720] (-425.938) * (-427.087) (-429.524) (-428.982) [-424.287] -- 0:00:44
225000 -- (-424.733) (-424.303) (-424.880) [-424.953] * (-425.586) (-424.576) [-427.208] (-424.996) -- 0:00:44
Average standard deviation of split frequencies: 0.009777
225500 -- [-424.454] (-425.151) (-426.798) (-425.337) * [-424.899] (-424.614) (-429.377) (-426.416) -- 0:00:44
226000 -- (-428.126) [-424.418] (-425.978) (-433.277) * (-425.207) (-424.267) [-425.346] (-425.289) -- 0:00:44
226500 -- (-425.285) (-425.009) (-425.020) [-430.840] * [-425.076] (-429.465) (-426.514) (-427.294) -- 0:00:44
227000 -- (-427.262) (-425.320) (-424.388) [-424.281] * [-426.084] (-426.608) (-428.229) (-426.883) -- 0:00:44
227500 -- (-424.457) (-424.357) (-425.277) [-425.181] * (-425.441) (-424.244) [-423.925] (-429.605) -- 0:00:44
228000 -- (-427.068) [-429.908] (-426.273) (-428.579) * [-426.692] (-425.776) (-425.176) (-428.454) -- 0:00:44
228500 -- (-429.792) (-424.476) (-426.261) [-424.298] * (-425.279) [-423.604] (-429.642) (-424.042) -- 0:00:43
229000 -- [-424.788] (-425.669) (-430.065) (-425.218) * (-425.475) (-431.931) (-425.126) [-428.501] -- 0:00:43
229500 -- [-424.585] (-425.523) (-426.930) (-427.318) * (-427.964) (-425.359) [-427.996] (-424.455) -- 0:00:47
230000 -- [-425.883] (-426.192) (-425.998) (-424.326) * (-427.818) [-424.506] (-425.443) (-425.544) -- 0:00:46
Average standard deviation of split frequencies: 0.010601
230500 -- (-424.567) (-429.501) [-425.374] (-424.383) * (-427.046) [-423.897] (-426.541) (-426.120) -- 0:00:46
231000 -- [-428.076] (-427.298) (-426.222) (-425.256) * (-424.355) (-425.422) (-424.020) [-424.941] -- 0:00:46
231500 -- (-427.555) (-426.812) [-426.791] (-425.624) * (-425.353) (-426.860) (-427.824) [-428.880] -- 0:00:46
232000 -- (-429.301) (-424.380) (-428.604) [-427.708] * [-424.894] (-424.754) (-428.177) (-424.943) -- 0:00:46
232500 -- (-425.918) (-428.312) [-425.674] (-427.796) * (-428.948) (-426.609) (-424.445) [-427.608] -- 0:00:46
233000 -- (-424.646) (-428.381) (-424.340) [-426.024] * (-426.076) (-425.662) [-424.516] (-427.378) -- 0:00:46
233500 -- [-424.131] (-428.601) (-426.795) (-428.764) * [-424.103] (-425.188) (-426.004) (-425.776) -- 0:00:45
234000 -- (-424.416) (-426.895) [-423.786] (-428.393) * (-426.398) (-425.967) (-426.745) [-424.652] -- 0:00:45
234500 -- (-424.155) (-425.510) [-424.999] (-425.274) * (-427.520) [-425.633] (-428.210) (-424.583) -- 0:00:45
235000 -- (-425.357) [-424.675] (-429.815) (-426.343) * [-424.978] (-424.633) (-425.919) (-424.330) -- 0:00:45
Average standard deviation of split frequencies: 0.011985
235500 -- [-427.904] (-424.610) (-428.918) (-425.951) * (-423.543) (-424.798) [-425.325] (-425.508) -- 0:00:45
236000 -- (-425.976) [-425.977] (-432.742) (-426.784) * (-424.749) (-425.674) (-429.006) [-426.493] -- 0:00:45
236500 -- (-424.787) (-425.826) [-425.454] (-424.255) * [-425.508] (-426.222) (-427.828) (-429.719) -- 0:00:45
237000 -- (-424.765) [-424.234] (-425.460) (-424.405) * (-428.107) (-429.381) [-423.811] (-426.665) -- 0:00:45
237500 -- (-424.195) (-427.498) (-429.587) [-424.726] * (-426.833) (-424.742) [-425.259] (-425.263) -- 0:00:44
238000 -- (-423.639) (-426.925) [-429.239] (-425.875) * (-426.085) (-425.521) [-424.138] (-425.799) -- 0:00:44
238500 -- (-424.179) (-424.081) [-429.438] (-424.357) * [-424.374] (-424.742) (-425.514) (-426.008) -- 0:00:44
239000 -- [-424.163] (-428.328) (-424.544) (-428.835) * [-424.477] (-427.944) (-424.952) (-428.950) -- 0:00:44
239500 -- (-423.780) (-424.798) (-425.143) [-425.154] * (-426.829) (-429.116) [-425.625] (-429.794) -- 0:00:44
240000 -- [-424.197] (-428.061) (-426.516) (-426.506) * (-425.409) (-426.965) [-424.676] (-427.178) -- 0:00:44
Average standard deviation of split frequencies: 0.011263
240500 -- (-427.026) (-434.053) (-426.833) [-424.788] * (-428.661) [-424.676] (-426.953) (-425.406) -- 0:00:44
241000 -- [-427.931] (-428.104) (-427.125) (-424.222) * (-426.169) (-426.177) [-425.665] (-427.688) -- 0:00:44
241500 -- (-424.171) (-427.649) [-424.998] (-430.303) * (-424.947) [-424.561] (-423.644) (-423.845) -- 0:00:43
242000 -- [-426.888] (-424.372) (-424.747) (-426.624) * (-427.401) (-425.323) (-424.298) [-424.839] -- 0:00:43
242500 -- (-427.829) (-424.947) [-424.763] (-428.324) * (-426.190) [-425.150] (-426.218) (-424.879) -- 0:00:43
243000 -- (-425.637) (-425.249) [-425.394] (-426.010) * [-425.661] (-424.463) (-428.561) (-427.580) -- 0:00:43
243500 -- (-425.071) (-424.062) (-425.264) [-425.429] * [-427.939] (-425.036) (-426.640) (-425.293) -- 0:00:43
244000 -- (-425.316) [-424.648] (-425.426) (-424.898) * (-426.939) (-426.046) [-425.239] (-430.374) -- 0:00:46
244500 -- (-427.530) [-425.891] (-426.928) (-424.700) * (-425.254) (-429.379) (-424.723) [-426.915] -- 0:00:46
245000 -- (-426.429) [-428.431] (-425.691) (-425.385) * [-428.111] (-429.418) (-424.913) (-426.099) -- 0:00:46
Average standard deviation of split frequencies: 0.010540
245500 -- (-425.551) (-428.728) (-424.954) [-426.668] * (-428.046) [-424.660] (-424.477) (-424.016) -- 0:00:46
246000 -- (-427.343) [-427.198] (-429.046) (-426.816) * (-428.952) [-423.955] (-424.519) (-427.730) -- 0:00:45
246500 -- (-424.439) [-423.758] (-429.773) (-426.556) * (-425.433) [-424.883] (-424.773) (-425.029) -- 0:00:45
247000 -- (-425.574) (-423.852) (-425.955) [-431.011] * (-425.345) (-425.640) [-426.487] (-424.537) -- 0:00:45
247500 -- (-426.963) (-426.453) [-429.654] (-423.785) * [-424.691] (-424.351) (-425.319) (-426.427) -- 0:00:45
248000 -- (-425.566) (-426.398) [-429.193] (-424.788) * (-432.351) [-429.647] (-427.812) (-424.164) -- 0:00:45
248500 -- (-424.919) (-425.366) [-425.642] (-424.819) * (-426.944) [-425.114] (-425.850) (-424.278) -- 0:00:45
249000 -- (-427.920) (-424.139) [-424.704] (-430.045) * (-427.861) [-426.266] (-425.625) (-429.555) -- 0:00:45
249500 -- [-425.760] (-425.019) (-424.080) (-427.755) * (-423.701) (-426.405) (-426.481) [-425.065] -- 0:00:45
250000 -- (-425.274) (-427.345) (-427.059) [-425.092] * (-430.497) (-428.429) [-425.494] (-425.334) -- 0:00:45
Average standard deviation of split frequencies: 0.011837
250500 -- (-425.357) [-425.646] (-424.976) (-424.766) * (-427.061) (-425.110) [-424.862] (-428.034) -- 0:00:44
251000 -- (-426.547) [-424.720] (-430.318) (-430.050) * [-424.753] (-424.273) (-425.541) (-425.822) -- 0:00:44
251500 -- (-425.761) (-428.224) (-426.576) [-424.118] * (-425.679) [-425.777] (-424.206) (-426.277) -- 0:00:44
252000 -- [-424.384] (-425.874) (-427.397) (-424.552) * (-425.007) [-424.217] (-425.807) (-427.115) -- 0:00:44
252500 -- (-424.221) [-425.904] (-429.371) (-425.877) * (-426.267) (-429.892) (-425.761) [-426.523] -- 0:00:44
253000 -- [-426.387] (-427.522) (-427.121) (-425.812) * (-424.293) (-424.293) [-425.642] (-424.991) -- 0:00:47
253500 -- (-428.015) [-427.480] (-425.313) (-425.833) * (-426.918) (-425.389) [-424.241] (-426.920) -- 0:00:47
254000 -- (-427.801) [-430.068] (-425.845) (-424.025) * (-425.317) (-424.308) [-430.264] (-425.393) -- 0:00:46
254500 -- (-427.762) (-425.365) (-425.831) [-423.721] * [-429.134] (-425.675) (-427.550) (-424.689) -- 0:00:46
255000 -- [-424.527] (-427.132) (-425.752) (-424.650) * (-429.179) [-425.575] (-429.113) (-424.169) -- 0:00:46
Average standard deviation of split frequencies: 0.011915
255500 -- [-425.856] (-425.253) (-431.850) (-426.489) * [-427.463] (-428.100) (-428.501) (-425.219) -- 0:00:46
256000 -- (-428.081) (-430.234) [-429.057] (-425.619) * [-424.515] (-426.966) (-425.985) (-425.015) -- 0:00:46
256500 -- (-427.441) (-424.956) [-427.100] (-430.188) * (-430.127) (-425.724) [-427.373] (-423.706) -- 0:00:46
257000 -- (-425.499) (-425.901) (-425.219) [-424.687] * (-426.236) (-425.598) (-427.814) [-423.809] -- 0:00:46
257500 -- (-425.361) (-426.626) (-426.977) [-424.053] * [-426.107] (-427.568) (-425.754) (-424.200) -- 0:00:46
258000 -- (-424.531) (-425.871) (-426.733) [-426.969] * [-424.132] (-425.623) (-425.952) (-423.838) -- 0:00:46
258500 -- (-427.492) (-424.863) (-426.390) [-427.847] * (-423.709) [-426.151] (-424.926) (-424.843) -- 0:00:45
259000 -- (-427.644) (-425.703) (-426.009) [-428.454] * (-426.110) (-425.125) [-424.987] (-427.058) -- 0:00:45
259500 -- (-425.075) (-423.957) [-425.109] (-426.635) * (-429.087) (-424.048) [-424.523] (-424.649) -- 0:00:45
260000 -- (-425.722) (-425.787) (-426.779) [-425.685] * (-425.487) [-425.577] (-424.954) (-423.897) -- 0:00:45
Average standard deviation of split frequencies: 0.010212
260500 -- [-426.227] (-426.357) (-426.005) (-425.123) * (-426.452) [-425.928] (-425.562) (-424.959) -- 0:00:45
261000 -- (-429.594) [-425.471] (-428.099) (-424.745) * (-427.452) (-428.504) [-425.622] (-424.589) -- 0:00:45
261500 -- [-426.840] (-426.803) (-425.286) (-425.564) * (-427.556) (-424.885) [-424.768] (-423.540) -- 0:00:45
262000 -- (-424.740) (-427.486) (-423.734) [-424.446] * (-431.123) [-426.197] (-424.928) (-427.649) -- 0:00:45
262500 -- [-426.913] (-424.952) (-424.552) (-427.429) * (-434.350) (-425.472) (-426.080) [-426.713] -- 0:00:44
263000 -- [-424.186] (-426.660) (-424.561) (-426.662) * (-427.012) (-426.368) (-426.325) [-427.612] -- 0:00:44
263500 -- (-423.985) [-424.198] (-427.830) (-424.921) * (-424.698) (-426.995) [-426.441] (-428.808) -- 0:00:44
264000 -- (-426.885) [-427.934] (-425.669) (-428.927) * (-425.999) (-426.224) (-423.579) [-426.708] -- 0:00:44
264500 -- [-424.477] (-428.217) (-428.345) (-425.798) * [-426.183] (-424.778) (-424.941) (-424.655) -- 0:00:44
265000 -- (-426.892) [-425.859] (-427.763) (-430.491) * (-424.921) (-427.524) [-425.949] (-428.693) -- 0:00:44
Average standard deviation of split frequencies: 0.010008
265500 -- (-424.651) (-427.547) [-430.638] (-427.578) * (-424.426) (-426.356) (-425.597) [-429.237] -- 0:00:47
266000 -- (-426.097) [-426.190] (-430.553) (-424.712) * (-427.449) (-428.160) (-425.334) [-424.983] -- 0:00:46
266500 -- (-423.734) (-424.630) (-425.642) [-425.064] * (-428.466) (-425.135) [-426.519] (-424.465) -- 0:00:46
267000 -- [-425.196] (-426.568) (-426.840) (-423.681) * [-427.400] (-425.668) (-426.023) (-424.615) -- 0:00:46
267500 -- [-426.015] (-424.586) (-427.589) (-426.856) * (-424.865) (-426.907) (-425.159) [-425.303] -- 0:00:46
268000 -- (-425.558) [-426.635] (-426.358) (-426.311) * [-425.671] (-426.546) (-424.339) (-424.599) -- 0:00:46
268500 -- (-425.295) [-424.540] (-428.813) (-427.721) * (-431.484) (-425.781) (-429.270) [-424.916] -- 0:00:46
269000 -- (-424.813) (-424.236) (-429.371) [-426.511] * (-425.471) (-427.100) (-427.693) [-425.291] -- 0:00:46
269500 -- (-429.192) (-426.312) (-425.958) [-431.931] * [-424.569] (-428.059) (-424.035) (-426.274) -- 0:00:46
270000 -- (-424.640) [-425.182] (-426.543) (-426.418) * (-423.619) [-423.849] (-428.357) (-424.592) -- 0:00:45
Average standard deviation of split frequencies: 0.009733
270500 -- (-434.409) [-425.345] (-426.243) (-426.986) * (-424.125) (-425.875) [-424.903] (-429.525) -- 0:00:45
271000 -- (-426.550) (-427.597) (-424.744) [-426.331] * (-426.074) [-425.720] (-426.014) (-429.746) -- 0:00:45
271500 -- (-426.871) (-427.350) (-426.005) [-425.719] * (-425.793) [-426.597] (-426.048) (-428.097) -- 0:00:45
272000 -- (-426.017) (-425.440) (-426.220) [-426.885] * (-424.444) (-424.032) [-427.602] (-426.445) -- 0:00:45
272500 -- [-425.308] (-428.859) (-424.694) (-427.242) * (-424.984) (-426.366) [-428.522] (-424.659) -- 0:00:45
273000 -- (-425.699) (-427.007) (-425.934) [-430.418] * (-427.079) [-427.522] (-423.988) (-423.873) -- 0:00:45
273500 -- (-427.146) (-428.877) [-427.660] (-431.491) * (-427.040) (-427.885) (-428.090) [-425.888] -- 0:00:45
274000 -- [-425.870] (-425.574) (-426.215) (-427.872) * (-425.146) [-424.261] (-427.323) (-428.869) -- 0:00:45
274500 -- (-427.519) [-424.071] (-425.354) (-424.950) * (-424.904) (-424.767) [-426.553] (-426.610) -- 0:00:44
275000 -- [-425.084] (-425.340) (-424.235) (-425.035) * (-428.300) (-426.561) [-427.247] (-425.010) -- 0:00:44
Average standard deviation of split frequencies: 0.009645
275500 -- (-423.977) (-424.910) [-425.938] (-425.364) * (-429.016) (-424.362) [-424.275] (-425.465) -- 0:00:44
276000 -- (-423.769) (-427.328) (-425.128) [-424.815] * (-427.161) (-426.238) [-426.928] (-429.228) -- 0:00:44
276500 -- (-426.533) (-429.526) [-425.576] (-426.435) * (-431.009) (-428.324) (-427.720) [-427.715] -- 0:00:44
277000 -- [-425.101] (-424.138) (-425.981) (-424.851) * [-426.671] (-426.114) (-425.654) (-425.440) -- 0:00:44
277500 -- (-427.208) (-426.252) (-427.766) [-425.250] * [-425.771] (-425.051) (-425.854) (-426.981) -- 0:00:46
278000 -- (-426.847) (-427.886) [-425.061] (-427.680) * (-429.586) [-424.840] (-428.299) (-428.464) -- 0:00:46
278500 -- (-423.813) (-424.881) [-427.225] (-425.110) * (-424.385) (-428.930) (-425.511) [-426.937] -- 0:00:46
279000 -- (-426.800) (-424.653) [-428.486] (-424.832) * (-426.285) (-431.099) (-426.994) [-424.137] -- 0:00:46
279500 -- (-426.715) (-423.809) (-425.039) [-424.599] * [-426.759] (-426.670) (-424.752) (-428.678) -- 0:00:46
280000 -- [-425.882] (-424.592) (-433.286) (-425.342) * [-428.596] (-425.198) (-428.026) (-426.348) -- 0:00:46
Average standard deviation of split frequencies: 0.010275
280500 -- (-425.423) (-426.330) [-431.366] (-425.120) * (-426.604) (-426.669) (-428.001) [-423.968] -- 0:00:46
281000 -- (-430.859) (-423.767) [-427.190] (-426.428) * (-424.762) (-427.591) [-432.287] (-425.623) -- 0:00:46
281500 -- (-430.535) (-425.069) [-425.901] (-428.468) * [-423.480] (-426.790) (-435.077) (-424.114) -- 0:00:45
282000 -- [-426.804] (-428.685) (-424.326) (-425.707) * (-426.910) (-426.280) [-424.863] (-424.207) -- 0:00:45
282500 -- (-424.493) (-426.930) [-426.381] (-424.098) * (-427.739) [-427.603] (-425.768) (-426.437) -- 0:00:45
283000 -- (-425.458) (-424.666) [-424.768] (-424.598) * (-425.274) (-426.674) [-425.447] (-425.710) -- 0:00:45
283500 -- (-424.877) (-424.702) [-424.788] (-425.058) * (-426.984) [-424.539] (-424.300) (-428.088) -- 0:00:45
284000 -- [-427.257] (-423.905) (-426.983) (-425.857) * [-426.360] (-425.871) (-424.111) (-428.789) -- 0:00:45
284500 -- (-430.794) [-427.413] (-424.745) (-429.007) * (-424.881) (-427.809) [-425.676] (-425.092) -- 0:00:45
285000 -- [-427.255] (-425.341) (-425.180) (-423.936) * (-423.866) [-426.137] (-430.796) (-427.329) -- 0:00:45
Average standard deviation of split frequencies: 0.010622
285500 -- (-426.211) (-435.098) (-424.509) [-425.349] * [-424.921] (-429.265) (-425.695) (-433.507) -- 0:00:45
286000 -- (-428.075) (-425.183) (-429.040) [-425.964] * (-426.218) (-428.274) [-423.811] (-425.418) -- 0:00:44
286500 -- (-426.628) (-424.093) (-426.027) [-424.973] * (-427.819) (-427.736) (-429.943) [-426.706] -- 0:00:44
287000 -- [-425.866] (-425.073) (-425.590) (-427.503) * [-427.770] (-424.758) (-425.435) (-426.592) -- 0:00:44
287500 -- [-426.447] (-425.688) (-425.009) (-424.096) * (-426.568) (-425.084) [-424.636] (-426.289) -- 0:00:44
288000 -- (-426.113) (-427.568) [-429.931] (-425.083) * (-436.351) (-424.537) [-425.248] (-423.875) -- 0:00:44
288500 -- [-425.245] (-426.798) (-430.593) (-424.621) * (-427.316) (-424.737) [-424.606] (-425.467) -- 0:00:44
289000 -- [-425.848] (-427.531) (-424.998) (-429.778) * (-428.245) (-425.367) (-426.008) [-424.872] -- 0:00:44
289500 -- (-426.674) (-424.388) [-426.998] (-426.640) * [-426.906] (-425.368) (-426.696) (-424.238) -- 0:00:44
290000 -- (-425.345) (-424.388) [-426.886] (-426.995) * (-426.859) (-424.621) [-425.681] (-423.808) -- 0:00:44
Average standard deviation of split frequencies: 0.011162
290500 -- (-426.532) (-432.085) (-425.062) [-426.529] * (-425.922) (-425.734) [-424.177] (-426.001) -- 0:00:43
291000 -- (-424.916) [-425.032] (-427.871) (-426.595) * (-426.979) (-424.328) (-424.263) [-424.978] -- 0:00:43
291500 -- (-424.898) (-429.679) (-426.641) [-423.829] * [-426.146] (-426.105) (-426.904) (-424.214) -- 0:00:43
292000 -- (-427.747) (-426.620) [-424.838] (-425.152) * (-425.382) [-427.821] (-426.219) (-428.000) -- 0:00:43
292500 -- (-424.769) (-432.354) (-427.075) [-425.133] * (-426.808) (-425.896) (-425.321) [-423.983] -- 0:00:43
293000 -- (-426.668) [-424.974] (-424.729) (-426.646) * (-425.634) (-425.054) (-425.151) [-424.737] -- 0:00:45
293500 -- (-425.665) (-425.391) [-423.950] (-427.217) * (-425.887) [-423.918] (-424.745) (-425.213) -- 0:00:45
294000 -- (-424.325) (-425.897) (-424.810) [-427.853] * (-428.132) (-426.747) [-424.879] (-426.230) -- 0:00:45
294500 -- (-426.026) [-427.429] (-426.349) (-427.166) * (-424.913) (-426.180) [-426.225] (-425.326) -- 0:00:45
295000 -- (-426.887) [-427.284] (-423.642) (-426.976) * (-425.129) (-428.621) (-424.857) [-426.850] -- 0:00:45
Average standard deviation of split frequencies: 0.010118
295500 -- (-425.542) (-426.494) (-424.294) [-423.670] * (-430.051) (-430.174) (-426.171) [-427.193] -- 0:00:45
296000 -- (-426.801) (-425.104) (-424.734) [-426.627] * (-425.991) [-427.855] (-424.022) (-432.040) -- 0:00:45
296500 -- [-424.184] (-425.172) (-427.143) (-425.549) * (-424.900) (-424.439) (-424.868) [-425.248] -- 0:00:45
297000 -- (-424.318) (-425.538) [-428.281] (-426.064) * [-424.553] (-426.112) (-428.222) (-425.518) -- 0:00:44
297500 -- [-425.341] (-426.543) (-424.124) (-427.256) * (-424.661) (-428.977) (-424.869) [-426.247] -- 0:00:44
298000 -- [-424.380] (-425.988) (-424.596) (-425.628) * (-424.046) (-427.291) (-427.280) [-425.035] -- 0:00:44
298500 -- (-427.369) (-427.192) [-424.659] (-426.482) * (-424.079) [-425.699] (-424.581) (-425.467) -- 0:00:44
299000 -- (-428.928) [-425.108] (-429.270) (-424.982) * (-425.879) (-427.209) [-425.228] (-426.231) -- 0:00:44
299500 -- (-429.257) (-425.575) (-425.794) [-426.571] * (-425.737) (-427.499) (-428.411) [-427.859] -- 0:00:44
300000 -- (-427.776) [-427.422] (-424.907) (-424.969) * (-429.615) (-427.653) [-426.037] (-425.320) -- 0:00:44
Average standard deviation of split frequencies: 0.009603
300500 -- [-426.826] (-425.661) (-428.350) (-426.164) * [-423.595] (-424.722) (-427.220) (-425.180) -- 0:00:44
301000 -- (-428.013) (-425.839) (-435.259) [-424.328] * [-427.158] (-424.716) (-427.650) (-425.935) -- 0:00:44
301500 -- [-426.468] (-427.102) (-428.487) (-424.472) * [-424.102] (-432.055) (-424.776) (-425.678) -- 0:00:44
302000 -- (-426.939) (-424.550) [-430.929] (-423.914) * (-425.083) [-424.977] (-424.798) (-430.316) -- 0:00:43
302500 -- (-426.934) (-427.078) [-424.669] (-424.399) * (-424.314) (-425.594) [-425.203] (-427.425) -- 0:00:43
303000 -- (-427.797) [-427.260] (-432.143) (-428.948) * [-424.302] (-427.405) (-427.067) (-427.131) -- 0:00:43
303500 -- (-423.721) (-426.663) [-428.323] (-426.150) * (-428.162) (-425.853) [-424.642] (-425.109) -- 0:00:43
304000 -- [-424.424] (-426.789) (-426.186) (-425.136) * [-429.484] (-426.603) (-426.874) (-424.837) -- 0:00:43
304500 -- (-423.991) (-427.017) (-424.605) [-424.867] * (-424.931) (-424.915) [-426.990] (-425.751) -- 0:00:43
305000 -- (-424.486) [-426.341] (-429.594) (-426.762) * (-425.004) (-424.409) (-425.446) [-425.292] -- 0:00:43
Average standard deviation of split frequencies: 0.010495
305500 -- (-424.402) [-428.992] (-427.183) (-428.247) * (-426.413) (-425.201) [-425.782] (-423.885) -- 0:00:43
306000 -- [-425.349] (-427.260) (-427.295) (-428.446) * (-424.751) (-424.544) [-427.080] (-426.730) -- 0:00:43
306500 -- (-425.388) [-428.480] (-425.316) (-427.849) * [-425.794] (-424.951) (-426.398) (-424.500) -- 0:00:42
307000 -- [-424.161] (-425.097) (-426.746) (-427.113) * (-424.959) [-427.391] (-428.733) (-425.849) -- 0:00:42
307500 -- (-424.482) [-424.041] (-426.798) (-426.491) * (-428.289) (-425.616) [-427.231] (-429.842) -- 0:00:42
308000 -- (-424.159) (-424.056) (-424.042) [-426.656] * (-428.780) [-424.796] (-426.744) (-424.716) -- 0:00:42
308500 -- (-424.750) (-427.284) (-425.961) [-425.460] * [-424.200] (-424.731) (-426.660) (-424.451) -- 0:00:42
309000 -- (-424.344) (-426.570) (-425.740) [-425.760] * [-426.086] (-424.638) (-429.981) (-425.343) -- 0:00:42
309500 -- (-427.205) [-424.853] (-424.305) (-425.537) * (-423.878) [-426.134] (-427.652) (-424.716) -- 0:00:44
310000 -- (-429.278) [-425.831] (-425.797) (-427.086) * (-423.658) [-425.352] (-428.014) (-427.068) -- 0:00:44
Average standard deviation of split frequencies: 0.011475
310500 -- (-432.608) (-429.672) [-425.215] (-427.524) * [-425.202] (-425.676) (-429.993) (-426.800) -- 0:00:44
311000 -- [-426.962] (-424.695) (-426.213) (-424.762) * (-425.662) (-426.061) [-424.650] (-423.949) -- 0:00:44
311500 -- (-425.165) [-425.784] (-427.965) (-428.929) * (-427.614) (-430.318) (-424.722) [-425.894] -- 0:00:44
312000 -- (-426.793) [-423.677] (-427.756) (-424.347) * (-429.619) [-426.590] (-424.567) (-425.707) -- 0:00:44
312500 -- (-427.830) [-424.588] (-425.019) (-425.421) * (-428.691) [-425.163] (-424.424) (-428.200) -- 0:00:44
313000 -- (-425.375) (-426.552) [-425.382] (-425.397) * (-427.489) (-425.774) (-425.435) [-425.951] -- 0:00:43
313500 -- (-427.663) (-426.248) [-425.123] (-423.952) * [-425.482] (-427.871) (-425.245) (-426.059) -- 0:00:43
314000 -- (-430.205) (-425.575) (-424.559) [-424.777] * (-426.247) (-425.023) (-425.667) [-431.363] -- 0:00:43
314500 -- (-428.472) (-425.926) [-425.217] (-425.065) * (-426.468) (-427.036) [-427.761] (-429.491) -- 0:00:43
315000 -- (-427.005) (-425.273) [-424.062] (-428.997) * [-426.965] (-425.869) (-426.205) (-427.241) -- 0:00:43
Average standard deviation of split frequencies: 0.011002
315500 -- (-426.524) [-426.359] (-425.842) (-424.280) * (-428.067) [-423.810] (-428.865) (-425.865) -- 0:00:43
316000 -- (-430.400) (-430.233) [-424.892] (-424.575) * (-427.022) (-426.974) [-426.627] (-426.673) -- 0:00:43
316500 -- (-425.343) (-425.209) [-429.785] (-424.246) * (-424.659) (-426.717) [-425.062] (-426.327) -- 0:00:43
317000 -- (-424.910) (-425.685) (-426.653) [-424.969] * (-426.434) (-424.626) [-425.414] (-426.048) -- 0:00:43
317500 -- (-425.218) (-425.998) (-428.173) [-423.914] * [-426.162] (-426.465) (-423.756) (-425.181) -- 0:00:42
318000 -- (-425.359) (-426.607) (-428.230) [-424.347] * (-425.134) [-426.411] (-423.756) (-427.470) -- 0:00:42
318500 -- (-424.088) (-424.683) [-425.975] (-426.263) * (-425.969) (-425.883) [-424.336] (-426.455) -- 0:00:42
319000 -- (-424.826) [-423.821] (-425.790) (-426.295) * (-428.301) (-428.656) (-426.429) [-425.663] -- 0:00:42
319500 -- (-425.233) (-423.652) [-425.328] (-425.804) * (-426.613) (-426.412) (-425.874) [-424.743] -- 0:00:42
320000 -- (-425.323) (-424.672) (-425.304) [-425.701] * (-428.467) [-424.018] (-425.726) (-425.773) -- 0:00:42
Average standard deviation of split frequencies: 0.011485
320500 -- (-423.825) [-428.129] (-427.471) (-425.661) * (-427.079) (-424.483) [-423.630] (-423.666) -- 0:00:42
321000 -- (-425.138) [-425.268] (-427.214) (-426.829) * [-424.825] (-424.689) (-425.697) (-424.454) -- 0:00:42
321500 -- (-429.579) [-423.968] (-424.880) (-425.345) * (-427.860) [-426.029] (-428.222) (-426.990) -- 0:00:42
322000 -- (-424.185) [-426.278] (-427.458) (-428.907) * (-426.301) (-426.532) [-423.635] (-425.091) -- 0:00:42
322500 -- (-426.109) [-424.489] (-426.955) (-425.791) * [-427.300] (-427.422) (-424.988) (-426.065) -- 0:00:42
323000 -- (-427.188) [-426.074] (-423.962) (-426.675) * [-426.689] (-424.438) (-426.137) (-424.997) -- 0:00:41
323500 -- (-426.658) (-426.233) [-428.932] (-426.006) * (-425.932) [-426.130] (-426.287) (-428.859) -- 0:00:41
324000 -- (-426.801) [-426.112] (-424.563) (-425.007) * (-428.721) (-426.771) (-426.491) [-423.541] -- 0:00:41
324500 -- [-424.345] (-426.814) (-424.921) (-424.908) * (-426.258) (-425.636) (-426.532) [-424.408] -- 0:00:41
325000 -- (-426.226) (-428.412) (-429.900) [-424.245] * (-425.194) (-426.179) (-425.550) [-424.559] -- 0:00:43
Average standard deviation of split frequencies: 0.011026
325500 -- (-430.280) [-425.407] (-425.400) (-427.169) * (-425.642) (-425.426) (-428.799) [-424.203] -- 0:00:43
326000 -- (-424.012) (-427.553) [-425.267] (-424.711) * (-426.231) (-427.683) (-429.734) [-424.915] -- 0:00:43
326500 -- (-424.389) (-424.946) (-424.275) [-425.601] * (-425.022) (-426.252) [-423.990] (-428.658) -- 0:00:43
327000 -- [-425.067] (-425.423) (-425.978) (-426.598) * [-425.425] (-426.258) (-424.973) (-424.617) -- 0:00:43
327500 -- (-429.417) (-424.074) (-425.506) [-424.947] * (-424.774) [-423.896] (-426.998) (-424.468) -- 0:00:43
328000 -- (-429.609) (-425.395) [-425.226] (-423.715) * [-429.056] (-424.316) (-425.900) (-424.457) -- 0:00:43
328500 -- (-427.563) (-427.082) [-425.852] (-426.258) * [-425.730] (-426.135) (-425.629) (-427.321) -- 0:00:42
329000 -- (-426.045) (-424.053) (-426.604) [-423.523] * (-428.635) (-425.339) (-424.883) [-427.831] -- 0:00:42
329500 -- [-427.630] (-428.032) (-425.454) (-424.844) * [-426.204] (-426.159) (-424.711) (-425.882) -- 0:00:42
330000 -- (-425.815) (-425.042) (-425.953) [-424.322] * (-425.563) (-425.063) [-424.792] (-424.343) -- 0:00:42
Average standard deviation of split frequencies: 0.012474
330500 -- (-428.275) (-424.218) (-425.454) [-426.985] * [-424.527] (-424.683) (-427.326) (-425.297) -- 0:00:42
331000 -- (-425.488) [-428.001] (-426.191) (-427.151) * (-423.909) (-426.285) [-426.388] (-425.704) -- 0:00:42
331500 -- (-424.945) (-425.869) (-424.741) [-425.699] * (-426.994) [-427.651] (-425.563) (-425.345) -- 0:00:42
332000 -- (-424.437) (-425.209) (-425.732) [-424.594] * (-425.103) [-425.633] (-426.068) (-428.344) -- 0:00:42
332500 -- (-425.701) [-424.109] (-426.925) (-424.156) * (-424.283) (-424.636) [-424.849] (-425.611) -- 0:00:42
333000 -- [-425.109] (-426.050) (-423.914) (-425.030) * (-427.385) [-423.531] (-426.837) (-424.963) -- 0:00:42
333500 -- [-426.104] (-426.683) (-425.913) (-423.844) * (-426.785) (-423.785) [-424.973] (-425.599) -- 0:00:41
334000 -- [-426.365] (-425.806) (-424.857) (-426.609) * (-427.762) [-424.578] (-424.000) (-424.567) -- 0:00:41
334500 -- (-427.682) (-427.122) (-425.791) [-425.650] * (-427.909) (-425.716) (-424.659) [-426.252] -- 0:00:41
335000 -- (-429.449) (-426.223) (-424.092) [-423.920] * (-428.356) [-424.644] (-426.743) (-425.387) -- 0:00:41
Average standard deviation of split frequencies: 0.011312
335500 -- (-426.337) (-427.555) [-424.204] (-426.995) * [-426.794] (-427.461) (-426.174) (-429.094) -- 0:00:41
336000 -- (-427.221) (-425.249) [-425.748] (-424.505) * [-425.719] (-426.722) (-427.762) (-431.144) -- 0:00:41
336500 -- (-426.947) [-426.368] (-425.194) (-429.432) * (-424.212) (-433.059) (-425.801) [-424.340] -- 0:00:41
337000 -- (-425.857) (-425.535) [-426.459] (-426.323) * (-426.982) [-424.843] (-427.265) (-427.204) -- 0:00:41
337500 -- (-425.906) (-425.804) (-429.289) [-424.926] * (-425.800) [-426.105] (-423.909) (-426.531) -- 0:00:41
338000 -- (-426.352) [-427.723] (-429.236) (-424.760) * (-426.420) (-427.129) (-424.776) [-425.292] -- 0:00:41
338500 -- (-425.313) (-424.869) [-425.259] (-426.385) * (-424.284) [-426.399] (-424.924) (-426.533) -- 0:00:41
339000 -- [-425.807] (-426.161) (-427.243) (-425.606) * [-427.494] (-426.347) (-425.172) (-424.957) -- 0:00:40
339500 -- (-429.229) (-428.752) (-425.598) [-427.777] * (-425.344) [-428.964] (-424.864) (-431.717) -- 0:00:40
340000 -- (-431.088) (-424.874) (-426.161) [-425.936] * (-425.199) (-425.946) [-427.296] (-425.206) -- 0:00:40
Average standard deviation of split frequencies: 0.010119
340500 -- (-426.475) (-424.997) [-429.307] (-425.959) * [-424.343] (-427.029) (-424.160) (-429.837) -- 0:00:40
341000 -- [-424.694] (-426.716) (-425.699) (-427.557) * [-423.968] (-427.324) (-425.867) (-425.766) -- 0:00:42
341500 -- [-423.705] (-427.479) (-424.431) (-424.536) * (-425.912) [-426.298] (-425.898) (-430.110) -- 0:00:42
342000 -- (-424.798) [-428.998] (-425.423) (-426.048) * (-425.107) [-425.603] (-427.670) (-428.418) -- 0:00:42
342500 -- [-429.841] (-424.529) (-426.437) (-423.955) * (-426.894) [-424.878] (-427.698) (-427.512) -- 0:00:42
343000 -- (-423.918) (-429.367) [-425.040] (-429.692) * (-424.969) (-425.056) (-424.469) [-428.498] -- 0:00:42
343500 -- (-426.234) (-427.038) [-424.769] (-424.105) * [-424.339] (-426.624) (-429.168) (-425.219) -- 0:00:42
344000 -- (-424.734) (-428.671) (-424.697) [-425.121] * (-426.632) (-429.171) (-425.538) [-423.731] -- 0:00:41
344500 -- [-424.348] (-426.614) (-426.294) (-426.006) * (-426.326) (-427.225) (-427.114) [-428.385] -- 0:00:41
345000 -- (-425.183) [-426.971] (-423.842) (-424.229) * (-425.585) (-426.409) [-424.663] (-427.648) -- 0:00:41
Average standard deviation of split frequencies: 0.010389
345500 -- [-427.322] (-427.230) (-425.671) (-427.174) * (-425.866) (-427.229) [-424.754] (-425.980) -- 0:00:41
346000 -- [-428.969] (-429.227) (-424.030) (-428.321) * (-425.410) (-426.811) (-424.256) [-425.413] -- 0:00:41
346500 -- (-432.337) (-426.344) [-424.457] (-428.316) * (-424.842) (-428.081) (-426.154) [-428.136] -- 0:00:41
347000 -- (-424.675) [-429.813] (-423.865) (-426.784) * (-426.676) (-425.895) (-424.313) [-426.155] -- 0:00:41
347500 -- [-426.877] (-425.362) (-425.447) (-424.813) * (-429.491) (-427.788) (-426.178) [-425.033] -- 0:00:41
348000 -- (-425.946) [-425.181] (-426.889) (-425.895) * (-430.430) (-424.883) (-426.840) [-428.107] -- 0:00:41
348500 -- [-425.378] (-425.210) (-426.714) (-423.490) * (-429.995) (-426.076) (-428.566) [-424.208] -- 0:00:41
349000 -- (-425.753) (-427.080) [-426.075] (-423.819) * (-428.502) (-428.306) (-429.744) [-426.149] -- 0:00:41
349500 -- (-424.352) (-426.159) [-425.013] (-426.810) * (-426.066) (-425.139) (-427.141) [-424.404] -- 0:00:40
350000 -- (-426.416) (-426.968) (-426.334) [-425.034] * (-425.161) (-426.818) [-424.453] (-424.576) -- 0:00:40
Average standard deviation of split frequencies: 0.010923
350500 -- [-424.086] (-430.098) (-428.181) (-425.456) * (-425.712) [-424.529] (-429.219) (-425.719) -- 0:00:40
351000 -- (-424.363) (-425.148) [-424.053] (-425.847) * (-425.300) [-430.051] (-427.188) (-424.630) -- 0:00:40
351500 -- [-423.939] (-425.338) (-424.584) (-425.367) * (-425.265) (-425.507) [-424.027] (-425.619) -- 0:00:40
352000 -- (-424.624) (-430.800) [-425.139] (-426.590) * [-423.925] (-426.624) (-424.576) (-425.453) -- 0:00:42
352500 -- (-424.744) [-427.878] (-426.366) (-425.599) * (-425.225) (-427.109) [-426.265] (-424.330) -- 0:00:42
353000 -- (-424.113) (-425.107) [-426.667] (-423.993) * (-424.778) (-429.485) (-427.437) [-425.895] -- 0:00:42
353500 -- (-427.638) [-424.344] (-428.406) (-426.936) * (-427.438) (-429.687) [-427.779] (-427.185) -- 0:00:42
354000 -- (-424.519) (-426.418) [-425.103] (-424.089) * (-428.743) [-425.269] (-428.687) (-426.180) -- 0:00:41
354500 -- [-424.502] (-425.723) (-424.948) (-426.518) * [-426.237] (-428.701) (-426.384) (-425.507) -- 0:00:41
355000 -- [-424.664] (-425.766) (-425.641) (-429.387) * (-427.942) [-426.021] (-424.943) (-428.396) -- 0:00:41
Average standard deviation of split frequencies: 0.010180
355500 -- (-423.841) (-426.300) [-426.840] (-427.083) * [-425.494] (-424.791) (-427.690) (-427.914) -- 0:00:41
356000 -- (-425.576) (-424.339) [-425.038] (-424.674) * (-426.488) (-425.538) [-424.489] (-424.622) -- 0:00:41
356500 -- [-426.914] (-426.390) (-426.529) (-427.108) * (-424.393) (-426.730) [-423.823] (-424.645) -- 0:00:41
357000 -- [-424.518] (-428.055) (-424.673) (-426.232) * (-426.185) (-425.355) (-425.458) [-426.687] -- 0:00:41
357500 -- (-426.214) (-425.697) [-426.715] (-430.681) * (-427.706) (-424.793) [-424.134] (-424.190) -- 0:00:41
358000 -- [-427.378] (-427.734) (-426.138) (-425.149) * (-426.757) (-426.121) [-424.049] (-428.677) -- 0:00:41
358500 -- [-424.055] (-425.008) (-426.188) (-424.647) * (-424.472) [-425.318] (-428.425) (-426.551) -- 0:00:41
359000 -- [-423.759] (-425.569) (-427.108) (-425.775) * (-425.925) (-428.033) [-428.535] (-426.269) -- 0:00:41
359500 -- (-426.121) (-428.102) [-426.003] (-423.703) * [-424.659] (-427.926) (-426.949) (-425.124) -- 0:00:40
360000 -- (-425.568) [-424.019] (-430.494) (-425.086) * [-425.904] (-427.006) (-426.420) (-426.537) -- 0:00:40
Average standard deviation of split frequencies: 0.009803
360500 -- (-425.422) (-426.425) (-427.248) [-425.902] * (-425.715) [-423.465] (-426.201) (-426.939) -- 0:00:40
361000 -- [-426.319] (-427.737) (-426.526) (-423.605) * (-425.296) (-425.538) [-426.885] (-427.765) -- 0:00:40
361500 -- (-427.686) (-424.173) (-425.063) [-427.163] * (-425.703) (-424.722) [-425.656] (-425.578) -- 0:00:40
362000 -- (-425.653) (-431.085) (-427.561) [-425.696] * (-425.427) (-424.496) [-424.181] (-427.095) -- 0:00:40
362500 -- (-425.907) [-427.997] (-427.806) (-423.792) * (-427.188) (-426.650) (-425.374) [-426.895] -- 0:00:40
363000 -- (-425.893) (-425.425) [-424.185] (-428.968) * (-427.705) [-426.625] (-425.624) (-425.660) -- 0:00:40
363500 -- (-425.610) (-424.645) (-426.247) [-427.783] * (-428.348) (-429.025) (-425.971) [-425.988] -- 0:00:40
364000 -- [-429.067] (-425.119) (-423.703) (-425.267) * (-428.364) (-429.443) [-425.212] (-426.894) -- 0:00:40
364500 -- (-425.636) [-425.493] (-426.726) (-426.766) * [-423.851] (-426.275) (-427.558) (-425.648) -- 0:00:40
365000 -- [-423.756] (-427.794) (-427.392) (-424.285) * (-426.129) (-428.457) [-427.149] (-428.324) -- 0:00:40
Average standard deviation of split frequencies: 0.009338
365500 -- (-425.480) (-426.444) (-430.582) [-427.471] * (-426.973) (-424.154) [-423.987] (-424.512) -- 0:00:41
366000 -- [-425.574] (-426.091) (-429.826) (-424.994) * (-425.237) (-426.006) (-428.881) [-424.952] -- 0:00:41
366500 -- (-424.347) (-424.948) (-429.417) [-426.753] * (-426.623) (-425.101) [-427.077] (-425.578) -- 0:00:41
367000 -- (-427.057) (-424.854) [-424.575] (-424.229) * [-428.484] (-427.759) (-425.669) (-423.893) -- 0:00:41
367500 -- [-426.661] (-423.899) (-427.069) (-426.038) * (-426.793) [-424.695] (-428.653) (-426.817) -- 0:00:41
368000 -- (-430.287) (-424.373) [-424.318] (-427.207) * (-425.777) (-434.555) (-427.412) [-426.565] -- 0:00:41
368500 -- [-423.936] (-425.230) (-425.253) (-425.960) * (-424.147) (-424.273) [-424.810] (-427.391) -- 0:00:41
369000 -- (-424.782) (-427.493) (-426.241) [-427.610] * (-425.203) (-423.683) (-425.504) [-426.230] -- 0:00:41
369500 -- [-424.880] (-427.825) (-428.020) (-426.615) * (-424.570) [-427.408] (-424.979) (-425.130) -- 0:00:40
370000 -- (-423.831) (-425.637) (-427.676) [-424.627] * (-424.180) (-424.639) (-426.363) [-424.946] -- 0:00:40
Average standard deviation of split frequencies: 0.009220
370500 -- [-425.140] (-425.871) (-423.952) (-424.758) * (-424.352) [-428.318] (-427.116) (-425.323) -- 0:00:40
371000 -- (-424.625) (-427.076) [-425.125] (-425.236) * (-425.274) (-426.683) (-426.487) [-426.526] -- 0:00:40
371500 -- [-425.660] (-426.127) (-424.046) (-425.546) * (-425.291) [-426.339] (-429.965) (-427.359) -- 0:00:40
372000 -- [-425.159] (-426.520) (-424.422) (-425.673) * [-424.992] (-428.643) (-428.649) (-423.690) -- 0:00:40
372500 -- [-425.003] (-425.049) (-423.780) (-424.609) * (-424.670) (-429.737) (-424.664) [-423.642] -- 0:00:40
373000 -- (-425.350) [-424.699] (-424.524) (-426.766) * (-425.983) (-424.494) [-427.915] (-426.599) -- 0:00:40
373500 -- (-423.916) [-424.431] (-426.545) (-425.123) * (-429.772) (-426.477) [-425.747] (-425.193) -- 0:00:40
374000 -- (-424.729) (-425.298) [-425.724] (-425.182) * (-425.799) [-424.756] (-426.257) (-427.876) -- 0:00:40
374500 -- (-424.329) (-424.162) (-425.374) [-426.703] * (-428.591) [-424.326] (-427.471) (-426.810) -- 0:00:40
375000 -- (-427.407) [-426.037] (-423.510) (-426.023) * (-426.681) [-425.583] (-424.803) (-426.486) -- 0:00:40
Average standard deviation of split frequencies: 0.009873
375500 -- (-426.541) (-425.559) [-423.682] (-426.327) * (-426.499) (-428.395) [-425.068] (-425.545) -- 0:00:39
376000 -- (-426.331) [-425.004] (-432.264) (-424.287) * [-428.243] (-426.080) (-425.729) (-426.332) -- 0:00:39
376500 -- (-425.801) (-428.506) (-427.537) [-426.764] * (-429.842) (-425.347) [-426.235] (-424.861) -- 0:00:39
377000 -- (-425.352) [-428.455] (-426.636) (-423.930) * (-425.744) [-426.863] (-425.043) (-425.018) -- 0:00:39
377500 -- (-425.644) (-425.807) (-426.310) [-426.110] * (-423.936) [-425.720] (-427.273) (-424.235) -- 0:00:39
378000 -- (-425.972) (-426.030) (-424.894) [-425.671] * (-424.564) [-424.195] (-425.827) (-430.592) -- 0:00:39
378500 -- (-424.433) (-429.081) (-424.000) [-427.070] * (-426.347) [-424.548] (-427.950) (-425.110) -- 0:00:39
379000 -- (-425.821) (-429.240) (-424.265) [-427.860] * [-425.004] (-425.051) (-424.432) (-425.124) -- 0:00:39
379500 -- [-423.857] (-426.712) (-425.552) (-426.024) * (-426.116) (-424.873) (-426.719) [-425.536] -- 0:00:39
380000 -- (-427.816) [-424.199] (-425.491) (-427.784) * [-426.887] (-424.372) (-425.187) (-424.740) -- 0:00:39
Average standard deviation of split frequencies: 0.009056
380500 -- (-424.100) (-423.734) [-424.511] (-426.089) * (-430.501) [-427.303] (-425.628) (-423.664) -- 0:00:39
381000 -- (-424.267) (-426.752) [-423.842] (-424.482) * (-426.333) (-424.079) (-425.462) [-425.475] -- 0:00:38
381500 -- [-426.294] (-424.684) (-423.622) (-424.319) * (-430.676) (-427.122) (-423.625) [-425.690] -- 0:00:38
382000 -- [-426.280] (-424.969) (-424.933) (-427.072) * (-426.202) (-428.349) (-427.764) [-425.454] -- 0:00:38
382500 -- (-428.239) (-424.063) [-426.321] (-424.323) * (-425.376) [-425.001] (-432.456) (-426.309) -- 0:00:38
383000 -- [-425.461] (-427.076) (-426.414) (-426.068) * (-428.180) (-429.742) (-425.339) [-425.636] -- 0:00:40
383500 -- (-424.386) (-432.229) (-429.551) [-425.638] * [-426.902] (-433.889) (-427.146) (-425.296) -- 0:00:40
384000 -- [-425.431] (-428.058) (-426.060) (-425.669) * [-426.212] (-428.524) (-424.163) (-427.991) -- 0:00:40
384500 -- (-424.158) [-425.390] (-424.643) (-424.806) * (-426.973) (-425.564) [-424.523] (-424.346) -- 0:00:40
385000 -- (-429.517) (-424.366) [-426.343] (-426.797) * (-424.504) [-425.599] (-428.496) (-427.074) -- 0:00:39
Average standard deviation of split frequencies: 0.007862
385500 -- (-425.714) (-428.626) [-427.381] (-430.869) * [-424.930] (-424.775) (-427.139) (-426.082) -- 0:00:39
386000 -- (-424.655) [-424.453] (-428.155) (-425.122) * (-429.494) (-425.904) (-425.791) [-423.752] -- 0:00:39
386500 -- (-425.712) (-425.939) (-427.637) [-424.029] * (-425.672) (-427.467) (-425.557) [-424.140] -- 0:00:39
387000 -- (-425.040) (-424.941) (-426.073) [-425.052] * (-424.088) (-427.013) (-424.889) [-425.166] -- 0:00:39
387500 -- (-426.980) (-426.850) (-427.018) [-427.771] * (-424.678) [-424.357] (-425.450) (-425.227) -- 0:00:39
388000 -- [-426.284] (-425.612) (-425.207) (-424.935) * (-426.330) (-429.777) (-423.666) [-424.277] -- 0:00:39
388500 -- (-425.569) [-426.693] (-425.040) (-424.557) * (-424.346) (-425.031) [-424.071] (-429.260) -- 0:00:39
389000 -- (-426.016) (-426.716) (-423.647) [-427.800] * (-435.401) (-427.765) [-423.754] (-427.309) -- 0:00:39
389500 -- (-425.081) (-429.099) [-425.566] (-428.070) * [-428.669] (-427.324) (-426.510) (-423.823) -- 0:00:39
390000 -- (-426.658) (-427.277) [-426.410] (-432.516) * (-425.010) [-423.894] (-424.932) (-424.353) -- 0:00:39
Average standard deviation of split frequencies: 0.007768
390500 -- (-426.313) (-425.919) (-426.950) [-428.063] * [-428.987] (-423.442) (-425.277) (-428.186) -- 0:00:39
391000 -- [-426.119] (-426.448) (-427.925) (-430.908) * (-426.157) (-423.856) (-425.421) [-425.215] -- 0:00:38
391500 -- (-425.301) [-426.659] (-426.546) (-427.995) * (-426.558) (-426.519) [-427.383] (-426.094) -- 0:00:38
392000 -- (-426.242) [-430.037] (-429.600) (-426.527) * (-425.602) [-424.670] (-427.525) (-425.762) -- 0:00:38
392500 -- (-425.763) (-423.686) (-429.993) [-424.802] * (-425.049) (-425.803) (-428.369) [-425.623] -- 0:00:38
393000 -- (-426.381) (-426.747) [-425.088] (-425.962) * (-424.773) (-425.403) [-426.878] (-425.762) -- 0:00:38
393500 -- (-425.118) (-427.483) (-425.094) [-426.133] * [-428.513] (-423.593) (-426.898) (-425.561) -- 0:00:38
394000 -- (-427.030) (-424.648) [-425.952] (-428.011) * [-424.929] (-425.526) (-425.981) (-427.353) -- 0:00:38
394500 -- (-426.715) (-425.824) (-424.491) [-429.585] * (-428.387) [-424.620] (-423.790) (-424.429) -- 0:00:38
395000 -- (-427.938) (-423.908) [-425.947] (-426.946) * (-425.060) (-427.276) (-423.972) [-425.350] -- 0:00:38
Average standard deviation of split frequencies: 0.007887
395500 -- (-425.375) [-429.761] (-426.890) (-426.905) * (-424.830) (-426.188) (-425.309) [-426.418] -- 0:00:38
396000 -- [-425.072] (-426.453) (-424.587) (-424.651) * (-425.340) [-424.814] (-433.904) (-424.781) -- 0:00:38
396500 -- (-424.680) [-424.943] (-425.932) (-425.760) * (-427.115) (-428.126) (-425.510) [-425.934] -- 0:00:38
397000 -- [-424.957] (-424.934) (-430.037) (-426.304) * [-424.384] (-427.659) (-424.255) (-425.541) -- 0:00:37
397500 -- (-425.194) (-424.808) [-425.183] (-423.708) * (-426.870) (-426.629) (-425.381) [-427.890] -- 0:00:37
398000 -- (-426.357) [-426.364] (-424.655) (-424.802) * (-425.738) (-427.433) (-427.092) [-424.983] -- 0:00:39
398500 -- (-432.083) (-426.416) (-423.574) [-425.156] * (-426.266) [-424.412] (-428.015) (-427.640) -- 0:00:39
399000 -- (-423.465) (-429.757) [-426.242] (-425.627) * (-426.353) (-427.204) [-424.293] (-426.613) -- 0:00:39
399500 -- (-424.426) (-429.911) (-425.729) [-426.904] * [-425.633] (-425.794) (-425.567) (-425.964) -- 0:00:39
400000 -- (-423.665) [-424.902] (-428.780) (-424.211) * (-424.155) [-424.451] (-426.081) (-428.280) -- 0:00:39
Average standard deviation of split frequencies: 0.008383
400500 -- (-425.486) (-432.837) (-425.779) [-425.443] * (-424.000) (-428.336) [-426.477] (-423.899) -- 0:00:38
401000 -- [-425.090] (-429.999) (-428.320) (-429.118) * (-427.818) (-425.935) [-424.109] (-429.070) -- 0:00:38
401500 -- [-425.650] (-425.435) (-426.200) (-429.921) * (-427.702) (-426.696) (-424.959) [-428.056] -- 0:00:38
402000 -- [-426.640] (-427.253) (-427.512) (-425.436) * (-424.854) [-428.453] (-426.269) (-431.818) -- 0:00:38
402500 -- [-424.945] (-429.144) (-423.962) (-426.668) * (-427.867) [-425.572] (-424.458) (-428.393) -- 0:00:38
403000 -- (-424.368) (-429.089) (-425.663) [-427.009] * (-431.907) (-426.031) [-427.632] (-428.781) -- 0:00:38
403500 -- [-425.154] (-424.364) (-425.757) (-425.293) * (-426.096) (-429.768) [-425.960] (-425.099) -- 0:00:38
404000 -- (-424.684) (-424.051) [-425.861] (-424.352) * [-424.814] (-424.984) (-426.591) (-425.865) -- 0:00:38
404500 -- (-424.524) (-424.069) (-425.523) [-424.172] * (-426.248) (-426.243) [-425.777] (-425.759) -- 0:00:38
405000 -- (-425.328) [-424.052] (-425.333) (-423.432) * (-428.150) [-423.867] (-423.982) (-425.381) -- 0:00:38
Average standard deviation of split frequencies: 0.007910
405500 -- [-425.050] (-427.305) (-426.401) (-423.430) * (-425.297) (-425.759) [-427.781] (-425.270) -- 0:00:38
406000 -- (-428.646) (-424.997) (-426.186) [-424.039] * (-425.426) [-426.761] (-425.817) (-424.713) -- 0:00:38
406500 -- [-425.681] (-426.110) (-427.252) (-428.741) * (-424.080) (-425.388) (-426.393) [-427.244] -- 0:00:37
407000 -- [-428.306] (-425.531) (-425.885) (-429.821) * (-426.224) (-433.971) [-425.974] (-426.079) -- 0:00:37
407500 -- (-425.151) (-430.588) (-425.031) [-425.010] * [-427.185] (-427.434) (-428.672) (-425.253) -- 0:00:37
408000 -- [-424.522] (-424.880) (-427.987) (-424.673) * (-434.316) (-426.973) (-430.196) [-426.623] -- 0:00:37
408500 -- (-431.657) (-423.664) [-425.834] (-424.855) * (-425.152) [-427.814] (-424.636) (-426.351) -- 0:00:37
409000 -- [-428.585] (-426.235) (-429.722) (-424.507) * (-429.321) (-428.557) (-424.096) [-426.311] -- 0:00:37
409500 -- (-426.954) (-427.266) (-430.922) [-425.178] * (-426.897) (-424.305) (-425.471) [-427.329] -- 0:00:37
410000 -- (-426.470) (-428.046) (-428.152) [-426.027] * (-426.138) (-426.940) [-423.961] (-425.251) -- 0:00:37
Average standard deviation of split frequencies: 0.007677
410500 -- (-426.630) (-425.076) [-424.349] (-431.924) * (-425.597) (-425.778) (-423.741) [-424.793] -- 0:00:37
411000 -- [-425.147] (-424.902) (-426.382) (-428.901) * [-426.864] (-427.033) (-425.358) (-425.058) -- 0:00:37
411500 -- [-425.681] (-425.073) (-427.140) (-425.127) * (-430.309) [-424.749] (-431.158) (-428.149) -- 0:00:37
412000 -- (-424.947) (-425.126) [-425.426] (-427.146) * (-426.536) [-424.196] (-432.735) (-426.133) -- 0:00:37
412500 -- (-425.201) (-430.188) (-429.561) [-429.706] * (-425.835) (-426.039) (-426.314) [-424.945] -- 0:00:37
413000 -- (-427.379) (-429.375) (-429.112) [-426.204] * (-425.400) (-426.266) [-423.965] (-424.215) -- 0:00:38
413500 -- (-426.420) (-427.720) (-425.918) [-424.324] * (-426.545) (-424.709) [-425.467] (-424.618) -- 0:00:38
414000 -- [-423.408] (-425.202) (-427.766) (-425.103) * (-426.760) [-426.340] (-428.350) (-426.584) -- 0:00:38
414500 -- [-423.850] (-427.380) (-428.070) (-425.964) * (-425.746) (-426.721) [-426.259] (-424.705) -- 0:00:38
415000 -- [-429.895] (-426.322) (-428.366) (-424.833) * [-427.248] (-425.737) (-427.513) (-428.149) -- 0:00:38
Average standard deviation of split frequencies: 0.008003
415500 -- [-425.853] (-427.577) (-425.040) (-424.503) * [-423.885] (-428.081) (-428.295) (-425.741) -- 0:00:37
416000 -- (-426.215) (-425.084) (-424.385) [-425.273] * (-424.643) [-424.897] (-425.519) (-425.341) -- 0:00:37
416500 -- (-426.644) (-427.066) (-425.036) [-425.261] * (-425.223) [-424.672] (-430.337) (-426.997) -- 0:00:37
417000 -- (-425.543) [-424.905] (-427.288) (-430.174) * (-426.007) [-424.683] (-427.412) (-424.697) -- 0:00:37
417500 -- (-427.602) (-426.860) [-424.578] (-426.163) * (-430.069) [-429.165] (-426.447) (-424.608) -- 0:00:37
418000 -- (-424.284) (-425.655) [-424.350] (-426.154) * (-427.657) (-423.994) (-429.011) [-426.381] -- 0:00:37
418500 -- (-424.834) (-426.717) (-424.756) [-427.170] * [-426.485] (-428.717) (-428.925) (-426.526) -- 0:00:37
419000 -- (-426.642) (-430.032) [-424.049] (-426.702) * [-425.774] (-425.408) (-429.254) (-427.963) -- 0:00:37
419500 -- (-426.929) [-424.068] (-425.616) (-425.297) * (-424.748) (-426.101) (-426.094) [-426.904] -- 0:00:37
420000 -- (-424.263) [-423.811] (-427.393) (-425.772) * [-428.422] (-428.417) (-425.465) (-428.207) -- 0:00:37
Average standard deviation of split frequencies: 0.008054
420500 -- (-424.763) (-426.513) (-425.509) [-426.578] * [-426.209] (-425.913) (-423.931) (-429.201) -- 0:00:37
421000 -- (-424.302) (-428.618) [-424.711] (-433.319) * (-428.746) (-425.900) (-429.955) [-427.716] -- 0:00:37
421500 -- (-424.604) (-425.533) [-425.265] (-427.402) * (-427.399) [-424.557] (-423.905) (-424.158) -- 0:00:37
422000 -- (-429.466) (-424.197) [-425.796] (-425.443) * (-428.578) (-425.620) (-424.958) [-424.762] -- 0:00:36
422500 -- (-424.432) [-424.825] (-424.898) (-424.582) * [-427.216] (-425.384) (-426.201) (-426.917) -- 0:00:36
423000 -- (-425.135) (-425.084) [-426.126] (-426.530) * [-426.966] (-424.711) (-424.988) (-424.058) -- 0:00:36
423500 -- [-425.805] (-429.576) (-425.477) (-424.934) * [-427.073] (-427.985) (-429.790) (-426.093) -- 0:00:36
424000 -- (-425.513) (-424.917) (-425.837) [-426.297] * (-426.403) (-425.256) [-424.690] (-424.460) -- 0:00:36
424500 -- [-424.495] (-426.562) (-425.591) (-426.512) * [-423.946] (-424.942) (-427.732) (-426.488) -- 0:00:36
425000 -- (-426.157) [-425.270] (-425.342) (-427.949) * (-424.744) (-425.278) (-425.204) [-426.314] -- 0:00:36
Average standard deviation of split frequencies: 0.008299
425500 -- (-426.207) [-425.610] (-423.668) (-431.700) * [-427.326] (-426.175) (-427.003) (-426.643) -- 0:00:36
426000 -- (-424.923) [-423.610] (-423.747) (-425.666) * (-425.423) (-427.513) (-426.370) [-424.541] -- 0:00:36
426500 -- [-425.398] (-424.044) (-425.589) (-424.119) * [-424.641] (-424.260) (-425.663) (-426.121) -- 0:00:36
427000 -- (-425.265) [-427.000] (-424.228) (-426.324) * (-428.075) (-426.750) [-425.478] (-428.252) -- 0:00:36
427500 -- (-427.931) (-423.718) [-426.241] (-426.192) * [-425.437] (-427.385) (-424.774) (-427.107) -- 0:00:36
428000 -- [-423.828] (-426.093) (-425.515) (-427.876) * (-423.876) (-428.932) [-427.280] (-423.908) -- 0:00:36
428500 -- (-427.082) (-426.379) (-424.638) [-425.270] * (-428.395) [-425.210] (-424.110) (-425.519) -- 0:00:36
429000 -- [-424.908] (-429.307) (-428.555) (-425.446) * [-424.769] (-423.837) (-427.060) (-428.709) -- 0:00:37
429500 -- (-425.738) (-424.466) [-424.694] (-426.850) * (-428.890) [-429.093] (-423.777) (-429.851) -- 0:00:37
430000 -- (-424.682) (-423.705) (-426.070) [-429.611] * [-425.166] (-424.315) (-423.912) (-429.026) -- 0:00:37
Average standard deviation of split frequencies: 0.007388
430500 -- [-424.363] (-427.896) (-425.000) (-424.447) * (-430.050) [-427.200] (-425.454) (-425.272) -- 0:00:37
431000 -- (-424.014) (-426.447) [-423.852] (-426.837) * (-426.409) (-424.685) (-424.568) [-426.664] -- 0:00:36
431500 -- (-424.757) [-425.020] (-425.083) (-424.475) * (-424.476) (-426.542) [-424.961] (-426.772) -- 0:00:36
432000 -- [-425.779] (-427.250) (-429.119) (-428.209) * [-425.967] (-426.326) (-424.540) (-427.063) -- 0:00:36
432500 -- (-426.128) (-423.817) (-427.029) [-426.096] * [-428.830] (-425.197) (-424.330) (-425.380) -- 0:00:36
433000 -- (-425.230) (-425.167) [-426.879] (-430.302) * (-424.775) (-426.852) [-425.020] (-424.929) -- 0:00:36
433500 -- (-426.836) (-425.054) [-426.174] (-427.029) * [-424.575] (-425.799) (-425.513) (-426.006) -- 0:00:36
434000 -- (-430.456) [-425.001] (-427.278) (-424.377) * [-425.284] (-425.493) (-424.742) (-424.328) -- 0:00:36
434500 -- (-428.089) [-430.212] (-424.956) (-424.714) * (-426.719) [-425.000] (-424.233) (-426.495) -- 0:00:36
435000 -- [-424.862] (-434.439) (-424.635) (-427.616) * [-425.238] (-425.769) (-426.528) (-424.132) -- 0:00:36
Average standard deviation of split frequencies: 0.007974
435500 -- (-424.638) (-428.048) [-424.987] (-424.590) * (-424.604) (-427.300) (-426.520) [-425.521] -- 0:00:36
436000 -- [-425.060] (-425.445) (-426.638) (-424.543) * [-423.889] (-424.589) (-426.773) (-425.547) -- 0:00:36
436500 -- (-425.588) (-424.863) [-429.011] (-424.861) * [-423.800] (-427.337) (-424.171) (-429.169) -- 0:00:36
437000 -- (-424.506) (-425.201) (-424.082) [-424.810] * (-423.605) [-425.389] (-424.892) (-423.992) -- 0:00:36
437500 -- (-425.019) [-427.046] (-427.343) (-428.381) * (-427.025) (-428.115) [-424.487] (-425.458) -- 0:00:36
438000 -- [-425.678] (-425.910) (-425.655) (-424.810) * (-428.164) (-425.960) (-425.844) [-424.148] -- 0:00:35
438500 -- (-425.658) [-424.980] (-424.380) (-424.388) * (-423.564) [-426.854] (-424.066) (-425.359) -- 0:00:35
439000 -- (-424.416) [-425.398] (-426.034) (-424.413) * [-423.902] (-424.414) (-424.839) (-424.127) -- 0:00:35
439500 -- (-424.228) [-427.775] (-426.997) (-427.692) * (-427.191) (-424.826) [-423.695] (-427.996) -- 0:00:35
440000 -- [-424.112] (-427.183) (-430.548) (-426.032) * (-430.666) (-431.491) [-425.454] (-423.604) -- 0:00:35
Average standard deviation of split frequencies: 0.008424
440500 -- (-424.352) (-428.226) [-427.407] (-427.038) * (-425.294) (-428.696) (-426.876) [-427.729] -- 0:00:35
441000 -- [-426.301] (-426.668) (-426.269) (-424.490) * [-424.396] (-426.010) (-429.086) (-426.029) -- 0:00:35
441500 -- (-426.233) [-428.677] (-429.069) (-431.527) * (-424.853) [-426.513] (-425.211) (-425.497) -- 0:00:35
442000 -- (-428.052) [-427.516] (-427.179) (-427.969) * (-424.250) (-424.353) (-424.396) [-428.348] -- 0:00:35
442500 -- [-427.576] (-425.493) (-426.885) (-427.220) * [-424.984] (-426.339) (-426.202) (-427.058) -- 0:00:35
443000 -- (-426.706) [-424.838] (-426.398) (-426.211) * (-423.648) (-429.504) [-425.455] (-424.927) -- 0:00:35
443500 -- [-426.309] (-428.771) (-428.138) (-424.292) * (-425.102) [-430.171] (-425.812) (-431.143) -- 0:00:35
444000 -- (-424.481) (-429.352) (-424.561) [-424.983] * (-429.343) (-430.359) [-428.850] (-427.167) -- 0:00:35
444500 -- (-425.909) [-426.064] (-424.477) (-424.005) * [-428.262] (-432.014) (-426.127) (-435.671) -- 0:00:36
445000 -- [-425.086] (-426.372) (-428.558) (-430.244) * [-424.780] (-427.826) (-428.481) (-431.086) -- 0:00:36
Average standard deviation of split frequencies: 0.008324
445500 -- (-426.881) (-425.196) [-425.338] (-426.659) * (-426.520) (-425.086) [-427.983] (-426.857) -- 0:00:36
446000 -- (-424.054) (-425.647) [-426.487] (-424.592) * (-425.197) (-426.918) (-425.203) [-424.723] -- 0:00:36
446500 -- (-424.809) (-424.721) [-426.448] (-430.225) * (-426.643) [-424.300] (-426.864) (-424.174) -- 0:00:35
447000 -- (-423.922) (-426.335) (-425.998) [-423.724] * (-423.886) (-427.210) (-425.137) [-425.973] -- 0:00:35
447500 -- [-423.856] (-425.038) (-424.307) (-424.290) * (-427.248) (-425.849) (-427.451) [-426.996] -- 0:00:35
448000 -- (-424.145) [-424.602] (-423.602) (-424.860) * (-425.791) [-423.887] (-425.413) (-424.789) -- 0:00:35
448500 -- (-425.255) (-426.250) [-423.569] (-426.883) * [-425.512] (-425.263) (-424.027) (-428.045) -- 0:00:35
449000 -- [-426.837] (-427.679) (-424.193) (-428.581) * (-424.466) (-426.411) (-426.406) [-424.444] -- 0:00:35
449500 -- (-430.354) (-424.402) (-424.067) [-424.985] * (-423.760) (-429.325) [-425.577] (-429.928) -- 0:00:35
450000 -- [-424.197] (-424.755) (-427.986) (-425.596) * (-424.043) [-424.151] (-425.974) (-428.899) -- 0:00:35
Average standard deviation of split frequencies: 0.008499
450500 -- (-433.855) (-425.913) [-426.537] (-426.905) * (-425.982) (-429.761) (-426.876) [-428.209] -- 0:00:35
451000 -- [-425.287] (-427.456) (-424.603) (-427.830) * [-425.990] (-425.402) (-423.791) (-425.768) -- 0:00:35
451500 -- [-425.670] (-425.535) (-424.278) (-426.086) * (-425.553) (-428.265) [-425.778] (-426.623) -- 0:00:35
452000 -- (-425.463) (-424.696) [-428.079] (-425.669) * (-425.564) [-426.732] (-429.477) (-426.959) -- 0:00:35
452500 -- (-425.337) (-427.356) [-426.277] (-426.726) * (-430.247) (-424.886) [-425.309] (-424.320) -- 0:00:35
453000 -- [-425.032] (-432.151) (-425.394) (-426.625) * [-427.022] (-424.763) (-426.126) (-424.147) -- 0:00:35
453500 -- [-424.310] (-425.572) (-426.692) (-425.657) * [-425.050] (-424.702) (-426.311) (-427.721) -- 0:00:34
454000 -- (-423.938) [-425.158] (-429.184) (-424.204) * [-426.457] (-425.057) (-426.051) (-427.929) -- 0:00:34
454500 -- [-424.427] (-426.095) (-427.082) (-424.432) * (-425.949) [-424.659] (-424.905) (-427.165) -- 0:00:34
455000 -- (-427.770) (-428.593) [-426.031] (-424.408) * (-425.703) (-424.783) [-426.770] (-427.166) -- 0:00:34
Average standard deviation of split frequencies: 0.008658
455500 -- [-423.894] (-430.641) (-425.778) (-429.537) * [-424.619] (-426.175) (-429.315) (-429.433) -- 0:00:34
456000 -- (-427.998) (-426.385) (-426.986) [-427.461] * (-423.576) (-427.617) [-424.894] (-425.526) -- 0:00:34
456500 -- (-426.112) (-426.810) (-424.405) [-426.655] * (-426.051) (-426.421) [-430.414] (-426.591) -- 0:00:34
457000 -- (-429.241) (-424.910) [-424.462] (-427.810) * [-427.956] (-425.988) (-428.060) (-426.293) -- 0:00:34
457500 -- [-424.758] (-428.458) (-424.927) (-426.225) * (-427.021) (-427.575) [-432.474] (-425.537) -- 0:00:34
458000 -- (-423.720) [-426.321] (-426.370) (-426.707) * (-428.500) (-429.287) [-424.220] (-427.103) -- 0:00:34
458500 -- [-423.498] (-424.581) (-423.978) (-426.210) * (-427.628) (-425.098) [-424.737] (-423.812) -- 0:00:34
459000 -- (-423.964) (-428.499) (-424.802) [-430.609] * [-425.745] (-424.619) (-425.438) (-425.704) -- 0:00:34
459500 -- (-424.688) (-424.065) (-425.402) [-433.478] * (-424.107) [-429.875] (-425.877) (-425.473) -- 0:00:34
460000 -- (-426.094) (-426.868) (-425.316) [-429.095] * (-425.398) [-428.941] (-424.978) (-428.648) -- 0:00:35
Average standard deviation of split frequencies: 0.008186
460500 -- (-428.169) [-424.449] (-424.832) (-425.666) * [-425.346] (-425.592) (-425.993) (-429.730) -- 0:00:35
461000 -- (-425.250) (-423.996) (-425.661) [-423.859] * (-427.603) [-425.882] (-424.595) (-425.167) -- 0:00:35
461500 -- [-428.428] (-426.499) (-424.626) (-426.603) * (-426.369) (-424.674) (-424.881) [-425.327] -- 0:00:35
462000 -- (-428.913) [-426.480] (-426.413) (-424.748) * (-424.039) [-426.475] (-425.065) (-424.306) -- 0:00:34
462500 -- [-427.848] (-427.185) (-426.943) (-424.293) * (-424.157) (-425.207) [-425.021] (-423.844) -- 0:00:34
463000 -- (-426.414) [-424.503] (-429.093) (-425.817) * (-428.400) (-425.930) (-425.103) [-425.471] -- 0:00:34
463500 -- (-427.216) [-427.213] (-426.805) (-424.214) * [-430.483] (-426.410) (-429.891) (-424.021) -- 0:00:34
464000 -- (-434.806) (-427.621) (-423.888) [-423.456] * (-425.710) (-426.355) (-425.561) [-423.676] -- 0:00:34
464500 -- (-430.150) [-425.403] (-424.693) (-424.663) * (-425.931) [-427.979] (-428.227) (-424.183) -- 0:00:34
465000 -- (-429.220) (-425.280) (-424.276) [-427.003] * (-425.931) (-428.857) [-424.751] (-424.954) -- 0:00:34
Average standard deviation of split frequencies: 0.007650
465500 -- (-426.630) (-424.447) (-428.472) [-425.666] * (-424.792) (-426.944) (-424.067) [-427.267] -- 0:00:34
466000 -- (-426.632) (-424.299) [-426.044] (-424.139) * (-424.866) (-423.841) (-427.925) [-426.167] -- 0:00:34
466500 -- (-426.060) (-425.722) [-428.069] (-424.258) * (-425.663) [-424.307] (-425.868) (-424.132) -- 0:00:34
467000 -- (-433.147) [-423.755] (-425.157) (-425.400) * (-428.413) [-424.441] (-425.354) (-428.049) -- 0:00:34
467500 -- [-425.119] (-427.234) (-427.196) (-425.829) * (-426.637) [-427.422] (-424.483) (-424.078) -- 0:00:34
468000 -- [-425.984] (-424.187) (-426.578) (-424.868) * (-426.419) [-425.173] (-426.389) (-425.356) -- 0:00:34
468500 -- (-425.299) [-424.111] (-428.273) (-425.638) * (-429.037) [-424.408] (-427.145) (-427.728) -- 0:00:34
469000 -- (-427.713) (-428.772) (-426.637) [-430.883] * (-428.343) (-424.938) (-424.296) [-426.248] -- 0:00:33
469500 -- [-424.483] (-429.729) (-427.498) (-424.618) * (-427.184) [-424.205] (-425.693) (-426.712) -- 0:00:33
470000 -- (-424.444) (-429.871) (-426.203) [-427.361] * (-431.290) (-425.804) (-426.553) [-424.238] -- 0:00:33
Average standard deviation of split frequencies: 0.007887
470500 -- (-425.226) (-427.912) (-428.035) [-425.395] * (-425.177) (-425.766) (-427.153) [-424.590] -- 0:00:33
471000 -- (-430.076) (-427.990) [-424.713] (-424.634) * [-424.609] (-426.601) (-425.101) (-428.119) -- 0:00:33
471500 -- (-427.131) (-424.462) [-426.503] (-431.889) * (-427.082) [-425.634] (-430.159) (-427.367) -- 0:00:33
472000 -- (-425.315) (-430.253) [-426.307] (-429.741) * (-427.333) [-424.316] (-424.717) (-425.054) -- 0:00:33
472500 -- (-426.160) [-429.718] (-424.425) (-425.183) * [-427.815] (-426.036) (-424.387) (-425.596) -- 0:00:33
473000 -- (-430.165) [-427.217] (-426.155) (-429.319) * (-427.068) (-424.627) (-423.767) [-424.448] -- 0:00:33
473500 -- [-426.170] (-426.620) (-426.452) (-425.912) * (-426.259) [-423.787] (-425.861) (-428.670) -- 0:00:33
474000 -- (-425.788) (-426.991) (-426.410) [-426.421] * [-423.921] (-423.735) (-425.649) (-426.224) -- 0:00:33
474500 -- (-424.419) (-428.901) [-428.099] (-425.621) * [-425.254] (-424.403) (-424.244) (-426.006) -- 0:00:33
475000 -- (-425.535) (-425.838) (-427.669) [-423.663] * [-425.109] (-426.235) (-428.061) (-424.238) -- 0:00:33
Average standard deviation of split frequencies: 0.008294
475500 -- [-427.512] (-426.283) (-428.684) (-424.066) * [-427.239] (-426.087) (-425.749) (-426.514) -- 0:00:33
476000 -- (-425.660) (-424.266) (-427.777) [-428.288] * [-424.376] (-427.173) (-424.908) (-427.011) -- 0:00:33
476500 -- (-425.840) (-426.131) (-425.914) [-424.328] * (-423.880) (-431.155) [-426.311] (-424.298) -- 0:00:32
477000 -- (-424.063) (-426.017) [-428.147] (-424.776) * (-424.412) (-424.746) (-426.970) [-424.557] -- 0:00:33
477500 -- [-424.229] (-426.481) (-425.545) (-423.488) * (-426.105) [-423.875] (-426.994) (-424.805) -- 0:00:33
478000 -- [-424.638] (-425.145) (-425.803) (-425.848) * (-425.207) (-424.056) [-424.748] (-426.359) -- 0:00:33
478500 -- [-425.887] (-424.874) (-425.165) (-424.151) * [-425.155] (-423.743) (-426.151) (-426.711) -- 0:00:33
479000 -- (-429.513) (-426.094) (-424.733) [-424.420] * (-426.174) (-423.909) [-425.761] (-429.573) -- 0:00:33
479500 -- [-425.616] (-425.213) (-425.831) (-423.907) * (-425.350) (-425.525) [-426.643] (-425.316) -- 0:00:33
480000 -- (-426.766) (-426.127) (-426.261) [-424.504] * (-428.113) (-425.753) (-427.574) [-430.211] -- 0:00:33
Average standard deviation of split frequencies: 0.007417
480500 -- (-427.525) (-423.740) (-425.206) [-425.609] * (-426.064) [-425.478] (-424.747) (-426.905) -- 0:00:33
481000 -- (-425.625) (-423.981) [-424.886] (-426.329) * (-427.522) [-425.418] (-425.438) (-424.953) -- 0:00:33
481500 -- (-425.291) (-425.652) (-428.945) [-427.375] * [-424.285] (-425.507) (-424.070) (-426.275) -- 0:00:33
482000 -- (-424.169) (-425.539) [-425.300] (-428.583) * [-425.889] (-434.486) (-425.337) (-425.619) -- 0:00:33
482500 -- (-424.627) (-426.184) (-427.070) [-427.761] * (-430.768) (-426.486) (-425.806) [-424.813] -- 0:00:33
483000 -- [-424.567] (-424.678) (-423.613) (-424.671) * (-424.527) (-428.329) (-423.872) [-425.496] -- 0:00:33
483500 -- (-429.772) (-425.999) [-425.019] (-426.541) * (-426.341) (-425.287) [-423.472] (-425.322) -- 0:00:33
484000 -- (-424.897) [-424.603] (-424.776) (-427.181) * (-428.589) (-428.458) (-432.671) [-425.639] -- 0:00:33
484500 -- (-423.919) (-426.611) (-424.088) [-429.865] * (-425.987) (-431.297) [-426.779] (-426.085) -- 0:00:32
485000 -- (-427.609) (-425.184) [-424.954] (-423.758) * (-424.109) (-429.339) [-425.167] (-425.156) -- 0:00:32
Average standard deviation of split frequencies: 0.006911
485500 -- [-424.810] (-424.534) (-430.951) (-426.721) * (-425.003) (-427.753) [-427.249] (-425.075) -- 0:00:32
486000 -- [-425.767] (-426.558) (-425.564) (-426.441) * (-428.678) [-426.828] (-426.317) (-428.137) -- 0:00:32
486500 -- (-427.076) [-426.325] (-425.361) (-425.827) * (-428.771) (-425.307) [-425.494] (-429.053) -- 0:00:32
487000 -- (-426.755) (-426.169) [-424.159] (-425.932) * (-426.320) (-425.388) (-424.870) [-426.983] -- 0:00:32
487500 -- (-425.589) (-424.569) (-425.707) [-427.155] * (-428.610) (-425.196) [-425.744] (-425.118) -- 0:00:32
488000 -- (-426.223) (-428.239) [-426.249] (-426.449) * (-429.008) [-427.344] (-429.373) (-424.114) -- 0:00:32
488500 -- (-428.237) (-428.095) (-423.973) [-426.414] * (-424.375) (-423.676) (-429.139) [-424.795] -- 0:00:32
489000 -- (-427.823) (-428.744) [-425.207] (-424.947) * (-425.105) (-423.735) [-426.520] (-427.938) -- 0:00:32
489500 -- [-424.889] (-425.456) (-425.104) (-424.723) * (-427.947) [-424.516] (-428.238) (-431.121) -- 0:00:32
490000 -- (-426.634) (-430.124) (-427.817) [-425.598] * (-427.284) [-424.168] (-424.679) (-427.283) -- 0:00:32
Average standard deviation of split frequencies: 0.007085
490500 -- [-429.501] (-426.242) (-426.592) (-425.964) * (-425.226) (-424.525) [-424.418] (-424.546) -- 0:00:32
491000 -- (-430.333) (-424.649) (-428.599) [-424.924] * (-424.082) [-427.983] (-425.197) (-425.722) -- 0:00:32
491500 -- (-425.865) [-425.574] (-427.343) (-427.618) * (-426.062) (-424.601) (-424.952) [-423.779] -- 0:00:32
492000 -- [-425.810] (-425.960) (-426.139) (-424.215) * (-425.749) (-426.876) [-424.512] (-424.171) -- 0:00:32
492500 -- (-423.787) [-426.114] (-425.655) (-424.006) * [-427.842] (-424.980) (-425.508) (-429.242) -- 0:00:31
493000 -- (-425.764) [-429.343] (-425.107) (-430.418) * (-425.395) (-424.262) [-426.644] (-430.320) -- 0:00:32
493500 -- (-428.664) (-427.218) (-424.648) [-426.748] * [-426.043] (-425.585) (-425.419) (-428.079) -- 0:00:32
494000 -- (-426.609) [-427.831] (-425.009) (-427.177) * (-424.636) [-424.140] (-427.231) (-426.131) -- 0:00:32
494500 -- [-425.223] (-425.230) (-426.236) (-424.380) * [-423.977] (-427.915) (-423.955) (-426.296) -- 0:00:32
495000 -- [-424.477] (-424.376) (-425.142) (-427.608) * (-424.797) (-425.090) [-425.056] (-428.173) -- 0:00:32
Average standard deviation of split frequencies: 0.007247
495500 -- (-429.665) (-423.968) [-424.306] (-425.273) * (-424.572) (-425.555) (-424.147) [-425.952] -- 0:00:32
496000 -- (-430.441) [-425.711] (-426.456) (-424.977) * (-424.040) [-428.894] (-424.155) (-425.878) -- 0:00:32
496500 -- (-425.541) (-425.339) (-426.137) [-423.748] * (-425.058) [-425.668] (-425.735) (-423.950) -- 0:00:32
497000 -- (-426.484) [-423.832] (-426.604) (-428.163) * (-424.042) [-425.704] (-427.235) (-429.854) -- 0:00:32
497500 -- (-427.551) [-425.192] (-428.074) (-426.681) * (-424.165) (-426.809) [-425.570] (-428.101) -- 0:00:32
498000 -- (-425.871) (-425.333) [-425.618] (-426.346) * (-426.206) (-425.166) [-424.514] (-424.794) -- 0:00:32
498500 -- (-424.539) (-423.945) [-427.921] (-427.313) * (-428.161) [-425.389] (-425.601) (-424.902) -- 0:00:32
499000 -- [-424.291] (-425.488) (-425.210) (-428.165) * [-428.873] (-429.200) (-425.063) (-426.548) -- 0:00:32
499500 -- (-431.698) [-426.267] (-426.116) (-426.526) * (-425.131) (-425.595) (-425.225) [-423.866] -- 0:00:32
500000 -- (-428.411) (-423.962) [-427.515] (-428.107) * (-427.239) (-427.603) (-427.480) [-423.746] -- 0:00:32
Average standard deviation of split frequencies: 0.007179
500500 -- [-424.787] (-425.306) (-428.754) (-424.686) * (-425.383) [-425.944] (-426.433) (-424.735) -- 0:00:31
501000 -- [-426.026] (-425.606) (-425.160) (-425.223) * (-425.844) (-426.011) [-426.843] (-425.966) -- 0:00:31
501500 -- (-428.846) [-426.742] (-424.931) (-426.769) * (-425.359) (-430.848) (-426.747) [-424.369] -- 0:00:31
502000 -- (-427.741) (-426.399) [-425.037] (-424.022) * [-426.017] (-428.067) (-426.982) (-425.047) -- 0:00:31
502500 -- [-429.994] (-426.846) (-425.616) (-425.952) * (-425.974) (-424.706) (-424.747) [-424.927] -- 0:00:31
503000 -- (-427.560) (-424.684) [-428.980] (-428.291) * (-426.417) (-426.813) [-426.310] (-426.915) -- 0:00:31
503500 -- (-424.993) (-430.903) [-425.576] (-424.033) * (-426.386) (-427.313) (-428.857) [-424.501] -- 0:00:31
504000 -- (-426.371) (-430.446) [-425.233] (-424.112) * (-424.100) [-426.301] (-426.378) (-423.776) -- 0:00:31
504500 -- (-425.643) (-429.663) (-427.933) [-427.098] * [-423.821] (-423.607) (-426.609) (-425.821) -- 0:00:31
505000 -- [-424.661] (-427.086) (-427.297) (-426.125) * (-427.178) [-424.081] (-430.796) (-428.571) -- 0:00:31
Average standard deviation of split frequencies: 0.008111
505500 -- (-427.777) [-428.724] (-424.973) (-429.711) * (-427.554) [-427.455] (-426.969) (-427.196) -- 0:00:31
506000 -- (-425.073) [-428.586] (-426.187) (-428.568) * (-425.454) [-427.819] (-425.107) (-424.394) -- 0:00:31
506500 -- (-428.937) [-429.509] (-424.454) (-428.326) * [-425.440] (-423.725) (-423.799) (-427.254) -- 0:00:31
507000 -- (-427.904) (-425.235) [-424.258] (-426.836) * (-428.361) [-425.040] (-427.340) (-425.632) -- 0:00:31
507500 -- [-426.144] (-426.244) (-423.985) (-430.975) * (-430.238) (-424.140) [-425.872] (-425.757) -- 0:00:31
508000 -- (-426.109) (-427.393) (-423.432) [-426.957] * (-429.520) (-426.785) (-427.150) [-424.408] -- 0:00:31
508500 -- (-428.225) (-426.053) (-426.050) [-427.454] * [-427.721] (-428.528) (-425.143) (-425.993) -- 0:00:31
509000 -- [-427.503] (-430.408) (-424.662) (-427.130) * (-427.090) [-425.692] (-426.713) (-429.230) -- 0:00:31
509500 -- (-427.193) [-424.341] (-429.442) (-423.406) * (-425.534) [-423.752] (-426.089) (-426.686) -- 0:00:31
510000 -- (-428.048) (-424.149) (-426.146) [-423.660] * (-426.018) (-425.034) [-424.720] (-425.061) -- 0:00:31
Average standard deviation of split frequencies: 0.007819
510500 -- (-424.574) (-424.298) [-427.145] (-427.037) * (-426.290) (-428.211) (-428.104) [-424.290] -- 0:00:31
511000 -- (-427.634) (-424.759) (-424.954) [-425.848] * (-426.093) (-428.558) (-426.048) [-426.306] -- 0:00:31
511500 -- [-426.631] (-426.162) (-424.289) (-425.768) * (-425.219) (-424.138) (-426.777) [-424.813] -- 0:00:31
512000 -- (-424.796) (-424.723) [-424.927] (-430.999) * (-426.864) (-425.424) (-427.630) [-426.222] -- 0:00:31
512500 -- (-427.826) [-425.365] (-424.941) (-428.768) * (-425.690) (-424.318) [-425.887] (-427.854) -- 0:00:31
513000 -- (-425.159) (-429.676) (-425.295) [-424.742] * (-427.895) [-424.254] (-427.895) (-424.173) -- 0:00:31
513500 -- (-425.455) [-423.994] (-426.204) (-426.325) * (-429.492) [-424.506] (-424.530) (-423.961) -- 0:00:31
514000 -- (-435.676) (-424.561) (-425.821) [-424.247] * [-425.761] (-423.963) (-426.369) (-425.037) -- 0:00:31
514500 -- [-434.629] (-426.034) (-426.735) (-425.988) * (-425.837) [-423.924] (-430.512) (-425.400) -- 0:00:31
515000 -- [-427.936] (-429.570) (-426.073) (-426.078) * [-425.210] (-424.535) (-424.666) (-426.956) -- 0:00:31
Average standard deviation of split frequencies: 0.008760
515500 -- [-425.674] (-427.100) (-430.041) (-425.199) * (-425.106) (-426.821) (-424.430) [-423.782] -- 0:00:31
516000 -- (-428.237) (-424.906) [-428.096] (-426.839) * (-426.207) (-424.307) (-424.934) [-427.768] -- 0:00:30
516500 -- (-426.574) (-424.260) (-423.875) [-425.892] * (-427.907) (-426.345) (-427.663) [-427.395] -- 0:00:30
517000 -- (-424.351) (-425.463) (-424.085) [-428.507] * (-426.267) (-425.324) [-426.043] (-426.981) -- 0:00:30
517500 -- (-424.993) (-426.260) (-428.624) [-425.357] * (-424.114) (-425.280) [-425.816] (-425.235) -- 0:00:31
518000 -- [-427.709] (-426.124) (-423.634) (-427.926) * [-425.493] (-426.809) (-425.532) (-426.926) -- 0:00:31
518500 -- (-425.621) [-424.486] (-424.958) (-424.374) * (-425.944) (-426.264) (-425.639) [-424.993] -- 0:00:31
519000 -- (-426.066) (-426.262) (-425.928) [-424.095] * (-426.183) (-424.847) (-424.011) [-425.342] -- 0:00:31
519500 -- (-425.921) (-423.780) [-426.229] (-423.780) * (-426.251) (-425.941) (-424.739) [-424.453] -- 0:00:31
520000 -- (-427.756) (-430.722) [-424.601] (-426.664) * (-424.788) (-426.178) (-425.607) [-424.343] -- 0:00:31
Average standard deviation of split frequencies: 0.008947
520500 -- (-426.300) [-423.431] (-430.842) (-429.216) * (-425.816) [-424.743] (-424.398) (-434.482) -- 0:00:31
521000 -- (-426.064) (-423.421) [-423.709] (-429.064) * (-425.800) (-424.733) [-426.929] (-426.392) -- 0:00:31
521500 -- (-424.173) (-425.662) (-423.534) [-430.282] * (-425.939) (-425.010) (-425.203) [-425.558] -- 0:00:31
522000 -- (-424.851) (-426.764) (-423.975) [-429.544] * [-427.530] (-425.405) (-426.154) (-428.850) -- 0:00:31
522500 -- (-427.650) (-424.728) [-423.434] (-426.839) * [-423.663] (-424.676) (-428.070) (-427.963) -- 0:00:31
523000 -- (-425.898) [-424.683] (-427.685) (-427.107) * (-424.722) [-424.208] (-427.947) (-426.873) -- 0:00:31
523500 -- [-423.881] (-430.915) (-428.390) (-424.354) * (-425.858) [-427.168] (-425.927) (-425.082) -- 0:00:30
524000 -- (-423.587) (-425.984) (-426.183) [-424.834] * (-426.415) [-427.268] (-427.403) (-430.731) -- 0:00:30
524500 -- (-425.850) [-425.034] (-425.641) (-427.862) * (-426.710) (-425.900) [-425.317] (-428.303) -- 0:00:30
525000 -- (-425.318) [-426.426] (-426.896) (-426.560) * (-426.267) (-426.381) (-425.909) [-426.285] -- 0:00:30
Average standard deviation of split frequencies: 0.009067
525500 -- (-431.139) (-425.366) (-426.811) [-425.273] * [-426.082] (-426.255) (-427.555) (-425.842) -- 0:00:30
526000 -- (-424.422) (-427.055) (-426.454) [-424.205] * (-425.895) (-426.134) (-427.495) [-425.041] -- 0:00:30
526500 -- (-427.932) (-426.562) [-424.253] (-426.014) * (-432.831) (-424.872) [-426.069] (-426.483) -- 0:00:30
527000 -- (-424.690) [-424.292] (-424.970) (-429.018) * (-430.621) [-426.044] (-431.150) (-426.868) -- 0:00:30
527500 -- (-425.939) [-424.053] (-426.004) (-426.725) * (-425.694) (-427.662) [-424.826] (-429.437) -- 0:00:30
528000 -- (-425.437) (-425.333) [-427.636] (-424.195) * (-428.146) (-425.083) (-424.899) [-424.556] -- 0:00:30
528500 -- (-425.422) (-424.474) [-425.067] (-425.229) * [-424.872] (-426.238) (-425.894) (-426.647) -- 0:00:30
529000 -- (-426.989) (-425.144) [-425.323] (-426.639) * (-429.808) (-424.234) [-428.525] (-425.661) -- 0:00:30
529500 -- (-426.351) (-427.089) [-424.870] (-427.482) * (-426.846) [-423.784] (-428.471) (-425.602) -- 0:00:30
530000 -- (-424.939) [-424.742] (-425.819) (-428.785) * (-425.325) (-425.177) [-427.285] (-426.072) -- 0:00:30
Average standard deviation of split frequencies: 0.008413
530500 -- (-424.055) [-423.857] (-425.165) (-425.202) * [-427.635] (-425.030) (-424.137) (-425.822) -- 0:00:30
531000 -- (-432.480) (-425.889) [-425.387] (-428.002) * (-427.598) [-425.301] (-424.161) (-432.166) -- 0:00:30
531500 -- (-425.546) (-423.819) (-425.897) [-426.735] * [-428.116] (-424.160) (-426.380) (-424.507) -- 0:00:29
532000 -- (-427.900) [-425.084] (-425.044) (-425.304) * (-426.505) (-426.611) (-426.229) [-425.510] -- 0:00:29
532500 -- (-428.588) [-427.063] (-425.896) (-425.280) * (-424.221) (-426.610) [-426.168] (-424.554) -- 0:00:29
533000 -- (-424.543) (-428.429) (-424.422) [-425.684] * [-424.732] (-425.542) (-424.367) (-428.393) -- 0:00:29
533500 -- (-425.157) (-428.474) [-423.950] (-424.519) * (-426.100) (-425.447) [-424.143] (-427.294) -- 0:00:30
534000 -- [-426.319] (-423.440) (-425.171) (-424.031) * (-425.150) (-425.005) (-425.353) [-427.751] -- 0:00:30
534500 -- (-426.762) [-424.787] (-424.626) (-423.584) * (-425.743) [-425.735] (-427.224) (-425.518) -- 0:00:30
535000 -- [-427.170] (-425.036) (-427.330) (-423.732) * (-428.853) [-425.821] (-428.162) (-427.522) -- 0:00:30
Average standard deviation of split frequencies: 0.008640
535500 -- (-424.979) [-424.927] (-427.732) (-429.558) * (-430.839) (-427.701) [-424.287] (-425.742) -- 0:00:30
536000 -- [-425.384] (-423.753) (-429.158) (-429.751) * (-428.187) (-425.454) [-425.031] (-424.279) -- 0:00:30
536500 -- (-426.217) [-425.488] (-424.614) (-424.010) * (-431.018) (-424.722) (-426.613) [-424.100] -- 0:00:30
537000 -- (-429.615) [-423.814] (-424.622) (-424.047) * (-427.382) (-429.885) (-427.162) [-426.249] -- 0:00:30
537500 -- [-428.630] (-425.447) (-424.389) (-425.395) * (-425.009) (-425.121) (-427.785) [-425.506] -- 0:00:30
538000 -- [-424.743] (-424.185) (-424.422) (-423.799) * (-430.089) (-424.650) (-425.371) [-424.046] -- 0:00:30
538500 -- (-425.648) (-425.064) [-424.187] (-424.491) * [-428.804] (-428.161) (-424.691) (-424.311) -- 0:00:29
539000 -- (-426.285) (-427.158) [-424.692] (-423.917) * (-428.690) (-424.325) (-425.984) [-430.993] -- 0:00:29
539500 -- [-424.369] (-427.743) (-426.528) (-424.412) * (-423.673) (-425.030) (-424.287) [-429.164] -- 0:00:29
540000 -- (-423.908) (-427.995) (-423.762) [-426.802] * [-424.138] (-424.305) (-426.181) (-429.103) -- 0:00:29
Average standard deviation of split frequencies: 0.008463
540500 -- (-429.422) (-431.436) (-426.673) [-424.200] * (-424.478) (-426.463) (-426.508) [-424.898] -- 0:00:29
541000 -- (-425.561) (-431.918) [-426.015] (-424.496) * (-425.248) [-424.654] (-432.054) (-428.297) -- 0:00:29
541500 -- (-426.937) (-429.582) [-425.730] (-424.558) * (-424.786) (-428.406) (-424.275) [-425.345] -- 0:00:29
542000 -- (-424.545) (-425.607) (-426.617) [-425.622] * (-425.703) (-424.742) (-425.893) [-430.757] -- 0:00:29
542500 -- (-423.800) (-424.905) (-423.564) [-424.887] * (-426.133) [-425.141] (-433.442) (-425.001) -- 0:00:29
543000 -- (-428.754) (-427.496) (-424.932) [-425.391] * [-426.400] (-429.978) (-424.979) (-429.328) -- 0:00:29
543500 -- (-426.837) (-428.796) (-425.809) [-424.368] * (-426.247) (-426.292) (-430.433) [-425.809] -- 0:00:29
544000 -- (-433.529) (-424.354) [-425.193] (-426.160) * (-425.868) (-431.838) [-427.241] (-424.211) -- 0:00:29
544500 -- (-428.729) (-425.784) [-425.178] (-427.571) * (-427.698) [-426.657] (-425.598) (-426.451) -- 0:00:29
545000 -- (-426.230) [-426.042] (-428.559) (-428.888) * [-424.945] (-424.385) (-425.539) (-424.613) -- 0:00:29
Average standard deviation of split frequencies: 0.008177
545500 -- (-425.969) [-424.753] (-430.020) (-425.104) * (-424.544) [-425.286] (-426.958) (-424.467) -- 0:00:29
546000 -- (-425.864) [-426.577] (-427.095) (-425.510) * (-428.186) (-425.797) (-423.802) [-426.880] -- 0:00:29
546500 -- (-425.649) (-426.605) (-424.726) [-425.822] * (-425.465) (-427.052) [-424.610] (-427.978) -- 0:00:29
547000 -- [-426.492] (-424.232) (-425.564) (-427.501) * [-425.726] (-423.844) (-424.638) (-424.734) -- 0:00:28
547500 -- (-424.802) (-428.866) (-427.748) [-424.886] * (-426.154) (-426.264) [-425.267] (-426.626) -- 0:00:28
548000 -- (-428.541) (-427.164) [-424.397] (-424.555) * (-425.030) (-428.668) (-424.070) [-425.022] -- 0:00:28
548500 -- [-424.304] (-423.903) (-424.642) (-427.028) * (-432.425) (-426.129) (-424.176) [-424.864] -- 0:00:28
549000 -- (-426.666) [-425.122] (-425.273) (-427.182) * (-425.427) [-425.436] (-423.595) (-426.084) -- 0:00:28
549500 -- (-424.690) [-424.970] (-425.653) (-427.503) * [-426.394] (-425.509) (-424.632) (-424.015) -- 0:00:28
550000 -- (-430.109) [-424.534] (-425.902) (-425.924) * (-426.013) [-425.477] (-424.474) (-424.534) -- 0:00:28
Average standard deviation of split frequencies: 0.008611
550500 -- (-425.689) [-424.309] (-428.262) (-426.664) * (-426.162) (-424.575) (-423.435) [-424.901] -- 0:00:29
551000 -- [-427.325] (-425.518) (-425.074) (-429.025) * (-428.482) [-424.673] (-425.642) (-426.334) -- 0:00:29
551500 -- (-426.870) (-426.428) [-424.653] (-423.802) * [-425.508] (-426.817) (-425.623) (-426.236) -- 0:00:29
552000 -- (-424.958) (-425.988) (-425.417) [-423.765] * (-424.587) (-427.344) [-423.550] (-428.173) -- 0:00:29
552500 -- (-430.337) (-426.346) (-424.766) [-424.476] * (-424.216) (-429.855) (-428.851) [-425.956] -- 0:00:29
553000 -- (-427.021) [-424.743] (-428.854) (-424.175) * [-424.508] (-426.374) (-429.332) (-427.436) -- 0:00:29
553500 -- [-427.563] (-426.051) (-427.460) (-424.673) * (-424.880) [-427.953] (-424.885) (-426.102) -- 0:00:29
554000 -- (-427.627) [-425.504] (-427.288) (-424.281) * (-425.351) (-424.258) (-424.981) [-425.815] -- 0:00:28
554500 -- (-426.312) [-427.652] (-429.013) (-425.849) * (-429.753) (-424.081) [-425.866] (-424.725) -- 0:00:28
555000 -- (-425.168) (-426.669) (-424.687) [-427.018] * [-425.186] (-425.521) (-425.913) (-428.419) -- 0:00:28
Average standard deviation of split frequencies: 0.007737
555500 -- [-427.080] (-428.041) (-424.065) (-424.216) * [-425.293] (-424.760) (-431.813) (-426.047) -- 0:00:28
556000 -- (-427.297) (-428.031) [-424.130] (-427.380) * (-425.724) [-427.395] (-425.398) (-428.019) -- 0:00:28
556500 -- (-427.694) (-425.245) [-424.302] (-429.561) * (-424.859) [-424.023] (-426.103) (-427.136) -- 0:00:28
557000 -- (-424.774) (-426.490) [-424.814] (-425.188) * (-425.598) (-428.277) (-426.575) [-426.544] -- 0:00:28
557500 -- (-424.936) (-426.430) (-424.098) [-424.873] * (-424.140) (-423.938) [-426.046] (-433.269) -- 0:00:28
558000 -- [-426.491] (-428.050) (-426.042) (-425.181) * [-425.928] (-435.424) (-423.901) (-432.838) -- 0:00:28
558500 -- (-427.871) (-423.898) (-424.493) [-424.518] * (-428.302) (-430.383) [-424.495] (-428.229) -- 0:00:28
559000 -- (-426.373) [-427.115] (-423.529) (-425.537) * (-423.874) (-426.380) [-425.350] (-430.459) -- 0:00:28
559500 -- (-424.584) [-426.238] (-423.636) (-424.734) * (-426.211) (-426.903) [-425.400] (-427.211) -- 0:00:28
560000 -- [-427.952] (-426.741) (-425.018) (-429.122) * [-427.097] (-428.471) (-425.954) (-425.285) -- 0:00:28
Average standard deviation of split frequencies: 0.007725
560500 -- (-426.246) [-427.266] (-424.114) (-428.393) * (-426.841) [-426.329] (-426.423) (-427.358) -- 0:00:28
561000 -- (-426.330) [-425.782] (-424.454) (-426.524) * [-429.052] (-426.374) (-424.706) (-426.887) -- 0:00:28
561500 -- (-429.055) (-424.323) (-426.780) [-426.340] * (-424.813) (-426.448) (-424.331) [-426.670] -- 0:00:28
562000 -- (-427.047) (-431.896) (-426.115) [-424.069] * (-425.887) (-425.661) [-424.100] (-424.954) -- 0:00:28
562500 -- (-425.395) (-424.704) (-427.535) [-424.933] * (-426.797) [-425.699] (-424.514) (-424.385) -- 0:00:28
563000 -- (-424.065) (-424.313) (-424.541) [-423.655] * [-425.112] (-425.503) (-424.715) (-424.197) -- 0:00:27
563500 -- (-425.387) (-428.312) (-426.500) [-423.367] * (-425.385) [-426.574] (-424.399) (-427.106) -- 0:00:27
564000 -- (-425.804) [-426.957] (-427.361) (-426.687) * (-426.182) (-427.206) (-426.914) [-425.645] -- 0:00:27
564500 -- [-425.301] (-428.663) (-428.667) (-426.569) * (-424.815) (-426.464) (-425.511) [-428.127] -- 0:00:27
565000 -- (-424.572) (-424.773) [-429.209] (-425.707) * (-425.317) [-426.020] (-423.698) (-424.732) -- 0:00:27
Average standard deviation of split frequencies: 0.008427
565500 -- (-426.263) (-425.151) (-425.028) [-430.772] * [-425.054] (-428.282) (-426.197) (-428.068) -- 0:00:27
566000 -- [-424.842] (-425.512) (-426.198) (-427.064) * (-426.360) (-426.147) [-426.355] (-424.844) -- 0:00:27
566500 -- (-425.816) (-424.517) [-427.651] (-425.895) * (-425.579) (-425.535) (-424.334) [-424.637] -- 0:00:27
567000 -- [-423.953] (-425.567) (-426.050) (-424.460) * (-426.506) (-426.887) (-424.553) [-424.106] -- 0:00:27
567500 -- (-424.323) [-427.675] (-426.048) (-424.126) * [-426.781] (-430.040) (-426.590) (-424.571) -- 0:00:27
568000 -- (-429.581) [-427.886] (-424.262) (-426.224) * (-425.060) [-423.382] (-429.222) (-424.002) -- 0:00:28
568500 -- (-427.533) [-430.319] (-424.313) (-427.005) * [-426.056] (-424.210) (-426.256) (-425.607) -- 0:00:28
569000 -- (-426.312) [-427.669] (-424.181) (-425.826) * (-424.915) (-426.938) (-424.966) [-428.094] -- 0:00:28
569500 -- (-424.245) (-425.513) [-424.417] (-424.451) * (-426.974) (-426.440) (-424.515) [-425.304] -- 0:00:27
570000 -- (-425.829) (-424.537) [-426.754] (-428.459) * [-426.540] (-425.151) (-429.896) (-425.683) -- 0:00:27
Average standard deviation of split frequencies: 0.008212
570500 -- (-430.703) [-426.684] (-425.841) (-430.180) * (-426.487) [-426.957] (-426.192) (-424.797) -- 0:00:27
571000 -- (-426.649) [-424.640] (-424.098) (-426.588) * [-426.750] (-424.110) (-425.651) (-425.568) -- 0:00:27
571500 -- (-424.035) (-428.222) (-423.590) [-427.646] * (-426.418) (-424.934) [-423.669] (-426.546) -- 0:00:27
572000 -- (-426.963) (-425.022) (-424.523) [-426.724] * (-425.535) [-424.410] (-424.235) (-426.397) -- 0:00:27
572500 -- (-426.593) (-424.800) [-423.974] (-425.261) * (-425.480) (-424.155) [-427.111] (-425.841) -- 0:00:27
573000 -- [-426.177] (-424.872) (-425.130) (-424.943) * (-423.991) (-425.835) [-424.178] (-424.548) -- 0:00:27
573500 -- (-425.879) (-424.709) (-425.394) [-423.839] * (-425.880) (-424.973) [-426.030] (-427.851) -- 0:00:27
574000 -- (-426.197) [-425.092] (-425.447) (-425.356) * (-426.241) [-426.688] (-426.838) (-427.102) -- 0:00:27
574500 -- (-426.062) (-425.740) (-427.601) [-424.450] * [-427.486] (-427.005) (-425.984) (-427.427) -- 0:00:27
575000 -- (-427.429) (-425.140) (-423.548) [-426.310] * (-428.443) [-427.619] (-426.908) (-424.695) -- 0:00:27
Average standard deviation of split frequencies: 0.007417
575500 -- (-430.143) (-427.917) [-426.325] (-424.214) * (-425.749) [-424.425] (-424.685) (-425.858) -- 0:00:27
576000 -- (-428.497) (-426.568) [-424.579] (-423.722) * [-426.408] (-425.680) (-427.648) (-425.352) -- 0:00:27
576500 -- (-428.644) [-425.550] (-424.442) (-425.288) * (-424.798) [-424.702] (-425.696) (-426.836) -- 0:00:27
577000 -- (-424.475) [-428.140] (-429.468) (-425.104) * (-424.126) (-424.224) [-423.779] (-425.463) -- 0:00:27
577500 -- (-424.748) (-424.615) (-426.643) [-426.365] * [-424.626] (-425.364) (-425.840) (-427.016) -- 0:00:27
578000 -- (-427.669) [-426.639] (-429.290) (-426.952) * (-425.634) [-425.339] (-426.917) (-426.946) -- 0:00:27
578500 -- (-427.850) (-425.600) (-426.427) [-424.364] * [-426.512] (-425.203) (-424.377) (-432.888) -- 0:00:26
579000 -- (-423.842) [-426.293] (-424.779) (-424.852) * (-429.694) (-427.064) [-424.237] (-428.778) -- 0:00:26
579500 -- (-425.737) [-426.156] (-425.406) (-424.289) * (-426.489) [-423.629] (-428.752) (-428.555) -- 0:00:26
580000 -- (-425.579) (-428.580) (-428.662) [-426.571] * (-427.552) [-423.627] (-427.162) (-427.839) -- 0:00:26
Average standard deviation of split frequencies: 0.006850
580500 -- (-427.985) [-424.497] (-426.203) (-425.562) * (-426.967) (-425.814) [-427.331] (-426.342) -- 0:00:26
581000 -- (-428.757) (-425.167) [-426.842] (-426.135) * (-424.509) (-427.280) (-425.390) [-427.792] -- 0:00:26
581500 -- [-426.007] (-425.206) (-424.593) (-425.211) * (-428.878) (-424.985) (-427.168) [-427.720] -- 0:00:26
582000 -- (-428.228) [-424.308] (-424.781) (-427.298) * [-425.451] (-427.361) (-428.362) (-424.166) -- 0:00:26
582500 -- [-429.716] (-426.777) (-425.958) (-427.686) * (-424.261) [-425.764] (-425.507) (-424.011) -- 0:00:26
583000 -- (-425.416) (-426.324) [-425.737] (-427.695) * [-425.643] (-426.854) (-425.852) (-424.846) -- 0:00:26
583500 -- (-425.167) [-427.044] (-426.022) (-424.998) * (-425.578) (-425.706) (-426.279) [-424.496] -- 0:00:26
584000 -- [-424.397] (-426.963) (-425.369) (-424.732) * (-428.266) (-428.901) (-428.384) [-423.909] -- 0:00:26
584500 -- (-423.826) (-424.698) [-423.975] (-424.386) * [-426.863] (-429.154) (-426.930) (-424.916) -- 0:00:26
585000 -- [-423.957] (-424.614) (-428.636) (-425.337) * [-426.408] (-424.844) (-425.825) (-426.178) -- 0:00:26
Average standard deviation of split frequencies: 0.006385
585500 -- (-425.286) (-424.850) [-424.597] (-428.411) * (-424.321) (-428.066) (-425.182) [-425.407] -- 0:00:26
586000 -- (-427.863) [-425.022] (-428.002) (-428.652) * (-426.153) [-427.155] (-426.358) (-428.437) -- 0:00:26
586500 -- (-430.100) [-427.305] (-426.512) (-428.716) * (-424.690) (-426.958) [-424.522] (-426.027) -- 0:00:26
587000 -- (-426.153) (-426.565) [-424.802] (-425.919) * (-424.143) [-425.483] (-427.491) (-425.019) -- 0:00:26
587500 -- (-425.161) [-425.370] (-427.116) (-429.426) * (-425.285) (-428.034) [-425.543] (-426.272) -- 0:00:26
588000 -- [-423.882] (-424.780) (-429.421) (-431.306) * (-428.145) (-424.620) (-425.571) [-426.357] -- 0:00:26
588500 -- (-425.331) [-423.842] (-427.835) (-426.329) * (-426.457) (-425.499) [-425.561] (-426.621) -- 0:00:26
589000 -- (-425.634) [-425.255] (-426.881) (-426.594) * (-428.266) (-425.910) (-425.294) [-424.402] -- 0:00:26
589500 -- [-425.254] (-425.576) (-424.726) (-424.629) * (-424.114) [-427.879] (-425.721) (-424.680) -- 0:00:26
590000 -- (-426.179) (-423.605) [-426.029] (-426.358) * (-425.616) [-424.068] (-425.080) (-432.052) -- 0:00:26
Average standard deviation of split frequencies: 0.005637
590500 -- (-424.656) (-423.979) (-429.724) [-424.652] * (-427.414) [-426.707] (-426.034) (-425.735) -- 0:00:26
591000 -- (-426.232) (-426.551) [-424.042] (-425.650) * [-423.959] (-427.493) (-428.102) (-427.188) -- 0:00:26
591500 -- (-424.917) (-423.692) [-426.131] (-425.490) * (-424.424) (-425.654) [-424.996] (-426.550) -- 0:00:26
592000 -- (-427.974) (-424.566) [-426.099] (-424.312) * (-425.954) (-427.763) (-425.691) [-424.654] -- 0:00:26
592500 -- (-426.088) (-425.267) (-425.403) [-425.382] * (-425.015) [-424.049] (-425.154) (-424.267) -- 0:00:26
593000 -- (-424.275) (-426.789) [-423.659] (-423.848) * (-427.152) (-425.773) (-428.682) [-424.152] -- 0:00:26
593500 -- (-425.055) (-425.577) (-424.738) [-425.047] * (-426.208) [-423.718] (-425.087) (-425.901) -- 0:00:26
594000 -- (-425.141) (-427.537) [-426.015] (-427.112) * (-425.656) [-429.371] (-425.623) (-424.998) -- 0:00:25
594500 -- (-424.139) (-423.948) (-424.223) [-425.097] * (-426.822) (-427.709) [-431.173] (-425.863) -- 0:00:25
595000 -- [-423.936] (-424.537) (-425.866) (-425.197) * (-424.499) (-423.696) (-430.363) [-427.207] -- 0:00:25
Average standard deviation of split frequencies: 0.005537
595500 -- (-425.140) [-424.160] (-426.384) (-425.561) * (-423.846) [-425.018] (-424.727) (-430.588) -- 0:00:25
596000 -- (-424.237) [-426.611] (-423.722) (-426.602) * (-424.347) (-424.589) (-427.038) [-426.264] -- 0:00:25
596500 -- [-424.882] (-429.672) (-430.663) (-428.756) * (-426.208) [-426.831] (-424.692) (-426.000) -- 0:00:25
597000 -- (-424.916) (-429.779) [-429.722] (-431.604) * (-425.420) (-427.113) [-423.899] (-426.199) -- 0:00:25
597500 -- (-426.431) (-424.095) [-426.195] (-431.306) * [-426.033] (-424.323) (-425.551) (-427.773) -- 0:00:25
598000 -- (-426.843) (-425.602) (-429.047) [-430.126] * (-429.824) [-423.592] (-426.059) (-431.445) -- 0:00:25
598500 -- (-426.980) (-425.544) [-426.392] (-424.491) * (-428.631) (-424.090) (-425.691) [-425.340] -- 0:00:25
599000 -- (-425.980) (-424.069) (-425.878) [-424.351] * (-427.512) (-425.979) (-425.573) [-425.905] -- 0:00:25
599500 -- (-425.276) (-424.680) [-426.209] (-424.710) * (-427.220) (-428.925) [-425.770] (-424.504) -- 0:00:25
600000 -- (-424.570) [-427.352] (-424.909) (-427.647) * [-424.665] (-429.077) (-428.194) (-426.106) -- 0:00:25
Average standard deviation of split frequencies: 0.005543
600500 -- (-426.154) (-425.779) (-424.293) [-424.819] * [-424.042] (-426.447) (-431.534) (-427.614) -- 0:00:25
601000 -- (-424.998) (-428.153) [-423.815] (-425.036) * (-425.016) [-425.865] (-424.875) (-425.570) -- 0:00:25
601500 -- (-427.245) (-426.155) [-425.566] (-424.882) * (-425.151) [-426.255] (-423.983) (-427.604) -- 0:00:25
602000 -- (-428.498) [-425.244] (-424.910) (-424.744) * [-426.562] (-429.206) (-425.812) (-426.135) -- 0:00:25
602500 -- (-424.262) (-427.386) [-424.623] (-426.018) * (-425.389) (-429.595) [-424.411] (-424.557) -- 0:00:25
603000 -- (-427.368) [-426.283] (-425.686) (-424.177) * (-426.004) (-425.394) (-424.595) [-428.402] -- 0:00:25
603500 -- (-426.154) (-426.088) [-425.217] (-425.316) * (-425.664) (-425.090) [-425.594] (-424.847) -- 0:00:25
604000 -- [-424.986] (-428.176) (-423.797) (-426.154) * [-429.186] (-427.709) (-427.689) (-423.727) -- 0:00:25
604500 -- (-426.761) [-424.108] (-423.776) (-424.404) * (-424.264) (-426.879) [-427.593] (-425.652) -- 0:00:25
605000 -- (-424.876) [-427.380] (-424.545) (-426.193) * (-424.004) (-425.403) (-427.929) [-425.829] -- 0:00:25
Average standard deviation of split frequencies: 0.004667
605500 -- (-430.058) (-430.624) [-424.311] (-424.273) * (-427.341) (-426.222) (-424.505) [-430.565] -- 0:00:25
606000 -- (-427.068) (-426.463) [-425.664] (-425.962) * (-424.823) (-424.974) (-424.424) [-426.275] -- 0:00:25
606500 -- [-425.620] (-427.371) (-425.577) (-424.961) * (-426.198) [-429.588] (-427.935) (-428.249) -- 0:00:25
607000 -- (-425.341) [-425.687] (-426.064) (-425.999) * [-426.132] (-426.094) (-426.730) (-425.741) -- 0:00:25
607500 -- (-426.078) (-425.097) (-424.229) [-423.704] * (-425.200) (-427.933) [-425.037] (-423.644) -- 0:00:25
608000 -- [-425.284] (-425.258) (-426.350) (-425.978) * (-425.602) (-424.246) (-424.904) [-426.379] -- 0:00:25
608500 -- (-424.862) (-426.444) [-425.714] (-424.048) * [-427.041] (-425.623) (-424.312) (-424.825) -- 0:00:25
609000 -- (-425.287) (-424.788) [-426.946] (-424.069) * [-426.315] (-429.134) (-424.561) (-423.994) -- 0:00:25
609500 -- (-425.489) (-425.848) (-427.050) [-424.210] * (-424.860) [-428.482] (-424.152) (-423.845) -- 0:00:24
610000 -- [-427.974] (-426.957) (-426.061) (-426.002) * (-426.669) (-426.033) (-426.398) [-426.156] -- 0:00:24
Average standard deviation of split frequencies: 0.004969
610500 -- (-430.401) (-425.210) (-427.092) [-424.000] * (-424.841) (-425.866) [-425.242] (-430.890) -- 0:00:24
611000 -- (-425.281) (-424.761) [-425.282] (-425.474) * (-427.048) (-424.888) (-425.058) [-424.630] -- 0:00:24
611500 -- (-425.102) [-425.269] (-430.250) (-425.303) * [-427.521] (-428.272) (-425.779) (-428.412) -- 0:00:24
612000 -- [-424.658] (-426.222) (-425.601) (-426.826) * (-424.009) (-427.284) (-426.519) [-424.617] -- 0:00:24
612500 -- (-424.826) (-425.054) (-425.516) [-426.609] * (-427.146) (-425.193) (-426.745) [-426.175] -- 0:00:24
613000 -- (-424.299) [-426.621] (-426.790) (-428.654) * (-424.947) [-424.041] (-427.585) (-425.278) -- 0:00:24
613500 -- (-426.487) (-428.445) [-430.418] (-427.125) * [-424.023] (-427.398) (-425.812) (-427.772) -- 0:00:24
614000 -- (-424.057) (-425.357) (-424.620) [-425.418] * (-423.692) (-426.608) [-427.920] (-435.653) -- 0:00:24
614500 -- [-423.796] (-425.850) (-425.153) (-425.886) * (-429.843) (-426.812) (-428.215) [-424.958] -- 0:00:24
615000 -- (-424.540) (-424.228) (-424.162) [-427.947] * (-425.591) (-425.256) (-424.991) [-426.598] -- 0:00:24
Average standard deviation of split frequencies: 0.005548
615500 -- (-424.933) [-423.835] (-427.962) (-425.735) * (-427.935) (-428.855) (-424.084) [-430.677] -- 0:00:24
616000 -- (-426.128) (-425.695) (-425.256) [-426.452] * (-431.103) [-428.452] (-425.675) (-429.328) -- 0:00:24
616500 -- (-425.102) [-426.109] (-428.724) (-425.218) * (-429.056) (-427.305) [-425.471] (-424.290) -- 0:00:24
617000 -- (-426.713) (-428.707) (-426.198) [-425.813] * (-423.621) (-424.749) (-427.536) [-424.573] -- 0:00:24
617500 -- [-425.256] (-428.999) (-425.127) (-429.666) * (-424.575) (-425.958) (-425.491) [-424.540] -- 0:00:24
618000 -- (-426.297) (-425.384) [-424.595] (-427.283) * (-426.277) (-425.495) (-424.052) [-425.042] -- 0:00:24
618500 -- (-426.686) (-424.414) (-427.748) [-424.894] * [-425.517] (-427.704) (-423.903) (-427.916) -- 0:00:24
619000 -- (-431.620) (-424.873) (-424.274) [-425.256] * (-425.883) (-427.272) (-425.711) [-424.559] -- 0:00:24
619500 -- (-428.961) (-433.878) [-425.003] (-426.695) * (-429.288) (-424.715) [-428.810] (-426.619) -- 0:00:24
620000 -- (-424.989) [-427.751] (-425.573) (-424.967) * [-424.530] (-424.422) (-430.337) (-425.506) -- 0:00:24
Average standard deviation of split frequencies: 0.005696
620500 -- [-424.595] (-430.340) (-427.368) (-431.256) * (-427.745) (-430.070) (-430.782) [-424.510] -- 0:00:24
621000 -- (-424.616) (-427.064) [-425.758] (-430.569) * (-427.122) [-426.108] (-426.689) (-429.069) -- 0:00:24
621500 -- [-425.071] (-427.372) (-426.051) (-429.307) * (-424.435) (-427.235) [-427.911] (-428.713) -- 0:00:24
622000 -- (-427.206) [-430.322] (-426.568) (-424.902) * (-425.504) (-428.541) (-425.622) [-426.937] -- 0:00:24
622500 -- (-427.394) (-433.450) (-427.163) [-424.425] * (-425.855) (-429.656) (-424.702) [-426.566] -- 0:00:24
623000 -- (-423.777) (-429.802) (-429.080) [-428.728] * (-428.385) [-425.091] (-425.553) (-426.506) -- 0:00:24
623500 -- [-425.722] (-424.780) (-426.212) (-427.247) * (-424.146) [-424.895] (-428.439) (-424.623) -- 0:00:24
624000 -- (-425.400) [-426.598] (-431.432) (-425.666) * (-427.282) [-424.686] (-432.092) (-426.052) -- 0:00:24
624500 -- [-424.506] (-424.068) (-428.323) (-430.012) * (-425.568) [-424.547] (-428.484) (-424.830) -- 0:00:24
625000 -- (-425.047) [-426.290] (-426.529) (-425.325) * (-424.149) [-423.997] (-433.859) (-429.159) -- 0:00:24
Average standard deviation of split frequencies: 0.005271
625500 -- (-426.338) (-427.629) [-424.178] (-427.638) * (-424.120) (-426.232) (-428.016) [-427.838] -- 0:00:23
626000 -- (-425.071) (-433.933) (-427.560) [-424.613] * (-427.004) (-424.951) [-424.348] (-431.786) -- 0:00:23
626500 -- (-429.190) [-425.231] (-424.741) (-424.295) * (-425.663) (-426.761) [-428.299] (-425.862) -- 0:00:23
627000 -- (-429.876) (-426.031) (-425.642) [-426.064] * (-424.372) [-423.736] (-432.417) (-424.547) -- 0:00:23
627500 -- [-426.353] (-429.650) (-426.948) (-423.504) * (-424.355) (-424.377) (-425.373) [-425.817] -- 0:00:23
628000 -- (-423.809) [-424.253] (-425.549) (-423.752) * (-424.524) (-425.107) (-426.075) [-427.844] -- 0:00:23
628500 -- (-425.245) (-427.515) [-425.137] (-423.757) * (-427.066) [-427.947] (-424.633) (-423.875) -- 0:00:23
629000 -- (-424.610) (-428.635) [-425.665] (-430.507) * (-425.955) (-426.674) (-424.739) [-423.813] -- 0:00:23
629500 -- [-424.395] (-425.715) (-425.415) (-427.080) * (-425.935) [-423.948] (-425.412) (-426.250) -- 0:00:23
630000 -- (-424.881) (-426.018) [-427.086] (-424.693) * [-425.674] (-425.838) (-423.802) (-424.242) -- 0:00:23
Average standard deviation of split frequencies: 0.005279
630500 -- (-425.574) (-428.323) (-426.283) [-427.145] * (-425.469) [-426.652] (-424.134) (-427.416) -- 0:00:23
631000 -- (-424.413) [-425.805] (-424.191) (-425.002) * (-441.342) [-424.900] (-424.672) (-425.767) -- 0:00:23
631500 -- [-426.853] (-424.650) (-423.895) (-426.989) * (-428.367) [-425.748] (-425.535) (-426.387) -- 0:00:23
632000 -- (-426.782) (-424.780) [-425.825] (-428.215) * (-425.934) (-424.559) [-425.010] (-427.857) -- 0:00:23
632500 -- (-427.270) [-423.926] (-426.288) (-428.054) * (-424.577) (-424.583) [-426.806] (-425.308) -- 0:00:23
633000 -- (-428.759) [-425.551] (-428.152) (-425.201) * (-424.531) (-425.529) [-427.843] (-426.479) -- 0:00:23
633500 -- (-427.163) (-425.380) (-425.826) [-426.802] * [-423.896] (-428.193) (-426.239) (-426.437) -- 0:00:23
634000 -- (-427.657) [-425.813] (-427.009) (-427.097) * (-425.852) (-425.466) [-424.752] (-430.688) -- 0:00:23
634500 -- [-426.285] (-424.051) (-425.027) (-431.100) * (-425.636) (-426.075) (-424.639) [-424.984] -- 0:00:23
635000 -- (-424.122) (-425.088) [-424.640] (-425.562) * (-424.381) (-431.750) (-425.602) [-425.354] -- 0:00:22
Average standard deviation of split frequencies: 0.006393
635500 -- (-427.228) (-425.020) [-427.755] (-428.315) * (-423.797) (-426.070) [-426.336] (-427.150) -- 0:00:22
636000 -- (-424.109) (-426.309) (-427.964) [-425.761] * (-425.178) [-425.163] (-428.881) (-424.144) -- 0:00:22
636500 -- (-423.589) [-426.729] (-426.977) (-429.703) * (-428.249) (-424.222) (-428.312) [-425.438] -- 0:00:22
637000 -- [-424.680] (-425.022) (-424.030) (-427.946) * (-426.790) (-426.040) (-427.766) [-424.284] -- 0:00:23
637500 -- (-423.882) (-425.881) (-426.688) [-425.497] * [-425.665] (-426.037) (-426.450) (-425.217) -- 0:00:23
638000 -- (-425.701) [-426.022] (-425.836) (-424.693) * (-425.619) [-424.275] (-426.514) (-426.325) -- 0:00:23
638500 -- [-425.282] (-432.198) (-429.892) (-428.203) * (-425.332) (-425.534) [-426.665] (-424.945) -- 0:00:23
639000 -- [-426.806] (-428.723) (-427.982) (-429.419) * (-424.883) (-425.554) (-426.286) [-425.275] -- 0:00:23
639500 -- (-433.013) [-425.059] (-425.167) (-426.191) * (-426.006) (-423.958) [-426.458] (-425.182) -- 0:00:23
640000 -- (-428.339) (-426.078) [-426.153] (-426.681) * (-427.346) (-428.262) [-425.470] (-426.698) -- 0:00:23
Average standard deviation of split frequencies: 0.006760
640500 -- [-424.890] (-424.611) (-425.865) (-427.986) * (-426.472) (-424.807) (-424.706) [-424.539] -- 0:00:23
641000 -- (-427.212) (-425.199) [-425.434] (-427.036) * (-424.582) (-426.474) (-424.875) [-425.174] -- 0:00:22
641500 -- (-424.753) (-426.119) [-426.255] (-423.886) * [-424.061] (-428.251) (-426.400) (-426.351) -- 0:00:22
642000 -- (-428.856) [-423.902] (-426.265) (-427.248) * (-424.882) (-428.118) (-424.759) [-426.714] -- 0:00:22
642500 -- (-428.313) [-428.434] (-426.096) (-426.325) * [-424.984] (-428.144) (-424.628) (-423.935) -- 0:00:22
643000 -- (-425.861) [-427.337] (-425.197) (-429.344) * (-424.588) (-429.211) [-425.086] (-425.539) -- 0:00:22
643500 -- [-424.653] (-430.033) (-426.783) (-425.506) * [-429.131] (-426.621) (-426.328) (-425.270) -- 0:00:22
644000 -- (-424.291) [-425.636] (-429.501) (-424.728) * (-425.975) [-426.292] (-425.052) (-425.578) -- 0:00:22
644500 -- (-425.198) [-425.341] (-426.611) (-424.618) * (-424.237) [-425.315] (-427.679) (-424.452) -- 0:00:22
645000 -- (-427.534) (-424.575) (-424.238) [-426.379] * (-424.564) (-426.495) (-424.934) [-425.644] -- 0:00:22
Average standard deviation of split frequencies: 0.006932
645500 -- (-429.245) [-425.583] (-424.234) (-425.275) * (-425.869) (-429.368) [-425.166] (-427.587) -- 0:00:22
646000 -- [-426.444] (-424.962) (-427.635) (-425.076) * (-425.295) (-429.250) (-425.336) [-426.542] -- 0:00:22
646500 -- [-424.315] (-428.512) (-424.886) (-426.671) * (-424.920) (-426.750) (-425.909) [-426.975] -- 0:00:22
647000 -- (-427.550) (-427.598) [-429.934] (-426.501) * (-425.785) (-426.842) (-429.443) [-424.886] -- 0:00:22
647500 -- (-427.074) [-429.319] (-425.041) (-427.540) * (-426.973) [-425.713] (-425.273) (-425.961) -- 0:00:22
648000 -- (-427.125) (-426.875) [-426.552] (-426.020) * (-425.555) [-423.779] (-424.382) (-424.678) -- 0:00:22
648500 -- (-424.534) (-424.004) [-426.566] (-426.109) * [-425.056] (-424.118) (-426.290) (-426.427) -- 0:00:22
649000 -- [-424.175] (-424.986) (-427.322) (-434.705) * (-424.703) (-426.719) [-427.577] (-428.783) -- 0:00:22
649500 -- (-425.172) [-423.879] (-425.588) (-428.550) * (-424.960) (-426.705) [-428.097] (-426.628) -- 0:00:22
650000 -- (-426.844) (-425.242) [-423.806] (-427.696) * [-428.347] (-424.167) (-427.331) (-427.360) -- 0:00:22
Average standard deviation of split frequencies: 0.007154
650500 -- (-427.317) (-424.499) [-430.772] (-424.420) * [-425.901] (-424.243) (-425.772) (-426.629) -- 0:00:22
651000 -- (-424.958) [-425.199] (-423.635) (-426.168) * (-424.073) [-425.660] (-428.658) (-425.328) -- 0:00:21
651500 -- (-425.213) [-428.514] (-425.984) (-425.800) * (-424.729) [-423.432] (-432.076) (-426.076) -- 0:00:21
652000 -- (-427.442) (-429.430) [-424.160] (-424.745) * (-425.016) (-424.570) [-430.226] (-426.504) -- 0:00:21
652500 -- (-426.718) [-425.427] (-426.255) (-423.909) * [-425.026] (-424.196) (-425.131) (-431.745) -- 0:00:21
653000 -- [-426.545] (-424.064) (-429.092) (-426.481) * (-428.555) (-427.694) [-424.582] (-425.701) -- 0:00:21
653500 -- (-427.646) (-424.142) (-428.241) [-426.402] * (-432.094) [-426.842] (-427.631) (-430.164) -- 0:00:21
654000 -- [-426.616] (-427.228) (-424.695) (-425.975) * (-430.140) (-425.217) (-425.309) [-429.014] -- 0:00:22
654500 -- (-426.334) (-427.855) (-424.712) [-426.731] * (-429.211) (-427.084) [-427.111] (-425.159) -- 0:00:22
655000 -- [-425.420] (-427.045) (-427.679) (-425.761) * [-426.237] (-424.863) (-427.845) (-426.574) -- 0:00:22
Average standard deviation of split frequencies: 0.007186
655500 -- (-429.200) (-426.352) (-424.263) [-427.300] * [-424.569] (-427.298) (-425.797) (-426.210) -- 0:00:22
656000 -- (-425.202) [-426.701] (-423.894) (-424.372) * (-425.595) (-427.560) (-425.192) [-425.908] -- 0:00:22
656500 -- (-424.582) (-425.892) (-424.655) [-424.311] * [-424.723] (-427.235) (-424.966) (-425.074) -- 0:00:21
657000 -- [-427.865] (-424.161) (-424.457) (-426.343) * [-425.390] (-424.533) (-429.086) (-424.983) -- 0:00:21
657500 -- (-429.798) (-424.566) (-424.363) [-424.983] * (-424.324) (-425.534) (-432.599) [-424.454] -- 0:00:21
658000 -- (-427.762) (-423.796) [-424.697] (-427.210) * (-424.510) (-425.526) [-424.516] (-424.320) -- 0:00:21
658500 -- (-425.074) [-425.332] (-424.296) (-424.251) * (-424.142) (-426.017) (-426.824) [-424.174] -- 0:00:21
659000 -- [-425.181] (-424.727) (-425.343) (-425.052) * (-426.651) (-426.329) (-424.662) [-425.656] -- 0:00:21
659500 -- (-424.499) (-424.378) (-425.742) [-426.019] * (-426.146) [-424.906] (-426.551) (-426.166) -- 0:00:21
660000 -- (-424.518) (-425.498) (-425.616) [-424.231] * (-423.692) [-425.760] (-429.345) (-425.573) -- 0:00:21
Average standard deviation of split frequencies: 0.006689
660500 -- (-425.893) (-424.970) (-426.693) [-427.481] * (-424.895) [-426.263] (-425.167) (-426.201) -- 0:00:21
661000 -- [-424.939] (-425.219) (-430.750) (-428.066) * (-424.630) [-424.579] (-425.951) (-427.860) -- 0:00:21
661500 -- (-423.650) [-425.291] (-426.651) (-427.409) * (-424.629) [-424.030] (-432.063) (-425.215) -- 0:00:21
662000 -- [-426.811] (-427.873) (-426.128) (-428.023) * (-436.920) (-424.211) [-430.997] (-425.694) -- 0:00:21
662500 -- [-424.923] (-426.340) (-424.354) (-427.869) * (-425.341) (-424.388) [-425.436] (-429.169) -- 0:00:21
663000 -- (-429.052) (-426.299) [-424.538] (-427.297) * [-427.006] (-424.303) (-428.798) (-426.078) -- 0:00:21
663500 -- (-426.837) [-425.329] (-428.395) (-431.609) * (-424.765) (-431.867) (-426.139) [-423.808] -- 0:00:21
664000 -- (-425.258) (-426.934) [-424.649] (-424.519) * (-425.388) (-429.432) [-425.092] (-427.411) -- 0:00:21
664500 -- (-427.887) (-430.405) [-425.435] (-426.680) * (-424.351) (-426.579) [-424.939] (-428.522) -- 0:00:21
665000 -- [-426.637] (-426.563) (-424.655) (-426.375) * (-424.335) (-430.046) [-423.891] (-425.683) -- 0:00:21
Average standard deviation of split frequencies: 0.006990
665500 -- (-428.674) (-430.374) [-425.753] (-427.604) * (-424.242) (-431.785) (-429.896) [-425.872] -- 0:00:21
666000 -- [-426.840] (-428.793) (-427.554) (-426.895) * [-425.838] (-425.326) (-430.638) (-426.250) -- 0:00:21
666500 -- (-426.091) [-425.830] (-426.785) (-427.734) * (-426.320) (-432.804) [-425.903] (-425.675) -- 0:00:21
667000 -- (-425.086) (-427.080) [-424.425] (-424.454) * (-425.395) (-425.361) (-426.816) [-425.201] -- 0:00:20
667500 -- (-426.457) [-424.722] (-424.917) (-424.648) * (-424.670) [-425.019] (-428.842) (-427.194) -- 0:00:20
668000 -- (-426.854) (-428.554) [-423.925] (-424.887) * [-425.601] (-426.993) (-426.923) (-427.073) -- 0:00:20
668500 -- (-427.908) (-425.970) (-428.281) [-427.033] * (-426.994) [-424.639] (-426.444) (-426.179) -- 0:00:20
669000 -- (-425.932) [-424.006] (-423.895) (-424.133) * (-423.727) (-424.929) (-426.867) [-424.215] -- 0:00:20
669500 -- (-425.406) [-423.720] (-425.751) (-423.706) * [-424.786] (-424.263) (-425.785) (-431.362) -- 0:00:20
670000 -- [-425.282] (-425.453) (-425.294) (-426.826) * [-430.325] (-425.991) (-426.565) (-425.270) -- 0:00:20
Average standard deviation of split frequencies: 0.006677
670500 -- [-426.014] (-424.520) (-428.055) (-427.108) * (-426.443) (-425.014) (-424.759) [-427.264] -- 0:00:20
671000 -- (-431.727) [-425.106] (-425.342) (-424.414) * (-426.662) (-425.071) [-425.651] (-431.414) -- 0:00:20
671500 -- (-428.722) (-424.900) (-425.275) [-424.367] * (-427.769) [-425.900] (-423.423) (-424.507) -- 0:00:21
672000 -- (-428.846) [-425.249] (-424.837) (-427.160) * [-425.471] (-427.087) (-424.316) (-424.749) -- 0:00:20
672500 -- (-429.273) [-424.168] (-424.702) (-425.967) * (-425.740) [-426.409] (-427.691) (-431.522) -- 0:00:20
673000 -- (-427.375) (-426.241) (-426.192) [-424.814] * (-424.962) [-423.819] (-425.418) (-425.843) -- 0:00:20
673500 -- (-426.681) (-425.058) [-428.346] (-424.768) * (-423.940) (-427.104) [-425.512] (-428.024) -- 0:00:20
674000 -- (-424.836) (-426.071) (-427.420) [-425.431] * (-423.848) [-424.938] (-426.603) (-426.309) -- 0:00:20
674500 -- [-424.626] (-425.209) (-426.064) (-426.041) * [-424.769] (-425.299) (-425.888) (-426.561) -- 0:00:20
675000 -- [-424.114] (-425.872) (-425.963) (-424.867) * (-424.155) (-424.924) (-428.903) [-425.161] -- 0:00:20
Average standard deviation of split frequencies: 0.005971
675500 -- (-425.016) (-424.237) [-430.090] (-427.076) * (-426.378) (-424.396) [-425.523] (-427.009) -- 0:00:20
676000 -- [-424.931] (-425.798) (-428.059) (-428.944) * (-423.851) [-425.206] (-427.727) (-426.843) -- 0:00:20
676500 -- (-426.218) (-428.455) [-428.670] (-425.073) * (-425.121) [-424.349] (-425.869) (-430.867) -- 0:00:20
677000 -- (-426.386) [-427.305] (-426.493) (-423.972) * (-426.639) [-424.806] (-429.854) (-430.776) -- 0:00:20
677500 -- (-425.602) (-428.617) (-425.289) [-424.394] * [-426.958] (-424.264) (-425.796) (-425.294) -- 0:00:20
678000 -- (-427.499) (-426.766) [-424.467] (-427.644) * (-424.877) (-426.442) [-427.350] (-424.291) -- 0:00:20
678500 -- (-424.503) (-430.119) [-424.944] (-428.115) * (-424.186) (-425.748) (-428.063) [-424.821] -- 0:00:20
679000 -- [-425.706] (-424.705) (-426.528) (-427.897) * [-426.656] (-424.982) (-428.603) (-427.280) -- 0:00:20
679500 -- (-426.722) (-424.332) (-426.530) [-429.572] * (-424.310) (-427.237) [-428.790] (-428.514) -- 0:00:20
680000 -- (-425.385) (-427.249) [-423.903] (-424.725) * (-433.519) (-425.464) [-426.416] (-427.216) -- 0:00:20
Average standard deviation of split frequencies: 0.006233
680500 -- (-426.578) (-430.731) [-426.638] (-424.781) * (-424.832) (-427.507) [-424.672] (-426.929) -- 0:00:20
681000 -- (-424.094) [-426.869] (-425.891) (-427.083) * [-429.162] (-423.688) (-425.009) (-424.450) -- 0:00:20
681500 -- (-424.896) (-423.945) [-424.181] (-428.113) * (-424.890) (-424.611) (-425.657) [-424.191] -- 0:00:20
682000 -- (-425.844) [-424.573] (-428.636) (-424.502) * (-425.387) [-424.228] (-429.139) (-426.836) -- 0:00:20
682500 -- (-427.160) [-427.144] (-426.608) (-425.236) * [-424.479] (-424.747) (-426.205) (-424.648) -- 0:00:20
683000 -- [-425.290] (-425.684) (-425.652) (-424.139) * (-425.857) [-424.944] (-426.969) (-426.100) -- 0:00:19
683500 -- [-426.830] (-424.563) (-428.741) (-427.098) * (-425.929) (-424.324) [-431.763] (-428.945) -- 0:00:19
684000 -- (-427.432) (-425.414) (-425.077) [-426.568] * (-425.122) (-425.013) [-428.019] (-428.003) -- 0:00:19
684500 -- (-428.146) (-427.560) (-424.674) [-428.703] * [-425.124] (-423.958) (-426.083) (-424.657) -- 0:00:19
685000 -- (-423.828) (-425.126) [-424.175] (-426.956) * (-424.063) (-424.566) (-426.884) [-423.801] -- 0:00:19
Average standard deviation of split frequencies: 0.006614
685500 -- (-429.596) (-423.592) (-430.713) [-427.375] * (-427.051) (-429.460) (-427.883) [-427.304] -- 0:00:19
686000 -- (-428.146) (-423.934) (-424.514) [-425.863] * (-426.608) (-427.724) [-424.947] (-424.017) -- 0:00:19
686500 -- [-424.154] (-425.903) (-423.743) (-428.799) * (-425.945) [-425.237] (-426.848) (-427.923) -- 0:00:19
687000 -- [-425.266] (-426.577) (-426.951) (-427.644) * (-425.847) (-423.915) [-427.024] (-424.355) -- 0:00:19
687500 -- (-424.685) (-426.284) [-426.541] (-426.419) * [-428.276] (-426.082) (-426.011) (-424.206) -- 0:00:19
688000 -- (-424.024) (-430.103) [-425.041] (-427.251) * (-427.929) [-424.925] (-426.574) (-425.656) -- 0:00:19
688500 -- (-425.492) [-428.344] (-425.444) (-425.103) * (-425.195) [-428.896] (-427.345) (-429.462) -- 0:00:19
689000 -- (-424.978) [-426.593] (-424.913) (-423.528) * [-427.877] (-428.408) (-424.445) (-425.175) -- 0:00:19
689500 -- (-425.523) (-427.900) (-425.984) [-423.942] * [-427.713] (-427.604) (-424.707) (-425.461) -- 0:00:19
690000 -- (-426.457) [-423.659] (-428.448) (-428.801) * (-426.158) [-424.935] (-424.977) (-426.322) -- 0:00:19
Average standard deviation of split frequencies: 0.007081
690500 -- [-426.470] (-423.435) (-424.388) (-426.045) * (-423.633) (-427.551) (-423.934) [-431.026] -- 0:00:19
691000 -- (-427.548) [-426.227] (-424.351) (-429.977) * (-427.604) (-426.511) [-424.317] (-427.874) -- 0:00:19
691500 -- (-428.081) (-424.799) [-424.504] (-424.313) * (-424.418) [-424.890] (-428.110) (-427.499) -- 0:00:19
692000 -- (-428.517) (-426.627) (-424.534) [-424.520] * (-426.743) [-426.120] (-425.794) (-429.492) -- 0:00:19
692500 -- (-425.176) (-424.733) (-427.811) [-425.138] * (-431.826) [-427.372] (-426.322) (-425.551) -- 0:00:19
693000 -- (-424.744) (-425.923) [-424.321] (-423.697) * (-428.735) [-426.414] (-425.200) (-424.825) -- 0:00:19
693500 -- [-426.817] (-427.280) (-424.004) (-426.372) * (-431.062) [-432.190] (-425.283) (-430.093) -- 0:00:19
694000 -- (-423.622) [-429.192] (-425.059) (-423.997) * (-428.025) (-425.943) [-426.295] (-427.410) -- 0:00:19
694500 -- (-431.639) (-424.006) [-424.445] (-424.993) * (-429.416) (-426.208) [-426.502] (-430.373) -- 0:00:19
695000 -- (-431.072) (-427.510) [-423.553] (-429.094) * (-426.828) (-429.374) (-426.905) [-426.407] -- 0:00:19
Average standard deviation of split frequencies: 0.007112
695500 -- (-426.047) [-424.522] (-428.802) (-426.130) * (-424.620) [-424.331] (-424.756) (-425.888) -- 0:00:19
696000 -- (-427.605) (-423.560) (-426.443) [-423.539] * (-426.660) (-424.154) (-424.334) [-425.996] -- 0:00:19
696500 -- (-431.579) (-426.847) (-429.066) [-423.484] * (-427.748) [-425.272] (-427.022) (-425.703) -- 0:00:19
697000 -- (-423.722) [-426.341] (-426.906) (-425.480) * (-430.549) (-427.591) [-425.830] (-424.063) -- 0:00:19
697500 -- (-424.895) [-424.339] (-424.680) (-425.693) * (-427.342) [-424.999] (-425.465) (-427.183) -- 0:00:19
698000 -- (-424.869) [-425.718] (-425.615) (-425.177) * (-425.960) (-426.881) (-426.467) [-424.013] -- 0:00:19
698500 -- [-426.047] (-424.669) (-424.350) (-426.579) * (-425.623) (-426.600) (-424.721) [-424.188] -- 0:00:18
699000 -- (-427.220) (-425.536) [-424.517] (-428.636) * (-428.676) [-428.606] (-429.707) (-427.551) -- 0:00:18
699500 -- (-424.994) [-423.974] (-425.604) (-429.339) * [-424.563] (-424.990) (-427.573) (-432.639) -- 0:00:18
700000 -- (-425.513) [-425.802] (-427.314) (-427.183) * (-424.338) (-428.046) (-424.721) [-425.560] -- 0:00:18
Average standard deviation of split frequencies: 0.006602
700500 -- (-423.715) (-426.100) (-425.179) [-428.784] * (-424.422) (-425.669) (-431.293) [-426.092] -- 0:00:18
701000 -- [-425.369] (-428.652) (-429.056) (-424.681) * (-428.018) [-425.879] (-425.029) (-426.925) -- 0:00:18
701500 -- (-425.271) [-425.397] (-425.362) (-425.395) * (-427.254) (-423.602) [-425.811] (-427.410) -- 0:00:18
702000 -- (-425.111) [-424.479] (-424.728) (-428.100) * (-426.477) (-423.606) (-430.994) [-428.189] -- 0:00:18
702500 -- (-424.983) (-427.044) (-427.658) [-431.618] * (-426.192) (-423.610) (-426.663) [-426.055] -- 0:00:18
703000 -- [-428.388] (-425.145) (-424.357) (-425.246) * (-427.438) [-425.364] (-427.352) (-425.709) -- 0:00:18
703500 -- [-424.885] (-425.282) (-424.557) (-426.037) * (-424.090) (-425.819) [-431.821] (-425.181) -- 0:00:18
704000 -- (-424.067) (-427.939) (-428.665) [-424.083] * (-425.779) [-425.684] (-426.194) (-423.870) -- 0:00:18
704500 -- (-424.912) (-424.026) [-426.885] (-424.784) * [-429.499] (-424.735) (-428.026) (-429.140) -- 0:00:18
705000 -- (-425.095) [-426.995] (-424.560) (-425.206) * (-428.016) [-425.680] (-423.750) (-426.080) -- 0:00:18
Average standard deviation of split frequencies: 0.006260
705500 -- (-425.424) [-425.722] (-425.077) (-431.754) * (-425.234) (-425.005) (-428.001) [-425.715] -- 0:00:18
706000 -- [-426.363] (-424.148) (-425.153) (-426.342) * (-424.637) [-425.863] (-426.380) (-426.214) -- 0:00:18
706500 -- (-425.047) [-425.711] (-425.664) (-426.535) * (-427.896) (-424.752) (-425.883) [-427.016] -- 0:00:18
707000 -- (-426.216) [-424.710] (-425.408) (-425.116) * (-428.130) (-424.964) [-429.236] (-427.020) -- 0:00:18
707500 -- (-429.515) [-430.030] (-425.235) (-423.752) * [-427.730] (-431.169) (-430.097) (-425.776) -- 0:00:18
708000 -- (-427.257) (-425.324) [-426.161] (-429.339) * (-428.363) (-427.920) (-429.259) [-427.132] -- 0:00:18
708500 -- (-428.270) (-425.749) (-424.603) [-424.080] * (-426.321) [-424.176] (-427.354) (-427.082) -- 0:00:18
709000 -- (-433.887) (-430.965) [-424.380] (-426.854) * (-426.188) (-425.942) [-426.233] (-425.577) -- 0:00:18
709500 -- [-426.661] (-431.217) (-424.914) (-424.329) * [-425.521] (-427.721) (-427.878) (-426.330) -- 0:00:18
710000 -- (-426.807) (-426.809) (-426.701) [-425.857] * (-426.835) [-425.313] (-424.767) (-423.771) -- 0:00:18
Average standard deviation of split frequencies: 0.006426
710500 -- (-426.652) [-426.227] (-427.482) (-427.157) * (-424.373) (-430.807) (-427.229) [-424.484] -- 0:00:18
711000 -- [-426.605] (-425.670) (-425.392) (-428.472) * (-424.053) (-425.910) (-430.245) [-425.223] -- 0:00:18
711500 -- (-428.711) (-426.027) [-426.797] (-427.152) * (-427.188) (-424.040) [-429.002] (-425.653) -- 0:00:18
712000 -- (-426.615) (-424.466) (-426.092) [-427.835] * [-427.953] (-424.246) (-426.275) (-426.405) -- 0:00:18
712500 -- (-430.939) (-426.680) [-425.470] (-426.085) * (-425.546) [-429.194] (-425.967) (-424.716) -- 0:00:18
713000 -- (-430.516) (-425.702) (-425.623) [-426.246] * (-425.809) (-424.899) (-426.149) [-426.242] -- 0:00:18
713500 -- (-427.895) [-427.370] (-427.689) (-423.992) * (-425.101) [-426.186] (-426.538) (-427.280) -- 0:00:18
714000 -- (-426.355) (-425.517) (-427.976) [-426.617] * (-425.467) (-423.837) (-424.572) [-430.369] -- 0:00:18
714500 -- (-427.984) (-426.370) (-427.870) [-423.711] * (-428.116) (-423.469) (-426.749) [-425.556] -- 0:00:17
715000 -- [-424.112] (-430.504) (-425.344) (-424.860) * (-429.980) (-426.532) [-426.475] (-426.124) -- 0:00:17
Average standard deviation of split frequencies: 0.006502
715500 -- (-424.060) (-425.519) [-427.585] (-425.425) * (-427.116) (-428.155) [-428.413] (-424.169) -- 0:00:17
716000 -- (-425.820) (-424.790) (-427.326) [-424.777] * [-425.923] (-428.071) (-428.077) (-424.554) -- 0:00:17
716500 -- (-429.281) [-426.347] (-425.070) (-423.909) * (-426.566) (-430.130) (-427.527) [-425.610] -- 0:00:17
717000 -- [-427.357] (-426.544) (-426.944) (-424.250) * (-424.649) (-427.368) (-425.322) [-425.299] -- 0:00:17
717500 -- (-425.031) [-425.044] (-431.120) (-428.478) * (-424.789) (-424.615) (-425.298) [-425.912] -- 0:00:17
718000 -- (-428.185) [-425.832] (-424.665) (-424.357) * [-423.791] (-426.191) (-424.856) (-428.834) -- 0:00:17
718500 -- (-426.555) (-425.204) [-424.369] (-424.605) * [-427.538] (-426.236) (-425.019) (-427.681) -- 0:00:17
719000 -- (-432.475) (-427.856) [-426.125] (-425.201) * (-429.737) (-427.454) (-425.120) [-426.097] -- 0:00:17
719500 -- (-425.873) (-425.557) [-424.398] (-428.156) * [-424.785] (-428.427) (-426.559) (-425.840) -- 0:00:17
720000 -- (-425.379) (-428.520) [-424.922] (-429.580) * (-426.012) [-429.046] (-429.736) (-423.625) -- 0:00:17
Average standard deviation of split frequencies: 0.006296
720500 -- (-425.350) [-427.837] (-431.504) (-428.036) * (-434.690) [-424.400] (-429.117) (-423.958) -- 0:00:17
721000 -- [-426.203] (-426.755) (-425.507) (-425.341) * (-426.206) [-425.729] (-424.211) (-425.890) -- 0:00:17
721500 -- [-425.714] (-427.522) (-424.949) (-424.932) * [-427.421] (-424.792) (-426.231) (-427.468) -- 0:00:17
722000 -- (-424.424) (-426.311) (-425.724) [-425.262] * (-426.007) [-424.127] (-424.679) (-428.312) -- 0:00:17
722500 -- (-424.879) (-428.285) [-431.233] (-424.017) * [-424.205] (-427.964) (-428.312) (-424.566) -- 0:00:17
723000 -- [-424.068] (-427.449) (-432.236) (-428.795) * (-427.864) [-425.426] (-426.742) (-425.859) -- 0:00:17
723500 -- (-424.771) (-426.046) [-425.144] (-426.480) * (-424.741) (-425.813) (-429.015) [-424.377] -- 0:00:17
724000 -- (-424.503) (-424.269) (-426.503) [-425.895] * (-425.377) (-425.873) (-428.285) [-423.858] -- 0:00:17
724500 -- (-425.974) (-425.213) [-425.450] (-424.278) * (-430.811) (-428.462) (-425.241) [-426.905] -- 0:00:17
725000 -- (-424.481) (-424.793) (-429.668) [-425.520] * (-426.408) (-425.171) [-425.422] (-425.302) -- 0:00:17
Average standard deviation of split frequencies: 0.006574
725500 -- (-427.099) [-426.780] (-427.922) (-427.801) * (-426.597) (-425.919) [-424.040] (-424.415) -- 0:00:17
726000 -- (-426.893) (-430.389) (-429.420) [-425.960] * (-426.311) (-427.268) (-425.642) [-426.146] -- 0:00:17
726500 -- [-425.294] (-424.968) (-423.971) (-427.302) * (-429.077) (-424.968) [-424.069] (-424.254) -- 0:00:17
727000 -- (-425.149) (-425.326) [-428.707] (-423.886) * [-423.463] (-429.540) (-429.105) (-423.947) -- 0:00:17
727500 -- (-425.246) [-424.021] (-426.547) (-424.144) * [-423.793] (-425.638) (-425.531) (-423.372) -- 0:00:17
728000 -- [-425.820] (-424.048) (-424.396) (-425.305) * (-426.292) [-430.279] (-425.281) (-427.859) -- 0:00:17
728500 -- (-425.976) [-423.947] (-424.053) (-426.347) * (-428.320) (-427.093) [-423.798] (-428.426) -- 0:00:17
729000 -- (-427.068) [-425.056] (-424.285) (-424.578) * (-425.020) [-424.563] (-425.893) (-426.135) -- 0:00:17
729500 -- (-425.700) (-424.071) (-425.014) [-428.282] * (-428.307) (-426.898) [-424.523] (-423.966) -- 0:00:17
730000 -- (-425.001) [-423.983] (-425.343) (-426.350) * (-425.889) (-425.698) [-425.320] (-423.599) -- 0:00:17
Average standard deviation of split frequencies: 0.006734
730500 -- (-428.915) [-425.501] (-424.205) (-424.863) * (-425.817) (-426.913) [-423.775] (-424.228) -- 0:00:16
731000 -- [-427.493] (-427.534) (-426.609) (-424.863) * [-424.173] (-424.150) (-425.126) (-428.499) -- 0:00:16
731500 -- (-423.451) [-424.753] (-425.952) (-425.905) * (-425.886) (-427.030) [-428.078] (-427.673) -- 0:00:16
732000 -- (-424.091) (-424.780) [-426.573] (-423.635) * (-429.262) (-425.830) (-424.074) [-426.381] -- 0:00:16
732500 -- (-426.115) (-423.551) [-424.340] (-427.647) * (-425.999) (-428.757) [-423.739] (-430.388) -- 0:00:16
733000 -- (-430.813) [-425.245] (-429.433) (-427.616) * (-428.286) [-423.735] (-428.747) (-427.153) -- 0:00:16
733500 -- (-426.862) (-426.795) (-426.866) [-424.389] * (-424.123) (-428.690) [-433.240] (-424.132) -- 0:00:16
734000 -- (-424.182) (-425.925) (-427.847) [-425.424] * (-425.267) (-425.279) [-427.005] (-431.687) -- 0:00:16
734500 -- [-426.314] (-428.607) (-427.335) (-427.254) * (-425.306) [-426.379] (-425.879) (-426.039) -- 0:00:16
735000 -- (-425.690) [-426.361] (-425.624) (-431.161) * (-426.805) (-424.836) (-425.766) [-424.352] -- 0:00:16
Average standard deviation of split frequencies: 0.006605
735500 -- (-424.830) (-427.112) (-425.743) [-425.789] * (-426.984) [-425.780] (-425.219) (-424.859) -- 0:00:16
736000 -- [-424.826] (-426.957) (-426.979) (-424.595) * [-427.342] (-426.722) (-429.268) (-427.566) -- 0:00:16
736500 -- [-429.595] (-425.534) (-427.845) (-426.747) * (-427.330) [-424.820] (-426.690) (-424.488) -- 0:00:16
737000 -- (-424.437) (-427.493) (-424.934) [-427.990] * (-425.979) (-425.234) (-426.814) [-425.358] -- 0:00:16
737500 -- [-423.785] (-426.195) (-424.934) (-428.139) * (-426.411) (-426.193) (-425.470) [-424.144] -- 0:00:16
738000 -- (-425.304) [-424.788] (-424.898) (-425.423) * (-425.474) [-428.220] (-424.568) (-427.605) -- 0:00:16
738500 -- (-432.151) (-423.921) (-426.816) [-425.253] * (-425.127) (-424.624) [-428.289] (-426.607) -- 0:00:16
739000 -- (-425.909) (-427.105) [-423.930] (-424.696) * (-426.670) [-425.128] (-426.414) (-425.141) -- 0:00:16
739500 -- (-430.403) (-425.938) [-425.209] (-429.277) * (-424.950) (-424.390) (-427.248) [-427.749] -- 0:00:16
740000 -- (-431.029) (-425.583) (-426.461) [-424.146] * (-426.865) (-424.170) (-428.695) [-428.734] -- 0:00:16
Average standard deviation of split frequencies: 0.006086
740500 -- (-426.869) [-423.976] (-426.949) (-426.826) * (-425.114) (-423.832) (-425.059) [-427.510] -- 0:00:16
741000 -- (-423.454) [-423.976] (-425.341) (-425.940) * (-424.945) (-424.128) (-428.367) [-425.232] -- 0:00:16
741500 -- (-426.590) [-425.197] (-425.689) (-424.403) * (-426.512) [-428.179] (-426.167) (-425.489) -- 0:00:16
742000 -- (-423.686) [-425.215] (-425.553) (-425.062) * [-424.821] (-425.739) (-424.780) (-426.436) -- 0:00:16
742500 -- (-424.091) (-425.316) (-425.570) [-425.270] * [-427.885] (-425.017) (-424.284) (-427.546) -- 0:00:16
743000 -- (-425.473) (-431.739) (-426.548) [-425.524] * [-425.256] (-427.829) (-425.546) (-425.930) -- 0:00:16
743500 -- (-424.844) (-426.489) (-425.543) [-425.243] * (-424.940) (-425.885) (-429.137) [-426.470] -- 0:00:16
744000 -- (-425.418) (-426.707) [-425.380] (-425.813) * (-424.691) (-425.737) (-426.762) [-425.200] -- 0:00:16
744500 -- [-425.985] (-426.908) (-427.547) (-424.005) * (-425.840) (-428.212) (-428.145) [-428.443] -- 0:00:16
745000 -- (-424.605) (-425.310) [-426.419] (-425.929) * (-428.501) (-424.485) [-429.650] (-426.867) -- 0:00:16
Average standard deviation of split frequencies: 0.006240
745500 -- (-425.415) (-428.902) [-425.471] (-424.313) * (-428.306) (-427.108) (-424.760) [-426.165] -- 0:00:16
746000 -- (-429.744) (-424.666) [-424.841] (-426.863) * (-426.360) (-425.975) (-424.047) [-425.799] -- 0:00:16
746500 -- (-426.016) [-425.285] (-428.362) (-425.222) * (-425.116) (-426.866) (-423.929) [-423.709] -- 0:00:15
747000 -- (-424.912) (-427.026) (-427.469) [-431.843] * (-425.267) (-423.739) (-425.496) [-427.326] -- 0:00:15
747500 -- (-428.265) (-426.111) [-428.285] (-426.896) * (-426.516) [-425.170] (-425.738) (-426.591) -- 0:00:15
748000 -- [-424.593] (-423.523) (-425.238) (-425.933) * (-425.718) (-427.938) [-425.949] (-427.150) -- 0:00:15
748500 -- [-426.900] (-426.256) (-429.602) (-426.140) * (-429.237) [-426.828] (-425.917) (-424.162) -- 0:00:15
749000 -- [-424.593] (-424.043) (-425.856) (-427.764) * (-425.788) (-424.268) (-425.984) [-425.398] -- 0:00:15
749500 -- (-425.778) (-424.685) (-427.258) [-429.600] * (-426.424) (-430.251) (-426.962) [-426.199] -- 0:00:15
750000 -- (-424.755) (-427.278) (-424.297) [-424.994] * (-424.663) [-427.188] (-428.790) (-428.155) -- 0:00:15
Average standard deviation of split frequencies: 0.006123
750500 -- [-425.476] (-428.546) (-425.668) (-426.626) * (-424.525) [-423.933] (-428.286) (-425.992) -- 0:00:15
751000 -- (-426.166) (-426.560) (-424.065) [-426.164] * (-426.585) [-425.774] (-424.969) (-426.698) -- 0:00:15
751500 -- (-431.194) [-431.506] (-426.212) (-426.737) * (-426.764) [-425.971] (-425.052) (-429.509) -- 0:00:15
752000 -- (-425.191) (-424.828) [-426.461] (-430.682) * (-425.750) [-427.773] (-425.114) (-425.813) -- 0:00:15
752500 -- (-426.939) [-424.877] (-424.354) (-428.477) * (-423.988) (-431.898) (-428.394) [-423.609] -- 0:00:15
753000 -- (-423.936) [-424.733] (-423.698) (-425.845) * [-426.214] (-425.905) (-424.047) (-424.994) -- 0:00:15
753500 -- (-424.842) (-427.189) (-425.058) [-425.828] * (-425.707) [-425.792] (-426.745) (-426.780) -- 0:00:15
754000 -- (-428.280) [-426.273] (-425.946) (-427.151) * (-428.619) (-427.155) (-426.144) [-427.521] -- 0:00:15
754500 -- (-428.726) [-424.705] (-426.306) (-427.878) * (-426.610) [-424.372] (-425.506) (-425.180) -- 0:00:15
755000 -- (-424.869) [-427.537] (-425.192) (-425.289) * [-426.061] (-425.588) (-425.395) (-423.718) -- 0:00:15
Average standard deviation of split frequencies: 0.005885
755500 -- (-426.523) [-428.734] (-425.130) (-425.404) * (-426.068) (-428.421) [-423.912] (-425.588) -- 0:00:15
756000 -- [-425.931] (-426.773) (-427.364) (-426.921) * [-423.985] (-428.397) (-425.546) (-424.560) -- 0:00:15
756500 -- (-428.886) (-430.300) [-430.407] (-424.247) * (-424.289) (-431.989) (-426.617) [-426.006] -- 0:00:15
757000 -- (-426.710) (-429.119) (-425.232) [-423.776] * [-426.293] (-424.990) (-424.551) (-425.057) -- 0:00:15
757500 -- (-426.080) (-430.366) [-428.545] (-423.723) * (-425.537) (-427.103) [-426.459] (-425.859) -- 0:00:15
758000 -- [-428.088] (-429.544) (-426.563) (-423.580) * (-425.863) (-424.254) [-425.194] (-427.812) -- 0:00:15
758500 -- (-423.933) (-425.682) (-425.890) [-425.867] * (-425.758) (-423.832) [-427.550] (-427.929) -- 0:00:15
759000 -- (-426.735) [-427.139] (-424.189) (-425.810) * (-423.976) (-425.790) [-426.764] (-428.612) -- 0:00:15
759500 -- [-428.897] (-427.832) (-425.229) (-427.405) * [-425.512] (-425.046) (-429.450) (-428.094) -- 0:00:15
760000 -- [-424.714] (-426.623) (-425.006) (-424.235) * (-424.786) (-426.516) (-426.204) [-425.729] -- 0:00:15
Average standard deviation of split frequencies: 0.005887
760500 -- (-428.268) [-423.887] (-425.696) (-423.527) * [-424.738] (-425.543) (-426.440) (-426.772) -- 0:00:15
761000 -- (-424.021) [-431.114] (-428.010) (-423.353) * (-424.766) (-426.117) (-425.899) [-426.833] -- 0:00:15
761500 -- (-424.662) (-425.950) (-426.871) [-423.372] * (-425.404) [-425.170] (-425.959) (-427.306) -- 0:00:15
762000 -- [-425.692] (-428.661) (-427.624) (-425.518) * (-425.441) (-424.131) [-425.308] (-424.063) -- 0:00:14
762500 -- (-428.327) (-425.023) [-424.411] (-425.536) * (-426.398) (-425.507) (-426.478) [-426.340] -- 0:00:14
763000 -- [-428.476] (-425.234) (-427.341) (-426.665) * (-429.707) [-424.466] (-424.607) (-425.732) -- 0:00:14
763500 -- [-425.590] (-427.505) (-426.280) (-427.012) * [-428.686] (-427.028) (-427.120) (-429.768) -- 0:00:14
764000 -- (-424.956) [-424.579] (-430.235) (-424.745) * (-426.057) (-426.749) (-427.960) [-425.091] -- 0:00:14
764500 -- (-425.204) (-424.362) (-427.280) [-425.443] * (-423.983) (-427.678) (-426.588) [-426.846] -- 0:00:14
765000 -- (-425.126) [-425.578] (-429.022) (-425.599) * [-425.321] (-426.951) (-429.674) (-426.951) -- 0:00:14
Average standard deviation of split frequencies: 0.006193
765500 -- (-424.510) (-427.836) [-425.103] (-427.651) * [-424.433] (-425.771) (-424.593) (-427.578) -- 0:00:14
766000 -- (-426.603) (-423.480) (-423.676) [-425.292] * [-424.550] (-426.363) (-427.609) (-428.298) -- 0:00:14
766500 -- (-427.253) (-423.538) (-424.569) [-424.946] * (-427.530) (-423.890) (-425.076) [-424.115] -- 0:00:14
767000 -- (-427.611) (-423.527) [-425.301] (-428.387) * (-428.092) [-427.047] (-428.725) (-425.092) -- 0:00:14
767500 -- [-427.518] (-423.835) (-425.656) (-429.194) * (-426.529) (-427.535) (-427.344) [-424.029] -- 0:00:14
768000 -- (-427.507) (-430.624) (-424.091) [-424.913] * [-425.075] (-425.317) (-426.158) (-427.013) -- 0:00:14
768500 -- (-426.503) (-425.266) [-424.463] (-425.644) * (-428.326) (-424.093) (-424.624) [-425.389] -- 0:00:14
769000 -- (-432.091) (-425.893) (-424.456) [-426.354] * [-425.585] (-424.713) (-424.188) (-426.668) -- 0:00:14
769500 -- (-429.636) [-427.320] (-425.029) (-427.267) * (-426.583) [-425.843] (-427.404) (-425.317) -- 0:00:14
770000 -- (-426.699) (-426.911) [-424.519] (-425.430) * (-425.969) (-426.551) [-426.237] (-425.051) -- 0:00:14
Average standard deviation of split frequencies: 0.006040
770500 -- (-426.601) (-428.671) [-424.207] (-424.758) * (-423.902) (-427.560) [-428.043] (-424.764) -- 0:00:14
771000 -- (-427.580) (-425.805) (-424.960) [-424.493] * (-425.152) (-428.257) [-428.433] (-425.158) -- 0:00:14
771500 -- (-428.222) [-427.084] (-424.141) (-425.753) * [-426.804] (-423.811) (-428.634) (-423.848) -- 0:00:14
772000 -- [-425.202] (-433.678) (-423.586) (-426.066) * (-425.044) (-427.294) (-424.469) [-425.006] -- 0:00:14
772500 -- (-427.810) (-431.621) (-423.589) [-423.572] * (-430.578) (-425.556) [-424.168] (-423.655) -- 0:00:14
773000 -- [-425.648] (-428.875) (-425.633) (-424.731) * (-426.449) (-424.590) (-424.721) [-425.128] -- 0:00:14
773500 -- (-428.450) [-424.316] (-424.465) (-424.839) * (-425.135) [-423.586] (-424.771) (-424.855) -- 0:00:14
774000 -- [-427.163] (-424.210) (-425.702) (-431.191) * (-426.226) [-423.942] (-425.780) (-426.083) -- 0:00:14
774500 -- (-425.418) (-424.246) [-424.124] (-425.549) * [-428.319] (-426.831) (-425.482) (-425.955) -- 0:00:14
775000 -- (-425.480) (-424.419) (-427.127) [-426.036] * [-424.780] (-431.053) (-424.515) (-424.848) -- 0:00:14
Average standard deviation of split frequencies: 0.005885
775500 -- [-426.901] (-429.318) (-424.723) (-425.137) * (-427.498) (-425.934) [-423.485] (-424.327) -- 0:00:14
776000 -- (-425.744) (-424.298) [-427.726] (-424.633) * (-424.207) [-425.908] (-424.501) (-426.961) -- 0:00:14
776500 -- (-429.809) (-426.982) [-425.074] (-428.131) * (-428.110) (-427.698) (-424.731) [-425.647] -- 0:00:14
777000 -- (-423.912) (-425.922) [-425.868] (-424.960) * [-424.072] (-425.568) (-426.156) (-431.011) -- 0:00:14
777500 -- (-426.158) (-425.566) [-426.607] (-427.857) * [-425.038] (-423.991) (-425.214) (-424.504) -- 0:00:14
778000 -- [-425.258] (-424.726) (-424.481) (-426.399) * (-425.681) (-424.429) [-426.177] (-423.572) -- 0:00:13
778500 -- [-423.569] (-425.157) (-429.124) (-423.990) * (-425.401) [-427.589] (-425.257) (-423.996) -- 0:00:13
779000 -- (-425.338) (-423.969) (-425.377) [-423.964] * (-427.372) (-430.501) (-426.151) [-426.148] -- 0:00:13
779500 -- (-424.824) (-424.009) [-426.495] (-426.624) * [-426.030] (-425.118) (-424.957) (-424.270) -- 0:00:13
780000 -- (-426.024) (-429.727) (-425.729) [-425.396] * (-428.239) [-425.418] (-427.302) (-425.332) -- 0:00:13
Average standard deviation of split frequencies: 0.005284
780500 -- (-427.862) (-426.945) (-424.307) [-424.842] * (-426.806) (-426.630) [-425.212] (-426.684) -- 0:00:13
781000 -- (-425.550) (-426.164) (-423.751) [-426.181] * (-425.031) (-426.095) (-425.559) [-425.551] -- 0:00:13
781500 -- [-429.529] (-423.802) (-424.222) (-425.744) * [-427.777] (-425.319) (-426.201) (-426.960) -- 0:00:13
782000 -- (-425.715) (-425.040) (-427.627) [-426.360] * (-426.059) (-425.494) [-426.552] (-427.124) -- 0:00:13
782500 -- (-424.357) (-423.837) [-424.911] (-426.837) * [-424.458] (-426.139) (-427.456) (-426.803) -- 0:00:13
783000 -- [-425.593] (-424.418) (-424.376) (-435.461) * [-424.446] (-430.649) (-424.354) (-427.196) -- 0:00:13
783500 -- [-425.828] (-425.917) (-427.533) (-436.058) * [-427.810] (-424.614) (-425.499) (-424.151) -- 0:00:13
784000 -- (-424.589) (-428.329) [-430.791] (-429.434) * (-424.326) (-427.120) [-425.671] (-424.989) -- 0:00:13
784500 -- (-427.897) (-426.969) (-426.011) [-425.996] * (-424.106) (-430.098) (-426.635) [-428.135] -- 0:00:13
785000 -- (-426.258) (-425.481) (-424.569) [-425.376] * (-425.938) (-427.109) (-424.659) [-424.426] -- 0:00:13
Average standard deviation of split frequencies: 0.005623
785500 -- [-424.628] (-424.094) (-425.530) (-428.269) * [-426.338] (-427.563) (-427.439) (-424.751) -- 0:00:13
786000 -- (-424.392) [-424.591] (-426.557) (-426.116) * (-425.147) (-430.393) [-425.515] (-425.402) -- 0:00:13
786500 -- (-423.765) [-424.266] (-429.024) (-427.604) * [-424.531] (-427.582) (-433.769) (-425.647) -- 0:00:13
787000 -- (-425.881) [-425.037] (-424.318) (-424.854) * [-424.236] (-427.896) (-429.260) (-426.471) -- 0:00:13
787500 -- (-423.587) (-423.886) [-427.726] (-426.294) * [-426.901] (-425.046) (-428.851) (-423.847) -- 0:00:13
788000 -- (-427.854) [-424.477] (-427.081) (-427.438) * (-426.501) (-423.849) [-423.828] (-427.020) -- 0:00:13
788500 -- (-425.968) (-424.790) (-424.303) [-426.218] * (-425.134) (-425.841) (-424.095) [-425.681] -- 0:00:13
789000 -- (-427.659) (-424.150) [-425.530] (-424.472) * (-426.326) [-425.324] (-424.492) (-426.211) -- 0:00:13
789500 -- [-424.840] (-423.932) (-426.307) (-433.908) * [-425.924] (-425.873) (-425.563) (-427.720) -- 0:00:13
790000 -- (-424.717) (-423.839) [-425.533] (-426.736) * (-426.381) (-427.854) [-425.660] (-427.084) -- 0:00:13
Average standard deviation of split frequencies: 0.005888
790500 -- (-426.268) (-425.838) [-428.654] (-427.234) * (-426.192) [-426.185] (-424.136) (-431.795) -- 0:00:12
791000 -- [-427.507] (-425.857) (-426.584) (-424.862) * (-428.247) [-426.280] (-427.115) (-426.810) -- 0:00:13
791500 -- (-427.482) (-424.792) [-424.182] (-426.522) * [-429.306] (-425.839) (-425.533) (-425.933) -- 0:00:13
792000 -- (-427.555) [-425.583] (-427.172) (-425.751) * (-424.776) [-426.035] (-425.529) (-425.787) -- 0:00:13
792500 -- (-427.832) [-424.884] (-426.234) (-426.599) * [-426.161] (-423.969) (-426.381) (-426.715) -- 0:00:13
793000 