--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:12:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0009/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -267.59 -271.00
2 -267.54 -271.23
--------------------------------------
TOTAL -267.57 -271.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865978 0.087386 0.349083 1.448313 0.835976 1501.00 1501.00 1.000
r(A<->C){all} 0.175441 0.023784 0.000065 0.492662 0.130087 216.29 245.66 1.000
r(A<->G){all} 0.135852 0.014865 0.000103 0.388774 0.099073 379.27 397.31 1.001
r(A<->T){all} 0.171855 0.020273 0.000301 0.459509 0.132686 157.19 199.27 1.003
r(C<->G){all} 0.147297 0.017275 0.000002 0.401865 0.111176 163.68 261.52 1.000
r(C<->T){all} 0.172431 0.021288 0.000061 0.478140 0.135168 191.82 213.66 1.000
r(G<->T){all} 0.197124 0.023537 0.000018 0.501502 0.160534 161.34 189.15 1.000
pi(A){all} 0.200385 0.000834 0.144101 0.255867 0.199580 1200.80 1233.23 1.000
pi(C){all} 0.189708 0.000756 0.138031 0.244588 0.188866 1162.60 1246.38 1.000
pi(G){all} 0.253498 0.000980 0.191964 0.314351 0.252760 1192.98 1219.98 1.000
pi(T){all} 0.356409 0.001206 0.289463 0.426066 0.356088 1251.73 1313.24 1.000
alpha{1,2} 0.327877 0.129486 0.000164 0.982661 0.215498 969.40 1127.49 1.000
alpha{3} 0.390216 0.210496 0.000267 1.339994 0.224174 1260.47 1266.19 1.000
pinvar{all} 0.979701 0.000270 0.948211 0.999344 0.984181 1061.88 1081.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -253.499004
Model 2: PositiveSelection -253.285292
Model 0: one-ratio -253.28528
Model 7: beta -253.499004
Model 8: beta&w>1 -253.285292
Model 0 vs 1 0.4274480000000267
Model 2 vs 1 0.42742400000003045
Model 8 vs 7 0.42742400000003045
>C1
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C2
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C3
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C4
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C5
MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C6
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=63
C1 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C2 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C3 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C4 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C5 MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C6 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
***********:**************************************
C1 ATKCGRFVIIYLS
C2 ATKCGRFVIIYLS
C3 ATKCGRFVIIYLS
C4 ATKCGRFVIIYLS
C5 ATKCGRFVIIYLS
C6 ATKCGRFVIIYLS
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 63 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 63 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1890]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1890]--->[1890]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.418 Mb, Max= 30.555 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C2 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C3 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C4 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C5 MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
C6 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
***********:**************************************
C1 ATKCGRFVIIYLS
C2 ATKCGRFVIIYLS
C3 ATKCGRFVIIYLS
C4 ATKCGRFVIIYLS
C5 ATKCGRFVIIYLS
C6 ATKCGRFVIIYLS
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 98.41 C1 C5 98.41
TOP 4 0 98.41 C5 C1 98.41
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 98.41 C2 C5 98.41
TOP 4 1 98.41 C5 C2 98.41
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 98.41 C3 C5 98.41
TOP 4 2 98.41 C5 C3 98.41
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 98.41 C4 C5 98.41
TOP 4 3 98.41 C5 C4 98.41
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 98.41 C5 C6 98.41
TOP 5 4 98.41 C6 C5 98.41
AVG 0 C1 * 99.68
AVG 1 C2 * 99.68
AVG 2 C3 * 99.68
AVG 3 C4 * 99.68
AVG 4 C5 * 98.41
AVG 5 C6 * 99.68
TOT TOT * 99.47
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
C2 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
C3 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
C4 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
C5 ATGAGATTATGTGTGTTCACCGGTACCGTAGACTCTGGTGGCGACCATTA
C6 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
********************************* ****************
C1 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
C2 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
C3 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
C4 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
C5 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
C6 TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
**************************************************
C1 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
C2 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
C3 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
C4 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
C5 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
C6 CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
**************************************************
C1 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
C2 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
C3 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
C4 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
C5 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
C6 GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
***************************************
>C1
ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C2
ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C3
ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C4
ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C5
ATGAGATTATGTGTGTTCACCGGTACCGTAGACTCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C6
ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA
TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG
CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT
GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>C1
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C2
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C3
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C4
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C5
MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
>C6
MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
ATKCGRFVIIYLS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 189 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788672
Setting output file names to "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 829790506
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0658417588
Seed = 822126357
Swapseed = 1579788672
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -426.393921 -- -24.965149
Chain 2 -- -426.393921 -- -24.965149
Chain 3 -- -426.393896 -- -24.965149
Chain 4 -- -426.393921 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -426.393921 -- -24.965149
Chain 2 -- -426.393896 -- -24.965149
Chain 3 -- -426.393896 -- -24.965149
Chain 4 -- -426.392371 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-426.394] (-426.394) (-426.394) (-426.394) * [-426.394] (-426.394) (-426.394) (-426.392)
500 -- [-270.868] (-274.060) (-269.607) (-273.816) * [-275.861] (-273.136) (-283.471) (-274.923) -- 0:00:00
1000 -- (-275.765) (-269.524) [-274.150] (-271.688) * [-273.765] (-269.235) (-268.992) (-273.628) -- 0:00:00
1500 -- (-269.926) (-271.024) (-271.010) [-271.157] * [-277.946] (-271.820) (-272.206) (-291.356) -- 0:00:00
2000 -- (-273.092) [-271.794] (-275.856) (-276.426) * (-276.905) (-268.312) [-274.224] (-271.216) -- 0:00:00
2500 -- (-270.845) [-273.996] (-274.223) (-275.903) * (-277.026) [-271.751] (-276.782) (-268.599) -- 0:00:00
3000 -- [-278.165] (-272.546) (-278.778) (-282.768) * (-269.011) (-274.509) [-272.047] (-268.687) -- 0:00:00
3500 -- (-280.751) [-272.242] (-276.002) (-281.217) * (-271.373) (-274.166) (-275.117) [-267.514] -- 0:00:00
4000 -- (-281.672) (-273.548) [-273.345] (-274.065) * (-277.445) (-274.633) [-271.575] (-276.811) -- 0:04:09
4500 -- [-283.487] (-274.674) (-268.761) (-280.179) * [-275.064] (-275.768) (-271.302) (-275.525) -- 0:03:41
5000 -- [-270.946] (-272.683) (-284.716) (-271.704) * (-273.723) (-276.083) (-274.912) [-272.382] -- 0:03:19
Average standard deviation of split frequencies: 0.074826
5500 -- (-273.766) (-275.128) [-272.631] (-276.924) * (-273.230) (-271.192) (-277.829) [-266.541] -- 0:03:00
6000 -- (-273.485) (-271.558) [-277.219] (-276.538) * (-278.494) (-276.945) (-280.765) [-274.633] -- 0:02:45
6500 -- (-272.445) (-283.155) [-269.439] (-271.397) * (-278.025) (-277.845) [-277.344] (-276.073) -- 0:02:32
7000 -- (-276.086) (-275.341) [-271.255] (-280.476) * (-276.137) (-270.734) [-271.453] (-275.841) -- 0:02:21
7500 -- (-277.033) (-278.126) (-277.230) [-272.028] * (-275.833) (-278.420) [-270.513] (-281.002) -- 0:02:12
8000 -- (-274.832) [-275.723] (-272.998) (-267.031) * (-272.292) (-273.830) [-278.627] (-279.266) -- 0:02:04
8500 -- (-279.839) (-278.572) [-270.677] (-266.569) * (-275.622) (-273.372) [-285.600] (-274.652) -- 0:01:56
9000 -- [-279.796] (-270.720) (-274.929) (-267.436) * (-275.510) [-283.843] (-282.208) (-279.078) -- 0:01:50
9500 -- (-273.699) (-284.692) [-270.044] (-267.386) * [-271.284] (-271.477) (-281.158) (-284.160) -- 0:01:44
10000 -- [-270.255] (-279.951) (-283.835) (-269.408) * (-272.143) [-270.731] (-277.999) (-275.726) -- 0:01:39
Average standard deviation of split frequencies: 0.048614
10500 -- (-280.184) [-270.414] (-274.798) (-267.788) * (-284.474) (-279.861) [-272.605] (-280.718) -- 0:01:34
11000 -- [-273.922] (-277.244) (-278.278) (-267.095) * (-283.802) (-273.937) [-269.635] (-277.982) -- 0:01:29
11500 -- (-270.037) (-283.246) [-273.743] (-267.714) * [-280.818] (-274.716) (-269.392) (-275.301) -- 0:01:25
12000 -- (-267.599) (-278.647) (-275.425) [-269.580] * (-280.431) [-268.800] (-269.847) (-269.457) -- 0:01:22
12500 -- (-269.680) [-270.217] (-271.744) (-266.598) * (-278.289) [-268.746] (-268.698) (-276.762) -- 0:01:19
13000 -- [-269.095] (-269.174) (-288.511) (-272.767) * (-277.224) (-276.086) [-266.088] (-284.443) -- 0:01:15
13500 -- (-267.894) (-271.528) (-273.363) [-265.662] * (-278.439) [-279.832] (-270.058) (-278.113) -- 0:01:13
14000 -- [-268.962] (-269.709) (-276.820) (-265.909) * (-276.159) (-272.603) [-270.163] (-275.190) -- 0:01:10
14500 -- [-266.971] (-266.287) (-271.895) (-267.357) * (-275.139) [-268.505] (-268.231) (-269.809) -- 0:01:07
15000 -- (-268.029) (-268.185) [-273.482] (-265.679) * [-269.677] (-273.645) (-267.875) (-267.536) -- 0:01:05
Average standard deviation of split frequencies: 0.057586
15500 -- (-269.545) (-267.758) (-282.100) [-268.655] * (-268.272) [-277.372] (-267.921) (-266.288) -- 0:01:03
16000 -- (-269.060) (-269.673) (-277.824) [-266.473] * [-268.951] (-279.229) (-269.786) (-268.045) -- 0:01:01
16500 -- (-274.232) [-267.599] (-277.630) (-271.719) * (-271.373) [-272.733] (-270.227) (-267.765) -- 0:00:59
17000 -- (-269.923) [-268.846] (-284.011) (-269.439) * (-269.326) (-278.692) (-270.657) [-267.897] -- 0:00:57
17500 -- [-269.350] (-270.833) (-272.606) (-266.776) * [-269.586] (-274.941) (-269.247) (-267.885) -- 0:00:56
18000 -- (-269.151) (-271.670) (-276.917) [-268.098] * (-271.860) (-272.900) (-271.330) [-269.740] -- 0:00:54
18500 -- [-269.497] (-271.037) (-278.175) (-268.386) * (-271.638) (-275.251) (-272.546) [-268.135] -- 0:01:46
19000 -- (-268.177) (-271.857) (-265.712) [-266.844] * (-274.503) [-274.370] (-274.756) (-274.748) -- 0:01:43
19500 -- (-268.616) (-268.244) [-271.912] (-266.578) * [-270.093] (-295.313) (-269.870) (-267.931) -- 0:01:40
20000 -- (-267.689) [-267.445] (-277.737) (-268.571) * (-268.561) (-283.517) [-268.091] (-268.603) -- 0:01:38
Average standard deviation of split frequencies: 0.054023
20500 -- [-268.023] (-267.690) (-269.271) (-269.504) * [-268.891] (-278.519) (-275.316) (-267.833) -- 0:01:35
21000 -- (-270.344) [-271.740] (-283.395) (-269.564) * (-270.505) (-275.038) (-277.433) [-268.223] -- 0:01:33
21500 -- (-271.691) [-269.496] (-269.527) (-266.299) * (-270.254) [-269.600] (-272.495) (-268.001) -- 0:01:31
22000 -- (-271.019) (-269.288) (-272.944) [-267.295] * (-273.031) (-271.374) [-270.119] (-268.847) -- 0:01:28
22500 -- (-268.182) [-274.395] (-264.007) (-269.532) * (-272.150) (-268.352) [-269.291] (-267.983) -- 0:01:26
23000 -- (-266.720) (-268.592) [-273.196] (-270.715) * [-270.066] (-269.550) (-266.484) (-268.633) -- 0:01:24
23500 -- (-267.341) [-269.056] (-276.523) (-266.887) * [-268.044] (-267.139) (-267.277) (-267.745) -- 0:01:23
24000 -- (-270.232) (-268.256) [-270.528] (-273.217) * (-269.636) (-272.528) [-270.598] (-267.035) -- 0:01:21
24500 -- (-269.097) (-269.538) [-273.584] (-270.105) * [-267.654] (-267.962) (-269.821) (-269.109) -- 0:01:19
25000 -- (-269.771) (-268.084) [-277.447] (-267.662) * (-268.698) [-268.299] (-268.266) (-267.318) -- 0:01:18
Average standard deviation of split frequencies: 0.040795
25500 -- [-266.447] (-270.100) (-269.499) (-269.105) * [-268.387] (-272.334) (-268.686) (-268.300) -- 0:01:16
26000 -- (-267.404) (-267.216) [-265.855] (-267.915) * (-268.871) (-268.782) (-270.962) [-265.373] -- 0:01:14
26500 -- (-270.448) (-267.905) [-268.526] (-269.284) * (-269.762) (-270.585) (-270.926) [-267.459] -- 0:01:13
27000 -- (-268.507) (-267.436) (-274.109) [-266.190] * (-270.667) (-269.050) (-268.149) [-268.554] -- 0:01:12
27500 -- [-267.522] (-266.889) (-273.530) (-267.244) * (-269.597) (-269.228) (-266.643) [-265.112] -- 0:01:10
28000 -- (-267.715) (-267.799) [-271.281] (-268.195) * (-269.600) [-269.379] (-269.778) (-267.987) -- 0:01:09
28500 -- (-268.359) (-267.361) (-294.319) [-266.147] * (-269.783) (-268.650) (-267.567) [-267.249] -- 0:01:08
29000 -- [-268.095] (-268.759) (-271.073) (-268.025) * (-270.349) [-267.804] (-268.359) (-266.194) -- 0:01:06
29500 -- (-267.018) [-269.491] (-276.704) (-268.464) * (-268.993) [-267.684] (-268.855) (-268.041) -- 0:01:05
30000 -- (-267.084) (-268.193) (-278.485) [-267.979] * (-270.826) [-267.183] (-266.980) (-267.417) -- 0:01:04
Average standard deviation of split frequencies: 0.030744
30500 -- [-267.604] (-269.951) (-270.051) (-270.449) * (-268.984) (-266.907) (-268.387) [-266.873] -- 0:01:03
31000 -- (-269.521) (-271.366) [-267.676] (-269.557) * (-268.794) (-266.565) [-267.357] (-268.167) -- 0:01:02
31500 -- (-268.892) (-266.113) (-267.086) [-269.888] * (-265.765) (-265.688) [-266.691] (-268.553) -- 0:01:01
32000 -- (-269.272) (-269.349) (-271.562) [-271.139] * (-270.600) [-265.563] (-265.109) (-270.308) -- 0:01:00
32500 -- (-269.654) (-271.223) (-266.425) [-270.010] * (-270.488) [-267.501] (-266.934) (-271.249) -- 0:01:29
33000 -- (-269.577) [-268.436] (-267.542) (-273.775) * (-270.093) (-267.184) (-266.026) [-268.079] -- 0:01:27
33500 -- (-273.046) (-266.663) (-270.267) [-275.568] * (-269.021) [-266.746] (-268.805) (-267.893) -- 0:01:26
34000 -- (-268.342) [-267.299] (-268.707) (-269.852) * (-270.710) [-266.405] (-268.477) (-269.437) -- 0:01:25
34500 -- [-268.604] (-270.572) (-268.026) (-269.504) * (-270.184) [-266.011] (-271.386) (-272.974) -- 0:01:23
35000 -- (-268.568) (-268.761) (-266.614) [-272.539] * [-269.273] (-268.259) (-270.579) (-270.241) -- 0:01:22
Average standard deviation of split frequencies: 0.030772
35500 -- (-271.076) (-268.487) (-266.250) [-267.666] * [-273.111] (-268.005) (-272.499) (-268.209) -- 0:01:21
36000 -- (-267.570) [-270.859] (-266.806) (-268.124) * (-268.424) (-269.671) [-269.749] (-267.582) -- 0:01:20
36500 -- (-269.589) (-269.421) (-272.685) [-269.438] * (-273.845) [-266.781] (-269.218) (-271.146) -- 0:01:19
37000 -- (-268.347) [-269.996] (-267.615) (-273.320) * (-270.156) (-267.257) [-268.386] (-269.414) -- 0:01:18
37500 -- (-268.494) [-268.944] (-274.991) (-270.037) * (-271.522) [-267.941] (-270.433) (-271.041) -- 0:01:17
38000 -- [-266.955] (-267.210) (-268.544) (-268.977) * (-269.013) (-268.744) [-269.199] (-268.649) -- 0:01:15
38500 -- (-268.343) (-267.679) [-271.737] (-267.348) * (-270.368) [-267.614] (-269.657) (-270.470) -- 0:01:14
39000 -- (-266.964) (-269.404) (-271.464) [-267.643] * [-271.720] (-268.444) (-270.511) (-268.651) -- 0:01:13
39500 -- (-268.286) [-270.966] (-265.577) (-266.529) * [-268.952] (-266.290) (-270.503) (-268.692) -- 0:01:12
40000 -- (-271.492) (-268.589) (-268.922) [-267.684] * (-270.165) (-268.422) [-266.485] (-274.621) -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-269.782) (-270.777) [-266.774] (-266.998) * (-270.788) [-268.112] (-269.981) (-267.899) -- 0:01:11
41000 -- (-271.074) (-271.060) [-266.607] (-270.762) * (-271.222) (-267.068) (-267.762) [-266.816] -- 0:01:10
41500 -- (-269.319) (-267.272) (-270.977) [-272.525] * (-270.335) [-265.283] (-268.460) (-271.200) -- 0:01:09
42000 -- (-266.104) (-267.859) [-268.827] (-269.381) * (-270.776) (-270.995) (-267.566) [-270.342] -- 0:01:08
42500 -- (-269.373) (-268.790) [-268.414] (-266.762) * (-266.498) [-266.415] (-266.374) (-276.017) -- 0:01:07
43000 -- (-267.515) (-267.607) (-268.459) [-269.282] * (-268.233) (-267.602) [-268.675] (-268.958) -- 0:01:06
43500 -- (-268.082) (-266.491) [-267.851] (-267.733) * (-268.030) (-271.327) [-270.492] (-269.049) -- 0:01:05
44000 -- (-270.205) [-266.014] (-268.530) (-270.653) * (-268.217) (-269.157) [-268.118] (-270.085) -- 0:01:05
44500 -- (-269.238) (-269.016) (-267.837) [-269.926] * [-269.949] (-269.055) (-267.693) (-267.795) -- 0:01:04
45000 -- (-267.156) [-266.158] (-266.306) (-267.573) * (-266.282) (-267.420) [-268.176] (-267.120) -- 0:01:03
Average standard deviation of split frequencies: 0.034648
45500 -- [-270.531] (-266.759) (-266.005) (-266.446) * [-268.865] (-270.182) (-270.102) (-268.340) -- 0:01:02
46000 -- (-270.468) (-266.075) [-265.726] (-271.269) * (-269.268) (-266.956) [-266.677] (-267.700) -- 0:01:02
46500 -- (-269.694) (-266.162) (-268.763) [-266.433] * (-268.579) (-267.511) [-269.537] (-267.144) -- 0:01:22
47000 -- (-267.543) (-266.886) [-268.178] (-266.831) * (-271.111) [-266.231] (-271.331) (-266.871) -- 0:01:21
47500 -- (-268.956) [-267.097] (-265.428) (-267.888) * (-269.187) [-272.319] (-269.374) (-268.039) -- 0:01:20
48000 -- (-268.129) (-270.505) [-270.425] (-269.552) * (-268.142) (-269.414) (-270.407) [-268.471] -- 0:01:19
48500 -- (-269.407) [-268.264] (-269.688) (-267.198) * [-272.280] (-267.862) (-268.218) (-267.950) -- 0:01:18
49000 -- [-270.326] (-265.191) (-269.351) (-269.049) * (-269.802) (-268.402) (-268.919) [-269.897] -- 0:01:17
49500 -- (-273.832) (-267.243) (-267.202) [-268.846] * (-266.789) [-266.950] (-270.674) (-265.364) -- 0:01:16
50000 -- (-271.745) (-272.957) (-271.189) [-268.011] * (-272.872) (-267.370) [-268.430] (-267.724) -- 0:01:16
Average standard deviation of split frequencies: 0.045191
50500 -- (-270.893) [-269.076] (-270.020) (-268.856) * (-266.281) [-266.361] (-271.408) (-268.175) -- 0:01:15
51000 -- (-272.312) (-265.883) (-273.544) [-267.357] * [-268.682] (-268.842) (-268.287) (-273.248) -- 0:01:14
51500 -- (-271.293) [-265.920] (-268.947) (-269.106) * [-270.666] (-268.146) (-269.804) (-276.532) -- 0:01:13
52000 -- (-269.140) (-266.433) (-269.569) [-268.534] * (-270.866) [-268.952] (-270.376) (-279.192) -- 0:01:12
52500 -- (-271.377) (-269.811) [-267.559] (-267.642) * (-269.216) [-266.171] (-273.716) (-269.859) -- 0:01:12
53000 -- (-273.630) (-264.999) (-268.751) [-271.537] * (-268.758) (-266.847) [-271.368] (-272.266) -- 0:01:11
53500 -- (-275.564) [-268.164] (-269.928) (-270.229) * (-271.353) (-270.870) (-270.247) [-268.791] -- 0:01:10
54000 -- [-274.853] (-271.725) (-271.249) (-270.312) * (-270.748) (-268.793) [-270.640] (-271.647) -- 0:01:10
54500 -- [-266.444] (-268.603) (-268.864) (-271.460) * (-271.031) [-268.793] (-269.164) (-271.950) -- 0:01:09
55000 -- (-268.838) (-269.058) [-269.914] (-271.460) * (-268.266) [-268.071] (-269.507) (-267.494) -- 0:01:08
Average standard deviation of split frequencies: 0.042976
55500 -- [-266.867] (-269.630) (-269.415) (-270.370) * (-267.909) (-270.838) [-271.834] (-270.994) -- 0:01:08
56000 -- [-270.183] (-269.037) (-269.900) (-267.884) * (-269.949) (-267.875) [-269.664] (-271.117) -- 0:01:07
56500 -- (-267.251) (-267.925) (-267.704) [-266.601] * (-268.949) [-266.336] (-272.490) (-269.049) -- 0:01:06
57000 -- (-266.682) (-266.394) [-268.653] (-269.985) * (-271.906) (-265.911) (-269.600) [-270.932] -- 0:01:06
57500 -- [-266.272] (-268.579) (-267.552) (-269.649) * (-267.131) (-269.069) (-272.415) [-266.545] -- 0:01:05
58000 -- (-270.929) [-268.067] (-267.615) (-271.098) * (-267.228) (-266.574) (-269.654) [-267.607] -- 0:01:04
58500 -- (-271.508) (-269.896) (-267.501) [-269.445] * (-273.058) (-268.222) (-267.649) [-268.737] -- 0:01:04
59000 -- [-271.182] (-268.517) (-268.425) (-266.523) * (-273.079) (-267.989) (-268.122) [-269.701] -- 0:01:03
59500 -- (-268.452) [-268.591] (-268.044) (-269.246) * (-268.898) (-265.552) (-270.893) [-269.675] -- 0:01:03
60000 -- (-266.958) [-268.244] (-266.802) (-266.374) * (-268.597) (-266.717) (-268.041) [-268.193] -- 0:01:18
Average standard deviation of split frequencies: 0.041010
60500 -- (-267.029) (-268.216) [-267.857] (-268.953) * (-270.272) [-266.414] (-271.111) (-267.169) -- 0:01:17
61000 -- (-268.359) (-267.187) (-272.213) [-267.204] * (-273.954) (-266.849) [-270.259] (-267.533) -- 0:01:16
61500 -- (-269.501) (-268.746) [-269.909] (-270.294) * (-272.779) (-270.533) (-268.754) [-268.895] -- 0:01:16
62000 -- (-270.805) (-267.407) [-268.508] (-268.729) * (-268.493) (-268.578) (-267.701) [-270.697] -- 0:01:15
62500 -- (-267.902) (-267.541) [-265.665] (-269.201) * (-272.141) [-266.467] (-266.817) (-270.750) -- 0:01:15
63000 -- (-273.278) [-268.400] (-267.452) (-266.952) * [-272.349] (-269.604) (-265.836) (-267.569) -- 0:01:14
63500 -- (-268.407) (-269.939) [-269.996] (-268.055) * (-271.046) (-266.062) (-272.447) [-268.575] -- 0:01:13
64000 -- (-268.700) (-269.236) (-268.253) [-268.277] * (-267.495) [-267.056] (-267.629) (-271.063) -- 0:01:13
64500 -- (-269.456) [-269.821] (-266.784) (-270.405) * [-268.546] (-272.870) (-268.456) (-269.581) -- 0:01:12
65000 -- (-270.585) [-267.403] (-269.543) (-269.256) * (-269.292) (-268.643) (-271.442) [-267.023] -- 0:01:11
Average standard deviation of split frequencies: 0.033927
65500 -- [-268.160] (-270.289) (-267.095) (-270.705) * (-268.572) (-266.975) [-275.837] (-266.674) -- 0:01:11
66000 -- (-266.437) (-273.852) (-266.834) [-274.379] * (-271.477) (-269.199) (-270.855) [-268.976] -- 0:01:10
66500 -- (-268.313) [-268.173] (-268.033) (-268.971) * [-268.141] (-266.641) (-270.419) (-267.509) -- 0:01:10
67000 -- (-268.087) [-270.175] (-269.253) (-269.672) * (-270.244) (-265.730) [-272.640] (-268.175) -- 0:01:09
67500 -- [-268.121] (-267.922) (-271.129) (-273.269) * (-268.145) (-267.601) (-268.334) [-269.384] -- 0:01:09
68000 -- (-268.327) (-269.732) (-268.161) [-268.253] * [-268.773] (-268.229) (-269.969) (-273.535) -- 0:01:08
68500 -- [-270.071] (-270.728) (-270.858) (-269.092) * (-270.617) (-267.605) (-268.991) [-269.663] -- 0:01:07
69000 -- (-270.044) (-270.074) [-269.805] (-273.367) * [-268.537] (-268.986) (-271.716) (-268.081) -- 0:01:07
69500 -- (-267.932) (-267.316) [-270.848] (-268.775) * [-269.086] (-267.795) (-272.011) (-269.896) -- 0:01:06
70000 -- (-267.097) [-269.242] (-267.594) (-267.063) * (-273.132) (-270.069) (-271.044) [-269.954] -- 0:01:06
Average standard deviation of split frequencies: 0.030019
70500 -- (-269.624) (-268.664) [-268.590] (-270.440) * [-268.653] (-266.297) (-269.355) (-270.532) -- 0:01:05
71000 -- [-268.970] (-267.764) (-267.475) (-267.505) * (-270.960) (-271.153) [-267.268] (-268.997) -- 0:01:05
71500 -- (-265.618) (-271.160) [-271.550] (-271.957) * [-270.272] (-271.649) (-272.883) (-269.183) -- 0:01:04
72000 -- (-268.115) (-271.066) [-267.295] (-269.584) * (-270.774) (-268.965) [-270.193] (-268.400) -- 0:01:04
72500 -- [-266.279] (-269.808) (-269.369) (-266.491) * (-271.893) (-267.583) [-268.879] (-267.572) -- 0:01:03
73000 -- [-268.332] (-265.821) (-269.764) (-269.324) * (-270.073) (-268.538) (-270.170) [-269.125] -- 0:01:03
73500 -- (-273.232) (-269.719) [-270.076] (-267.151) * (-269.376) [-274.564] (-267.192) (-269.532) -- 0:01:03
74000 -- (-271.169) (-270.776) (-266.910) [-269.613] * (-269.567) (-271.532) [-265.727] (-268.333) -- 0:01:02
74500 -- (-269.846) (-269.754) (-267.959) [-267.008] * (-268.441) (-270.513) (-267.745) [-271.125] -- 0:01:02
75000 -- [-267.575] (-273.098) (-269.513) (-267.902) * (-269.210) (-269.804) (-270.100) [-267.970] -- 0:01:01
Average standard deviation of split frequencies: 0.029773
75500 -- [-269.204] (-267.616) (-267.803) (-270.958) * [-267.441] (-268.850) (-268.223) (-269.552) -- 0:01:01
76000 -- (-269.978) (-266.874) [-268.064] (-276.694) * [-273.601] (-269.386) (-266.719) (-269.913) -- 0:01:12
76500 -- [-268.175] (-269.979) (-268.893) (-272.899) * (-269.511) (-269.387) [-268.052] (-268.198) -- 0:01:12
77000 -- (-268.760) (-267.938) (-268.432) [-270.671] * [-271.449] (-271.572) (-266.597) (-267.994) -- 0:01:11
77500 -- [-268.334] (-272.514) (-267.938) (-268.550) * [-269.034] (-272.139) (-271.415) (-268.768) -- 0:01:11
78000 -- (-266.466) (-267.944) (-269.164) [-267.541] * [-269.883] (-271.654) (-269.869) (-268.132) -- 0:01:10
78500 -- (-267.987) (-267.727) [-267.860] (-269.012) * (-268.789) (-269.373) [-268.404] (-265.842) -- 0:01:10
79000 -- (-271.705) (-268.545) [-267.995] (-270.781) * (-270.898) [-269.781] (-267.892) (-267.476) -- 0:01:09
79500 -- [-271.482] (-266.093) (-267.739) (-269.377) * (-273.384) (-270.669) (-267.013) [-265.408] -- 0:01:09
80000 -- (-267.397) (-267.035) (-267.766) [-268.427] * (-269.731) (-270.624) (-267.501) [-267.902] -- 0:01:09
Average standard deviation of split frequencies: 0.028604
80500 -- [-265.603] (-270.741) (-268.437) (-269.237) * [-271.068] (-269.873) (-271.994) (-271.457) -- 0:01:08
81000 -- (-267.040) (-271.535) (-267.298) [-267.715] * [-271.969] (-276.802) (-271.698) (-273.200) -- 0:01:08
81500 -- (-267.833) (-272.579) [-267.891] (-271.134) * (-269.819) [-266.549] (-268.765) (-271.246) -- 0:01:07
82000 -- (-267.705) (-276.174) (-269.036) [-272.405] * (-268.556) [-266.705] (-271.443) (-269.723) -- 0:01:07
82500 -- (-269.019) (-269.575) [-265.535] (-269.061) * [-268.630] (-268.166) (-273.459) (-268.998) -- 0:01:06
83000 -- [-270.535] (-268.263) (-268.302) (-266.976) * [-268.168] (-270.164) (-269.057) (-271.889) -- 0:01:06
83500 -- (-267.904) (-270.758) (-265.511) [-267.107] * (-271.973) [-267.558] (-268.170) (-270.468) -- 0:01:05
84000 -- (-266.738) (-269.807) (-266.686) [-269.247] * [-268.257] (-268.683) (-270.916) (-271.041) -- 0:01:05
84500 -- (-267.933) (-271.317) [-266.645] (-273.947) * (-268.482) [-268.621] (-266.041) (-270.270) -- 0:01:05
85000 -- (-268.566) (-274.246) (-269.104) [-268.738] * [-267.265] (-266.924) (-266.484) (-268.365) -- 0:01:04
Average standard deviation of split frequencies: 0.025763
85500 -- [-268.836] (-272.753) (-266.835) (-267.469) * (-267.958) (-269.166) (-267.317) [-267.518] -- 0:01:04
86000 -- (-267.956) (-268.901) [-267.217] (-267.050) * [-267.823] (-266.541) (-270.584) (-265.702) -- 0:01:03
86500 -- (-268.403) (-268.362) [-267.579] (-268.627) * [-266.547] (-268.009) (-269.319) (-266.379) -- 0:01:03
87000 -- (-266.062) (-272.883) (-270.526) [-267.540] * [-266.191] (-267.750) (-269.995) (-267.661) -- 0:01:02
87500 -- [-267.645] (-271.913) (-268.943) (-269.691) * (-267.099) (-269.679) [-267.209] (-266.850) -- 0:01:02
88000 -- (-268.185) [-268.318] (-269.336) (-269.346) * [-267.594] (-273.388) (-266.632) (-268.774) -- 0:01:02
88500 -- (-267.768) (-267.927) (-266.486) [-269.060] * [-266.447] (-265.601) (-269.573) (-269.225) -- 0:01:01
89000 -- (-267.434) (-270.235) [-266.426] (-266.980) * (-269.239) (-265.720) (-272.332) [-272.608] -- 0:01:01
89500 -- [-267.139] (-271.462) (-272.110) (-269.677) * (-267.843) (-271.456) [-270.856] (-267.240) -- 0:01:01
90000 -- (-269.766) (-271.768) (-269.590) [-269.616] * (-269.556) [-268.830] (-268.580) (-267.647) -- 0:01:00
Average standard deviation of split frequencies: 0.022530
90500 -- (-270.430) (-275.735) (-270.627) [-269.760] * [-267.616] (-267.280) (-270.932) (-269.227) -- 0:01:00
91000 -- (-267.376) (-269.998) [-268.032] (-266.805) * (-268.299) (-270.068) (-266.546) [-267.757] -- 0:00:59
91500 -- (-269.406) (-267.880) (-270.479) [-269.296] * [-269.738] (-268.394) (-266.504) (-266.184) -- 0:00:59
92000 -- (-270.992) [-270.878] (-268.945) (-269.700) * (-267.371) (-270.058) [-267.054] (-268.929) -- 0:01:09
92500 -- [-270.291] (-269.607) (-273.181) (-268.681) * (-267.402) [-267.569] (-269.161) (-267.789) -- 0:01:08
93000 -- (-266.113) (-271.798) [-266.201] (-271.330) * (-270.541) (-268.435) (-267.143) [-267.176] -- 0:01:08
93500 -- [-269.070] (-268.201) (-269.068) (-268.673) * (-272.615) (-269.518) (-267.925) [-267.650] -- 0:01:07
94000 -- (-266.739) (-269.031) [-269.620] (-268.824) * (-270.045) (-268.147) [-273.589] (-269.113) -- 0:01:07
94500 -- [-271.159] (-268.790) (-269.193) (-270.818) * (-271.777) [-269.436] (-268.012) (-272.917) -- 0:01:07
95000 -- [-269.032] (-269.128) (-267.994) (-267.395) * (-268.390) (-271.947) [-268.424] (-269.520) -- 0:01:06
Average standard deviation of split frequencies: 0.023002
95500 -- (-271.278) [-267.758] (-270.948) (-270.137) * (-268.697) (-270.898) [-269.028] (-273.608) -- 0:01:06
96000 -- [-267.975] (-270.382) (-272.599) (-269.213) * (-269.243) (-272.386) [-267.212] (-272.117) -- 0:01:05
96500 -- (-268.561) [-268.547] (-270.084) (-267.568) * [-267.969] (-269.150) (-267.584) (-269.555) -- 0:01:05
97000 -- (-269.760) (-270.116) [-269.253] (-267.066) * (-267.655) [-269.867] (-268.833) (-270.472) -- 0:01:05
97500 -- (-271.386) (-269.383) (-265.833) [-268.717] * [-269.112] (-270.968) (-267.236) (-269.156) -- 0:01:04
98000 -- (-270.598) [-268.341] (-270.272) (-268.709) * (-270.185) (-268.860) [-268.741] (-266.741) -- 0:01:04
98500 -- (-270.692) (-268.989) [-267.513] (-269.566) * (-270.617) [-272.588] (-266.555) (-270.337) -- 0:01:04
99000 -- (-268.084) (-267.913) [-267.394] (-272.859) * [-267.809] (-270.157) (-269.058) (-269.843) -- 0:01:03
99500 -- (-270.318) (-270.168) (-269.216) [-266.609] * (-266.297) (-270.935) [-271.500] (-271.296) -- 0:01:03
100000 -- (-271.331) (-269.783) (-269.117) [-268.481] * [-270.045] (-269.603) (-275.475) (-271.725) -- 0:01:02
Average standard deviation of split frequencies: 0.024646
100500 -- (-270.746) [-271.414] (-275.182) (-269.173) * (-269.226) [-269.764] (-271.093) (-274.294) -- 0:01:02
101000 -- [-268.540] (-270.294) (-272.801) (-269.387) * (-267.752) (-268.959) [-266.887] (-267.477) -- 0:01:02
101500 -- [-268.088] (-274.048) (-270.521) (-269.614) * [-267.461] (-272.532) (-267.195) (-265.851) -- 0:01:01
102000 -- (-268.766) (-271.752) [-266.641] (-272.467) * [-269.259] (-267.307) (-267.928) (-267.897) -- 0:01:01
102500 -- (-266.969) (-274.050) (-267.928) [-267.939] * (-267.437) (-269.259) (-267.826) [-270.004] -- 0:01:01
103000 -- (-268.737) [-271.654] (-268.978) (-271.626) * (-267.156) [-267.615] (-266.493) (-268.173) -- 0:01:00
103500 -- (-268.479) [-268.951] (-268.912) (-267.962) * [-267.719] (-272.646) (-268.367) (-268.935) -- 0:01:00
104000 -- (-266.856) [-266.924] (-270.101) (-269.324) * (-266.757) (-273.635) [-267.803] (-273.035) -- 0:01:00
104500 -- [-268.952] (-270.573) (-270.479) (-270.187) * (-270.975) (-272.319) [-268.538] (-273.250) -- 0:00:59
105000 -- (-269.338) (-268.339) [-267.338] (-271.370) * [-270.246] (-270.013) (-272.296) (-268.782) -- 0:00:59
Average standard deviation of split frequencies: 0.022002
105500 -- (-268.764) (-266.977) [-268.314] (-268.443) * [-267.393] (-270.998) (-271.544) (-270.370) -- 0:00:59
106000 -- (-268.411) (-269.531) (-269.093) [-269.294] * (-271.278) [-268.700] (-269.163) (-270.440) -- 0:00:59
106500 -- (-267.900) [-268.675] (-269.624) (-268.499) * (-269.865) (-269.790) [-269.122] (-267.895) -- 0:00:58
107000 -- [-268.433] (-274.257) (-269.572) (-271.633) * (-268.146) [-268.742] (-272.780) (-267.625) -- 0:00:58
107500 -- (-272.332) (-276.190) [-268.546] (-268.974) * (-270.977) [-271.605] (-269.328) (-269.128) -- 0:00:58
108000 -- (-271.191) (-274.628) (-266.997) [-268.351] * (-266.832) [-268.669] (-269.758) (-267.213) -- 0:01:06
108500 -- (-270.008) (-273.308) [-273.549] (-269.334) * [-268.016] (-268.431) (-268.943) (-267.831) -- 0:01:05
109000 -- (-269.501) [-268.911] (-274.426) (-271.163) * (-270.075) (-267.457) [-269.672] (-267.773) -- 0:01:05
109500 -- (-270.688) [-268.892] (-270.493) (-269.658) * (-268.496) [-269.414] (-270.367) (-268.707) -- 0:01:05
110000 -- (-270.840) (-272.072) [-267.820] (-270.354) * [-269.793] (-268.416) (-269.461) (-266.342) -- 0:01:04
Average standard deviation of split frequencies: 0.022644
110500 -- (-269.296) (-268.185) [-268.790] (-267.064) * (-272.734) (-271.921) (-271.600) [-268.574] -- 0:01:04
111000 -- (-272.732) (-268.079) [-265.980] (-267.517) * (-269.872) (-269.406) (-271.291) [-268.243] -- 0:01:04
111500 -- (-269.676) (-272.021) [-267.367] (-266.115) * (-269.033) (-269.762) (-271.707) [-269.983] -- 0:01:03
112000 -- (-269.839) (-272.003) (-268.515) [-270.529] * (-268.814) (-270.903) (-269.166) [-267.863] -- 0:01:03
112500 -- (-268.904) (-266.275) (-269.884) [-269.393] * (-270.789) [-269.009] (-267.531) (-266.688) -- 0:01:03
113000 -- (-272.180) [-268.416] (-269.835) (-268.948) * (-268.492) [-270.206] (-272.423) (-268.731) -- 0:01:02
113500 -- (-276.409) (-268.397) [-269.046] (-270.096) * (-269.827) (-267.676) (-269.764) [-268.882] -- 0:01:02
114000 -- (-269.203) (-268.966) (-272.099) [-268.776] * [-269.160] (-267.737) (-268.171) (-269.996) -- 0:01:02
114500 -- (-271.203) [-267.594] (-269.839) (-268.005) * (-268.819) (-269.443) [-270.210] (-267.404) -- 0:01:01
115000 -- (-269.910) [-268.083] (-270.735) (-268.468) * (-269.914) (-269.913) [-267.315] (-267.687) -- 0:01:01
Average standard deviation of split frequencies: 0.021867
115500 -- (-267.061) (-271.225) (-274.623) [-270.172] * (-270.173) (-270.764) (-269.366) [-266.502] -- 0:01:01
116000 -- (-265.845) [-266.150] (-272.646) (-269.417) * [-267.133] (-269.981) (-268.573) (-269.450) -- 0:01:00
116500 -- (-268.852) [-267.207] (-269.590) (-270.220) * (-270.269) (-270.154) (-273.381) [-270.637] -- 0:01:00
117000 -- (-269.288) (-268.056) (-267.060) [-269.357] * (-269.115) (-270.237) (-273.526) [-268.579] -- 0:01:00
117500 -- (-268.477) (-268.277) [-266.713] (-272.473) * [-270.361] (-271.033) (-269.840) (-269.249) -- 0:01:00
118000 -- (-267.132) [-267.238] (-267.214) (-271.152) * (-268.362) (-268.304) (-269.620) [-266.763] -- 0:00:59
118500 -- (-270.130) (-272.647) (-268.016) [-268.240] * (-265.935) [-268.393] (-269.482) (-267.806) -- 0:00:59
119000 -- (-267.775) [-266.594] (-269.342) (-268.812) * (-269.587) [-268.297] (-268.890) (-267.261) -- 0:00:59
119500 -- (-272.969) [-267.604] (-267.207) (-266.331) * (-268.043) (-267.642) [-270.451] (-269.916) -- 0:00:58
120000 -- (-271.131) [-268.278] (-268.899) (-267.175) * [-273.716] (-268.612) (-270.345) (-268.598) -- 0:00:58
Average standard deviation of split frequencies: 0.019739
120500 -- (-265.523) (-269.005) (-268.416) [-269.748] * (-270.824) [-269.680] (-269.054) (-268.487) -- 0:00:58
121000 -- (-266.350) (-269.535) (-275.443) [-270.923] * [-275.259] (-269.528) (-267.185) (-266.389) -- 0:00:58
121500 -- (-268.526) (-270.496) (-272.164) [-266.858] * (-268.820) (-271.323) [-268.088] (-269.473) -- 0:00:57
122000 -- (-273.599) (-272.609) (-273.209) [-267.161] * (-271.903) [-267.766] (-270.935) (-267.550) -- 0:00:57
122500 -- (-270.487) (-269.458) (-275.926) [-268.965] * (-270.274) (-266.656) (-265.840) [-267.806] -- 0:00:57
123000 -- (-268.589) [-270.774] (-272.462) (-269.209) * [-269.835] (-271.211) (-269.664) (-266.466) -- 0:00:57
123500 -- (-269.249) [-268.889] (-270.780) (-269.214) * (-267.597) (-271.401) (-269.681) [-267.877] -- 0:01:03
124000 -- [-267.791] (-271.097) (-269.550) (-270.994) * (-266.659) [-269.408] (-274.384) (-268.941) -- 0:01:03
124500 -- (-269.256) (-269.050) [-268.041] (-267.051) * (-267.690) (-267.528) [-274.102] (-268.330) -- 0:01:03
125000 -- (-270.103) [-274.228] (-271.511) (-268.062) * (-268.519) (-268.601) [-267.026] (-267.897) -- 0:01:03
Average standard deviation of split frequencies: 0.019954
125500 -- (-269.538) [-267.731] (-269.078) (-267.571) * [-267.523] (-267.580) (-269.568) (-268.094) -- 0:01:02
126000 -- [-270.103] (-268.715) (-271.767) (-265.812) * (-267.634) (-271.293) (-272.956) [-267.277] -- 0:01:02
126500 -- [-269.239] (-267.767) (-269.758) (-271.257) * (-270.886) (-268.661) [-273.913] (-269.118) -- 0:01:02
127000 -- (-272.715) [-267.250] (-268.817) (-269.152) * (-271.186) (-268.854) (-271.202) [-266.411] -- 0:01:01
127500 -- (-272.243) [-268.292] (-269.128) (-271.050) * (-268.310) (-273.299) [-269.078] (-267.962) -- 0:01:01
128000 -- (-268.292) [-269.781] (-266.983) (-270.333) * (-270.545) [-270.828] (-269.399) (-269.251) -- 0:01:01
128500 -- (-269.982) (-269.564) (-270.214) [-271.039] * [-267.479] (-273.287) (-268.205) (-268.418) -- 0:01:01
129000 -- (-269.712) [-265.541] (-271.249) (-269.591) * (-268.895) (-269.292) [-269.656] (-271.233) -- 0:01:00
129500 -- (-270.292) [-269.989] (-266.773) (-267.005) * (-269.085) (-269.111) [-267.185] (-267.601) -- 0:01:00
130000 -- (-275.685) [-269.578] (-268.974) (-266.874) * (-270.730) (-269.970) [-268.015] (-270.772) -- 0:01:00
Average standard deviation of split frequencies: 0.019937
130500 -- (-266.814) (-267.748) (-267.910) [-270.136] * (-270.855) [-268.153] (-268.234) (-268.725) -- 0:00:59
131000 -- [-269.477] (-267.535) (-268.670) (-272.641) * (-270.080) (-268.912) [-267.084] (-267.954) -- 0:00:59
131500 -- (-270.788) (-267.584) (-269.738) [-273.856] * (-273.077) (-269.095) [-266.210] (-270.039) -- 0:00:59
132000 -- [-270.065] (-267.485) (-267.003) (-268.591) * [-269.291] (-270.473) (-267.359) (-269.691) -- 0:00:59
132500 -- (-267.727) (-269.019) (-269.681) [-268.016] * (-271.448) (-267.418) (-267.209) [-268.559] -- 0:00:58
133000 -- (-266.566) (-268.722) (-268.844) [-271.286] * [-269.015] (-270.826) (-267.160) (-268.286) -- 0:00:58
133500 -- [-267.382] (-272.798) (-268.864) (-267.728) * (-269.978) [-270.730] (-268.612) (-268.269) -- 0:00:58
134000 -- (-270.563) (-268.385) [-268.616] (-269.410) * [-267.502] (-269.459) (-267.887) (-267.732) -- 0:00:58
134500 -- (-270.109) (-270.683) [-269.746] (-269.968) * (-271.290) (-272.110) [-268.306] (-267.429) -- 0:00:57
135000 -- (-265.936) (-268.243) [-267.560] (-269.438) * (-274.289) (-270.240) [-270.808] (-269.425) -- 0:00:57
Average standard deviation of split frequencies: 0.019703
135500 -- (-269.642) (-267.809) [-268.806] (-269.109) * (-273.194) (-269.205) (-267.899) [-268.939] -- 0:00:57
136000 -- (-272.464) (-266.543) [-266.223] (-268.697) * (-266.393) (-267.800) (-272.077) [-269.715] -- 0:00:57
136500 -- (-270.204) (-268.012) [-266.550] (-269.114) * [-266.790] (-272.082) (-270.275) (-268.530) -- 0:00:56
137000 -- (-269.190) [-269.329] (-268.607) (-268.912) * (-268.338) (-271.681) [-270.946] (-269.511) -- 0:00:56
137500 -- (-272.633) (-267.635) [-268.453] (-268.900) * (-267.720) (-269.853) [-273.702] (-270.570) -- 0:00:56
138000 -- (-271.624) [-271.054] (-268.733) (-271.245) * [-267.359] (-268.061) (-270.580) (-269.750) -- 0:00:56
138500 -- (-267.934) (-267.208) (-268.770) [-268.997] * (-270.008) (-270.703) [-268.454] (-269.108) -- 0:00:55
139000 -- (-268.536) [-267.347] (-272.089) (-276.823) * (-266.120) [-268.902] (-268.990) (-268.537) -- 0:00:55
139500 -- [-269.328] (-268.648) (-270.227) (-273.461) * [-266.848] (-270.481) (-269.884) (-268.064) -- 0:01:01
140000 -- (-266.693) (-268.338) [-268.046] (-269.989) * [-267.431] (-273.923) (-268.620) (-267.440) -- 0:01:01
Average standard deviation of split frequencies: 0.017462
140500 -- (-267.856) (-267.833) [-269.603] (-269.947) * (-269.189) [-267.899] (-269.323) (-268.046) -- 0:01:01
141000 -- (-271.072) [-267.874] (-269.679) (-270.619) * (-267.424) (-268.737) (-269.200) [-270.507] -- 0:01:00
141500 -- (-267.169) (-267.250) [-268.824] (-269.451) * [-270.733] (-270.340) (-270.187) (-270.520) -- 0:01:00
142000 -- [-270.938] (-270.081) (-273.173) (-267.943) * [-267.597] (-271.649) (-268.078) (-269.228) -- 0:01:00
142500 -- [-267.627] (-270.882) (-270.334) (-270.227) * (-268.453) (-268.734) [-269.733] (-268.857) -- 0:01:00
143000 -- (-267.914) (-271.300) (-268.236) [-269.217] * [-269.355] (-270.724) (-271.711) (-271.942) -- 0:00:59
143500 -- (-268.120) (-270.622) [-266.854] (-268.390) * [-265.745] (-269.638) (-271.247) (-271.983) -- 0:00:59
144000 -- [-269.964] (-268.056) (-268.936) (-270.141) * (-270.804) (-269.730) [-268.684] (-270.403) -- 0:00:59
144500 -- (-269.863) (-269.309) (-268.185) [-268.401] * (-269.517) (-266.732) [-267.610] (-270.969) -- 0:00:59
145000 -- (-268.659) [-271.163] (-266.303) (-268.069) * (-269.862) (-265.889) [-270.881] (-276.181) -- 0:00:58
Average standard deviation of split frequencies: 0.017597
145500 -- (-269.500) (-269.306) [-269.500] (-272.539) * [-268.929] (-268.024) (-272.053) (-275.446) -- 0:00:58
146000 -- (-269.537) (-275.082) [-270.111] (-268.178) * (-268.715) (-266.238) (-268.910) [-272.110] -- 0:00:58
146500 -- (-268.697) (-270.596) (-271.268) [-269.032] * (-268.315) [-268.056] (-267.546) (-270.133) -- 0:00:58
147000 -- (-269.346) (-266.894) (-271.062) [-268.160] * [-267.773] (-269.559) (-267.781) (-269.877) -- 0:00:58
147500 -- (-273.738) [-267.150] (-269.174) (-268.812) * (-268.250) (-268.251) (-272.394) [-270.683] -- 0:00:57
148000 -- (-274.607) (-271.247) (-274.172) [-271.543] * (-268.280) (-265.328) [-271.077] (-269.779) -- 0:00:57
148500 -- [-268.753] (-270.006) (-269.818) (-268.806) * (-272.231) (-266.796) (-269.951) [-273.589] -- 0:00:57
149000 -- (-273.596) (-269.677) [-269.927] (-268.461) * [-269.795] (-268.253) (-267.795) (-269.616) -- 0:00:57
149500 -- (-268.478) (-267.884) (-266.505) [-268.578] * (-268.837) (-273.227) (-268.108) [-269.629] -- 0:00:56
150000 -- (-267.675) (-267.406) (-272.111) [-268.483] * (-269.544) (-272.941) [-268.064] (-270.053) -- 0:00:56
Average standard deviation of split frequencies: 0.018599
150500 -- (-267.468) (-266.661) (-269.450) [-268.154] * [-268.076] (-271.638) (-268.334) (-269.010) -- 0:00:56
151000 -- (-267.724) (-266.441) (-269.691) [-269.323] * (-267.324) [-268.295] (-269.589) (-267.811) -- 0:00:56
151500 -- (-266.276) [-267.506] (-272.115) (-269.378) * [-268.359] (-270.780) (-270.741) (-267.827) -- 0:00:56
152000 -- [-265.997] (-270.004) (-271.085) (-269.347) * (-266.946) (-271.902) [-268.179] (-269.305) -- 0:00:55
152500 -- [-268.632] (-270.591) (-270.175) (-269.500) * (-268.520) (-268.973) [-267.303] (-272.695) -- 0:00:55
153000 -- (-273.114) (-266.468) [-268.146] (-271.210) * (-270.823) [-267.520] (-269.579) (-270.862) -- 0:00:55
153500 -- (-270.231) (-268.176) (-274.588) [-270.158] * (-271.808) (-267.748) (-269.687) [-270.127] -- 0:00:55
154000 -- (-272.537) (-270.972) [-266.244] (-268.160) * (-269.087) [-266.986] (-270.235) (-268.889) -- 0:00:54
154500 -- (-272.844) [-269.526] (-271.311) (-267.600) * (-269.822) (-269.130) (-269.935) [-268.117] -- 0:00:54
155000 -- (-268.822) (-271.402) [-266.763] (-269.119) * (-269.897) [-267.212] (-270.516) (-266.872) -- 0:00:54
Average standard deviation of split frequencies: 0.018635
155500 -- (-271.020) [-269.633] (-270.569) (-269.826) * [-268.963] (-275.441) (-267.895) (-269.642) -- 0:00:59
156000 -- (-268.947) (-270.470) (-270.156) [-268.352] * (-267.146) (-268.427) (-268.548) [-267.805] -- 0:00:59
156500 -- (-269.104) (-268.821) (-268.995) [-268.908] * (-266.690) [-267.383] (-270.149) (-268.180) -- 0:00:59
157000 -- (-268.973) (-268.439) (-267.149) [-269.091] * (-268.286) (-265.702) (-270.262) [-265.998] -- 0:00:59
157500 -- (-268.041) (-266.090) [-268.131] (-269.155) * (-266.296) [-266.529] (-267.193) (-268.491) -- 0:00:58
158000 -- (-273.473) (-271.083) [-267.145] (-269.555) * (-271.178) (-267.225) [-268.197] (-272.138) -- 0:00:58
158500 -- (-271.359) [-266.071] (-269.496) (-268.053) * (-273.701) [-266.125] (-270.361) (-267.737) -- 0:00:58
159000 -- [-266.280] (-267.457) (-268.029) (-270.255) * (-266.068) (-271.438) (-264.928) [-267.071] -- 0:00:58
159500 -- (-268.426) (-268.715) [-269.269] (-271.601) * (-269.451) (-266.606) [-271.785] (-266.834) -- 0:00:57
160000 -- [-266.750] (-269.231) (-267.356) (-268.947) * (-271.034) (-266.746) (-273.083) [-266.035] -- 0:00:57
Average standard deviation of split frequencies: 0.021747
160500 -- (-268.438) (-269.587) (-266.351) [-268.289] * (-267.955) (-270.215) [-266.770] (-266.391) -- 0:00:57
161000 -- (-268.678) (-266.595) (-266.773) [-267.836] * (-265.979) (-269.367) (-269.552) [-270.742] -- 0:00:57
161500 -- (-268.494) (-268.421) [-270.202] (-269.951) * (-270.685) (-271.401) [-267.225] (-269.701) -- 0:00:57
162000 -- [-265.868] (-268.615) (-269.256) (-268.532) * [-268.168] (-272.218) (-266.600) (-268.907) -- 0:00:56
162500 -- (-269.329) (-273.442) (-269.694) [-272.162] * (-268.570) (-267.830) (-272.289) [-273.243] -- 0:00:56
163000 -- (-268.069) (-272.157) (-275.587) [-271.207] * (-269.119) [-266.063] (-266.041) (-267.615) -- 0:00:56
163500 -- (-272.996) [-268.475] (-272.207) (-272.007) * (-271.755) [-267.561] (-268.635) (-271.692) -- 0:00:56
164000 -- (-271.653) (-267.260) (-274.031) [-270.157] * (-270.558) (-268.818) [-269.624] (-267.671) -- 0:00:56
164500 -- [-270.104] (-267.926) (-269.786) (-269.669) * [-268.231] (-270.927) (-268.179) (-267.985) -- 0:00:55
165000 -- (-266.705) (-271.189) (-270.840) [-268.787] * (-268.090) (-268.471) [-270.207] (-270.030) -- 0:00:55
Average standard deviation of split frequencies: 0.020177
165500 -- (-268.471) [-267.226] (-271.892) (-272.031) * [-269.806] (-267.769) (-267.074) (-268.495) -- 0:00:55
166000 -- [-268.687] (-267.350) (-273.219) (-270.021) * (-268.979) (-271.473) [-267.383] (-269.673) -- 0:00:55
166500 -- (-267.960) (-268.922) [-274.329] (-269.277) * (-272.058) (-269.607) (-270.817) [-268.270] -- 0:00:55
167000 -- [-268.754] (-270.926) (-269.836) (-269.069) * (-267.856) (-269.622) [-268.856] (-271.264) -- 0:00:54
167500 -- (-269.993) [-269.524] (-275.771) (-270.959) * (-268.954) (-268.879) (-268.644) [-267.953] -- 0:00:54
168000 -- (-268.494) (-270.507) (-269.395) [-271.239] * (-270.470) (-271.059) [-268.913] (-266.412) -- 0:00:54
168500 -- (-267.398) (-270.525) [-270.742] (-271.180) * [-268.725] (-267.826) (-274.049) (-269.607) -- 0:00:54
169000 -- [-267.312] (-267.228) (-267.461) (-272.839) * (-271.254) (-266.475) [-273.536] (-271.058) -- 0:00:54
169500 -- (-269.531) [-270.327] (-270.256) (-269.111) * (-268.323) [-268.501] (-271.672) (-267.834) -- 0:00:53
170000 -- (-270.205) (-269.213) (-274.296) [-268.598] * [-265.692] (-268.527) (-269.336) (-267.294) -- 0:00:53
Average standard deviation of split frequencies: 0.021661
170500 -- [-269.804] (-269.652) (-270.895) (-269.282) * (-270.636) (-277.174) [-270.709] (-271.159) -- 0:00:53
171000 -- (-269.337) (-270.345) (-270.121) [-267.676] * (-267.599) (-271.065) (-265.673) [-273.322] -- 0:00:58
171500 -- (-269.984) (-268.042) [-270.109] (-271.472) * (-268.876) [-265.763] (-266.308) (-269.360) -- 0:00:57
172000 -- [-268.641] (-268.829) (-272.184) (-268.271) * (-267.410) (-268.719) [-269.148] (-271.602) -- 0:00:57
172500 -- [-268.405] (-268.714) (-266.625) (-269.116) * (-266.055) (-272.625) [-268.192] (-270.207) -- 0:00:57
173000 -- (-270.765) (-266.243) (-266.479) [-269.761] * (-268.034) (-271.831) [-270.627] (-269.988) -- 0:00:57
173500 -- (-273.777) [-267.529] (-269.529) (-269.588) * (-267.727) (-270.796) [-266.542] (-270.753) -- 0:00:57
174000 -- (-269.868) (-267.673) (-269.915) [-269.377] * [-266.125] (-270.828) (-271.861) (-267.092) -- 0:00:56
174500 -- (-269.557) [-266.856] (-269.015) (-268.078) * (-267.900) [-266.471] (-266.786) (-269.303) -- 0:00:56
175000 -- (-268.212) (-268.720) [-268.413] (-268.652) * (-267.996) (-269.545) [-268.008] (-266.333) -- 0:00:56
Average standard deviation of split frequencies: 0.021991
175500 -- (-271.254) (-267.022) [-266.730] (-270.480) * (-265.857) (-268.551) [-267.850] (-267.683) -- 0:00:56
176000 -- (-271.973) [-267.621] (-268.236) (-274.236) * [-268.415] (-268.158) (-268.791) (-266.688) -- 0:00:56
176500 -- (-266.746) (-270.925) [-266.964] (-270.079) * (-266.513) (-268.499) (-269.640) [-267.871] -- 0:00:55
177000 -- [-268.168] (-268.248) (-267.399) (-269.498) * (-267.842) (-268.116) [-268.301] (-270.178) -- 0:00:55
177500 -- [-267.937] (-267.343) (-269.262) (-272.757) * (-271.583) [-268.077] (-266.390) (-268.836) -- 0:00:55
178000 -- (-265.934) [-268.213] (-270.397) (-277.386) * (-271.756) (-269.482) (-267.673) [-269.488] -- 0:00:55
178500 -- (-269.484) (-266.929) [-267.638] (-272.295) * (-268.093) [-266.607] (-266.529) (-270.609) -- 0:00:55
179000 -- (-268.384) (-266.960) [-270.249] (-269.037) * (-267.495) (-267.609) (-268.649) [-267.522] -- 0:00:55
179500 -- (-271.598) (-266.414) [-267.733] (-273.470) * (-268.946) (-267.792) [-269.475] (-267.926) -- 0:00:54
180000 -- (-267.931) (-268.687) (-266.811) [-267.196] * [-267.522] (-269.704) (-268.843) (-266.346) -- 0:00:54
Average standard deviation of split frequencies: 0.020874
180500 -- (-268.147) [-267.241] (-267.117) (-270.094) * (-268.673) [-265.310] (-267.423) (-267.736) -- 0:00:54
181000 -- (-269.248) (-266.087) (-267.075) [-270.233] * (-266.133) (-270.120) [-268.147] (-267.512) -- 0:00:54
181500 -- [-266.059] (-271.568) (-268.591) (-269.451) * [-267.230] (-275.291) (-270.586) (-266.275) -- 0:00:54
182000 -- [-267.089] (-271.881) (-265.673) (-268.566) * (-267.970) (-269.986) [-270.900] (-269.709) -- 0:00:53
182500 -- [-271.457] (-269.570) (-270.493) (-267.321) * (-268.830) (-269.677) [-269.535] (-272.457) -- 0:00:53
183000 -- (-272.831) [-269.088] (-268.871) (-268.851) * (-270.249) [-269.697] (-271.392) (-268.508) -- 0:00:53
183500 -- (-271.112) [-268.670] (-269.915) (-269.244) * [-268.530] (-267.556) (-272.809) (-272.627) -- 0:00:53
184000 -- (-269.027) (-268.014) [-267.196] (-268.608) * (-273.851) (-269.543) (-270.192) [-267.024] -- 0:00:53
184500 -- (-267.734) (-266.188) (-268.021) [-267.104] * (-272.459) [-268.254] (-273.152) (-268.970) -- 0:00:53
185000 -- (-266.183) (-270.125) (-268.317) [-267.901] * (-267.003) (-271.722) (-270.968) [-270.035] -- 0:00:52
Average standard deviation of split frequencies: 0.018675
185500 -- (-267.282) (-266.781) [-269.004] (-270.603) * [-270.326] (-271.644) (-270.842) (-267.320) -- 0:00:52
186000 -- [-272.082] (-269.551) (-270.815) (-269.488) * (-266.705) (-268.872) (-268.820) [-267.962] -- 0:00:52
186500 -- (-271.339) [-273.813] (-268.837) (-270.480) * [-265.402] (-267.848) (-269.475) (-269.077) -- 0:00:52
187000 -- (-271.704) (-270.615) (-267.985) [-266.356] * (-269.995) (-270.074) [-269.280] (-268.033) -- 0:00:56
187500 -- (-268.667) (-267.377) (-267.288) [-267.962] * [-268.433] (-267.726) (-270.318) (-266.869) -- 0:00:56
188000 -- (-267.587) (-269.131) [-266.599] (-268.372) * (-267.301) [-268.214] (-269.412) (-271.399) -- 0:00:56
188500 -- (-275.313) (-267.581) [-267.565] (-271.643) * (-269.432) [-269.291] (-268.824) (-268.044) -- 0:00:55
189000 -- (-269.430) [-270.591] (-269.660) (-269.577) * [-270.354] (-268.955) (-268.833) (-268.094) -- 0:00:55
189500 -- (-268.658) (-268.269) [-267.607] (-269.042) * (-270.502) (-269.734) [-267.420] (-270.011) -- 0:00:55
190000 -- [-267.908] (-269.420) (-269.887) (-269.750) * (-271.660) (-266.855) (-268.708) [-270.249] -- 0:00:55
Average standard deviation of split frequencies: 0.019504
190500 -- (-268.345) (-269.022) (-269.817) [-269.205] * (-267.532) (-266.561) (-267.413) [-267.365] -- 0:00:55
191000 -- (-265.941) [-267.937] (-267.649) (-270.358) * (-267.672) [-269.141] (-268.439) (-269.164) -- 0:00:55
191500 -- (-267.696) (-268.639) [-267.667] (-270.276) * (-266.704) [-267.699] (-268.749) (-273.991) -- 0:00:54
192000 -- (-269.885) (-269.595) (-267.684) [-270.316] * (-271.277) (-268.434) [-267.117] (-267.400) -- 0:00:54
192500 -- [-268.666] (-269.528) (-269.596) (-269.684) * (-268.497) (-270.414) [-267.843] (-271.547) -- 0:00:54
193000 -- [-273.988] (-268.200) (-268.678) (-267.476) * (-269.154) [-267.596] (-269.497) (-272.857) -- 0:00:54
193500 -- [-267.417] (-268.221) (-269.328) (-268.187) * [-267.809] (-271.901) (-273.107) (-270.008) -- 0:00:54
194000 -- (-271.536) [-266.802] (-271.903) (-274.850) * (-270.988) (-266.815) [-270.473] (-268.806) -- 0:00:54
194500 -- (-268.361) [-267.718] (-270.571) (-266.046) * (-271.444) (-269.603) [-268.502] (-270.511) -- 0:00:53
195000 -- (-269.435) [-266.761] (-273.173) (-270.640) * (-266.524) (-269.204) (-268.112) [-267.052] -- 0:00:53
Average standard deviation of split frequencies: 0.017685
195500 -- (-271.887) [-269.466] (-269.586) (-271.354) * (-266.860) [-266.041] (-268.035) (-268.187) -- 0:00:53
196000 -- (-269.186) [-267.447] (-270.731) (-267.394) * [-267.458] (-266.604) (-269.024) (-268.803) -- 0:00:53
196500 -- (-271.333) (-270.209) (-269.526) [-272.232] * (-270.139) (-268.974) [-267.795] (-269.305) -- 0:00:53
197000 -- (-265.790) (-270.655) (-269.997) [-269.093] * [-267.630] (-272.217) (-268.052) (-273.029) -- 0:00:52
197500 -- (-268.670) [-266.301] (-270.232) (-268.481) * (-267.121) (-267.988) [-266.625] (-269.273) -- 0:00:52
198000 -- (-268.250) (-270.385) (-270.178) [-270.326] * (-269.615) (-269.108) (-267.785) [-267.821] -- 0:00:52
198500 -- (-267.217) [-267.191] (-269.617) (-269.625) * (-273.396) (-268.176) (-267.070) [-267.958] -- 0:00:52
199000 -- (-268.045) (-268.498) (-272.738) [-268.829] * (-271.036) [-271.776] (-266.389) (-265.740) -- 0:00:52
199500 -- (-268.932) (-270.218) (-270.612) [-266.018] * (-273.748) (-269.761) (-270.433) [-266.519] -- 0:00:52
200000 -- (-267.713) (-266.627) [-268.026] (-268.127) * (-269.843) (-267.430) (-268.284) [-268.970] -- 0:00:51
Average standard deviation of split frequencies: 0.017227
200500 -- [-265.953] (-268.855) (-269.678) (-269.029) * (-268.721) (-269.760) [-277.382] (-267.707) -- 0:00:51
201000 -- (-267.778) [-265.547] (-267.505) (-268.043) * (-269.513) (-267.080) (-269.470) [-267.668] -- 0:00:51
201500 -- (-270.290) (-266.147) (-269.707) [-266.975] * (-271.964) (-266.585) [-268.965] (-267.041) -- 0:00:51
202000 -- (-266.326) [-266.152] (-267.991) (-266.598) * [-270.001] (-268.356) (-266.687) (-267.209) -- 0:00:51
202500 -- (-269.578) (-268.533) [-267.224] (-273.650) * (-273.542) (-269.023) (-268.023) [-268.354] -- 0:00:51
203000 -- (-266.551) (-267.001) [-270.991] (-272.076) * (-272.114) (-267.299) (-272.007) [-267.102] -- 0:00:54
203500 -- [-266.798] (-271.880) (-267.627) (-270.610) * (-272.603) [-268.440] (-273.444) (-266.682) -- 0:00:54
204000 -- [-268.030] (-269.219) (-269.273) (-269.254) * [-271.264] (-267.538) (-270.994) (-267.601) -- 0:00:54
204500 -- (-270.861) [-268.977] (-270.366) (-267.395) * (-271.010) (-270.091) (-267.706) [-267.549] -- 0:00:54
205000 -- (-271.029) (-268.201) (-271.503) [-270.863] * (-269.836) (-269.159) (-266.507) [-268.164] -- 0:00:54
Average standard deviation of split frequencies: 0.017926
205500 -- [-266.321] (-268.426) (-266.914) (-267.006) * (-271.639) (-268.634) (-266.568) [-270.223] -- 0:00:54
206000 -- (-266.200) (-270.621) [-268.566] (-267.829) * (-270.469) (-269.836) [-267.205] (-266.553) -- 0:00:53
206500 -- [-266.090] (-267.948) (-269.283) (-267.900) * (-271.138) (-272.731) (-272.095) [-271.524] -- 0:00:53
207000 -- (-267.413) (-267.225) (-266.823) [-271.230] * (-268.539) (-269.452) (-270.138) [-268.039] -- 0:00:53
207500 -- (-268.821) (-269.782) [-267.060] (-267.536) * [-267.471] (-268.288) (-267.921) (-269.550) -- 0:00:53
208000 -- [-265.919] (-272.270) (-268.233) (-268.422) * (-272.411) (-269.162) (-269.188) [-270.849] -- 0:00:53
208500 -- (-270.141) (-267.316) (-268.419) [-266.912] * [-275.476] (-269.574) (-267.863) (-270.401) -- 0:00:53
209000 -- (-267.563) [-267.372] (-269.058) (-270.332) * (-270.850) (-267.675) (-269.086) [-271.968] -- 0:00:52
209500 -- (-269.207) (-270.335) (-267.267) [-269.484] * (-273.502) (-274.034) (-269.632) [-267.812] -- 0:00:52
210000 -- (-269.627) (-269.305) (-271.102) [-268.772] * (-269.126) (-269.344) (-269.315) [-267.782] -- 0:00:52
Average standard deviation of split frequencies: 0.017638
210500 -- (-265.690) (-268.659) [-269.171] (-268.729) * (-269.878) [-267.503] (-268.644) (-266.906) -- 0:00:52
211000 -- (-270.282) (-268.556) [-268.968] (-269.363) * (-267.026) (-268.884) [-267.125] (-270.990) -- 0:00:52
211500 -- (-267.136) [-269.038] (-267.558) (-268.129) * (-268.834) (-270.741) [-267.836] (-269.097) -- 0:00:52
212000 -- (-267.904) (-270.258) (-269.067) [-268.285] * [-268.697] (-268.113) (-267.286) (-269.464) -- 0:00:52
212500 -- (-269.942) [-270.141] (-276.876) (-268.821) * (-269.075) (-269.208) [-268.634] (-269.400) -- 0:00:51
213000 -- [-266.381] (-269.872) (-278.742) (-270.262) * (-270.911) [-269.572] (-272.321) (-270.474) -- 0:00:51
213500 -- (-268.810) [-269.460] (-267.834) (-269.121) * [-268.182] (-270.134) (-270.868) (-269.531) -- 0:00:51
214000 -- (-269.121) [-268.820] (-268.109) (-268.578) * (-268.975) [-268.055] (-267.721) (-270.427) -- 0:00:51
214500 -- (-268.894) [-268.349] (-268.907) (-268.986) * (-273.239) [-267.497] (-270.332) (-268.620) -- 0:00:51
215000 -- [-268.396] (-272.293) (-270.393) (-269.615) * (-272.536) [-269.007] (-272.473) (-267.876) -- 0:00:51
Average standard deviation of split frequencies: 0.019642
215500 -- (-274.534) (-271.441) (-274.069) [-267.753] * (-268.290) [-268.609] (-269.926) (-270.947) -- 0:00:50
216000 -- (-272.448) (-268.444) (-274.181) [-273.293] * [-267.856] (-265.426) (-266.468) (-268.846) -- 0:00:50
216500 -- (-267.626) (-272.254) (-274.194) [-266.841] * (-271.169) (-272.738) (-267.873) [-267.655] -- 0:00:50
217000 -- (-267.205) (-272.813) [-270.178] (-268.500) * [-269.697] (-266.999) (-269.151) (-267.356) -- 0:00:50
217500 -- [-267.367] (-268.322) (-271.162) (-270.602) * (-269.689) [-267.259] (-268.392) (-273.554) -- 0:00:50
218000 -- (-269.409) (-267.520) [-268.281] (-268.073) * [-267.733] (-267.407) (-269.309) (-268.317) -- 0:00:50
218500 -- (-267.978) (-270.526) (-273.994) [-269.008] * (-268.630) (-268.806) (-271.698) [-267.777] -- 0:00:50
219000 -- (-270.239) [-269.563] (-269.434) (-267.395) * (-267.287) [-270.314] (-272.067) (-267.849) -- 0:00:53
219500 -- (-272.797) [-268.796] (-268.559) (-270.059) * (-271.692) (-268.391) [-270.953] (-268.081) -- 0:00:53
220000 -- (-269.343) [-274.128] (-270.258) (-269.300) * (-269.870) [-267.185] (-266.357) (-268.029) -- 0:00:53
Average standard deviation of split frequencies: 0.019226
220500 -- (-268.477) [-268.356] (-268.313) (-268.902) * (-268.182) [-270.115] (-269.102) (-268.730) -- 0:00:53
221000 -- (-268.288) (-268.261) [-270.366] (-269.132) * (-268.920) (-267.468) [-270.769] (-268.363) -- 0:00:52
221500 -- (-273.634) [-271.210] (-267.204) (-269.567) * (-268.021) [-268.138] (-268.295) (-266.167) -- 0:00:52
222000 -- (-269.806) (-271.294) (-268.794) [-269.329] * (-269.363) (-267.232) [-269.154] (-269.826) -- 0:00:52
222500 -- [-266.981] (-271.532) (-267.851) (-266.600) * (-268.957) (-274.168) [-269.649] (-273.808) -- 0:00:52
223000 -- (-276.370) (-272.369) [-269.378] (-270.511) * (-270.254) (-271.894) [-268.678] (-267.096) -- 0:00:52
223500 -- [-266.660] (-273.700) (-275.055) (-269.312) * (-271.459) [-267.593] (-269.809) (-268.125) -- 0:00:52
224000 -- (-269.020) (-273.040) (-271.567) [-269.980] * (-273.845) (-265.320) (-274.427) [-265.530] -- 0:00:51
224500 -- [-268.903] (-268.342) (-266.592) (-267.176) * [-268.766] (-268.234) (-269.324) (-269.066) -- 0:00:51
225000 -- (-269.362) (-268.653) (-271.084) [-266.830] * (-272.533) [-267.779] (-270.301) (-272.795) -- 0:00:51
Average standard deviation of split frequencies: 0.019555
225500 -- (-269.523) [-269.457] (-268.289) (-269.006) * (-268.560) (-268.244) (-267.236) [-271.498] -- 0:00:51
226000 -- [-268.699] (-268.708) (-270.513) (-269.501) * (-267.809) (-268.746) (-270.152) [-266.424] -- 0:00:51
226500 -- [-270.115] (-269.017) (-271.092) (-272.769) * (-267.877) (-265.614) (-274.303) [-267.785] -- 0:00:51
227000 -- (-266.197) (-268.691) [-270.212] (-271.474) * (-269.859) (-269.002) (-272.217) [-265.740] -- 0:00:51
227500 -- [-267.925] (-270.382) (-270.190) (-270.714) * (-269.655) (-268.320) (-268.093) [-267.766] -- 0:00:50
228000 -- [-267.760] (-269.765) (-269.811) (-270.754) * (-272.522) (-270.826) (-266.218) [-270.273] -- 0:00:50
228500 -- [-269.040] (-275.792) (-269.303) (-269.357) * (-269.737) [-270.076] (-271.107) (-267.930) -- 0:00:50
229000 -- [-268.363] (-274.677) (-270.995) (-267.619) * (-270.406) (-267.262) [-270.292] (-270.765) -- 0:00:50
229500 -- (-266.960) (-270.681) (-270.280) [-267.794] * [-269.667] (-269.249) (-272.453) (-272.990) -- 0:00:50
230000 -- (-272.236) (-269.327) (-269.563) [-269.755] * (-268.442) (-269.039) [-270.570] (-274.563) -- 0:00:50
Average standard deviation of split frequencies: 0.018776
230500 -- [-268.353] (-270.972) (-271.731) (-269.918) * (-270.251) (-269.792) (-269.422) [-268.805] -- 0:00:50
231000 -- [-267.480] (-270.256) (-271.620) (-272.473) * (-267.831) (-268.443) (-268.544) [-267.092] -- 0:00:49
231500 -- (-266.282) (-269.928) [-268.394] (-265.817) * (-272.428) [-267.117] (-274.600) (-267.026) -- 0:00:49
232000 -- [-267.950] (-268.747) (-270.396) (-269.550) * (-268.914) (-269.597) [-271.713] (-266.042) -- 0:00:49
232500 -- (-266.790) (-274.159) (-269.674) [-268.592] * (-269.686) [-268.479] (-267.795) (-267.891) -- 0:00:49
233000 -- [-266.300] (-270.644) (-272.038) (-270.255) * (-269.158) (-268.654) [-267.940] (-267.612) -- 0:00:49
233500 -- [-270.354] (-270.369) (-268.722) (-267.429) * [-272.859] (-269.937) (-267.855) (-266.854) -- 0:00:49
234000 -- (-267.970) [-270.094] (-268.868) (-270.192) * (-269.954) (-267.972) [-268.223] (-269.162) -- 0:00:49
234500 -- [-267.620] (-272.299) (-268.889) (-269.373) * (-269.007) (-271.411) (-271.881) [-268.255] -- 0:00:48
235000 -- (-268.081) [-267.031] (-269.166) (-269.919) * (-276.606) (-268.537) [-270.484] (-265.532) -- 0:00:52
Average standard deviation of split frequencies: 0.018477
235500 -- (-267.037) (-271.544) [-268.018] (-268.176) * (-271.820) (-274.137) (-271.867) [-268.314] -- 0:00:51
236000 -- (-266.631) (-271.589) (-270.737) [-266.508] * (-269.385) (-268.582) (-270.739) [-266.628] -- 0:00:51
236500 -- (-267.949) [-270.097] (-269.695) (-265.666) * [-269.508] (-266.834) (-268.040) (-269.536) -- 0:00:51
237000 -- (-268.977) [-268.718] (-274.069) (-266.760) * (-269.427) (-268.452) [-269.542] (-271.626) -- 0:00:51
237500 -- [-267.856] (-269.727) (-267.945) (-269.174) * (-270.385) (-267.204) [-267.737] (-272.538) -- 0:00:51
238000 -- [-268.648] (-268.605) (-270.219) (-268.170) * (-271.881) [-267.463] (-270.332) (-267.145) -- 0:00:51
238500 -- [-267.801] (-269.224) (-269.054) (-268.339) * (-271.956) (-268.372) [-267.996] (-270.435) -- 0:00:51
239000 -- (-266.142) (-266.683) (-267.904) [-269.372] * (-272.134) (-269.672) [-266.271] (-270.412) -- 0:00:50
239500 -- [-266.788] (-269.441) (-269.008) (-269.558) * (-271.188) (-271.216) (-268.099) [-267.128] -- 0:00:50
240000 -- (-267.887) (-266.348) [-267.837] (-266.629) * [-271.083] (-270.240) (-267.658) (-267.422) -- 0:00:50
Average standard deviation of split frequencies: 0.019098
240500 -- [-267.198] (-267.660) (-270.261) (-269.122) * [-269.196] (-269.535) (-272.796) (-269.196) -- 0:00:50
241000 -- (-269.408) (-270.169) (-268.375) [-269.128] * (-272.493) [-268.636] (-271.358) (-272.258) -- 0:00:50
241500 -- (-267.016) [-269.909] (-269.812) (-269.823) * (-274.517) (-268.393) [-270.609] (-267.506) -- 0:00:50
242000 -- (-267.527) (-268.753) (-267.725) [-266.970] * (-272.514) (-267.576) (-276.934) [-268.716] -- 0:00:50
242500 -- (-271.741) (-269.935) [-269.487] (-265.829) * (-269.206) (-267.321) (-269.978) [-266.508] -- 0:00:49
243000 -- (-267.540) (-271.738) (-269.448) [-268.565] * (-268.356) (-267.159) (-268.772) [-269.080] -- 0:00:49
243500 -- (-268.564) (-270.529) [-267.682] (-269.016) * [-268.406] (-271.001) (-269.215) (-271.412) -- 0:00:49
244000 -- (-266.667) (-269.893) (-268.779) [-271.350] * (-267.599) (-271.483) (-271.301) [-269.107] -- 0:00:49
244500 -- [-266.881] (-266.954) (-274.899) (-268.043) * (-270.240) (-266.520) (-268.223) [-268.745] -- 0:00:49
245000 -- (-266.725) [-266.666] (-278.374) (-268.236) * (-269.998) [-267.218] (-268.712) (-267.749) -- 0:00:49
Average standard deviation of split frequencies: 0.019163
245500 -- (-269.076) [-266.653] (-272.068) (-267.425) * [-268.038] (-270.117) (-273.074) (-270.339) -- 0:00:49
246000 -- (-266.055) [-266.820] (-270.987) (-270.795) * (-272.484) (-268.441) (-270.443) [-269.839] -- 0:00:49
246500 -- (-269.236) [-265.165] (-270.477) (-267.606) * [-268.313] (-271.313) (-270.312) (-268.167) -- 0:00:48
247000 -- (-267.445) (-267.700) (-266.071) [-268.042] * (-270.905) [-266.373] (-270.486) (-268.358) -- 0:00:48
247500 -- (-269.614) (-269.368) (-268.892) [-267.752] * (-272.222) (-269.769) (-268.271) [-271.512] -- 0:00:48
248000 -- (-267.660) [-268.863] (-273.704) (-266.853) * (-270.674) (-269.796) (-268.433) [-266.984] -- 0:00:48
248500 -- (-270.500) (-268.450) (-268.376) [-266.322] * [-276.180] (-269.116) (-269.473) (-270.205) -- 0:00:48
249000 -- [-267.407] (-266.947) (-272.821) (-265.524) * (-274.985) (-269.428) (-268.159) [-267.895] -- 0:00:48
249500 -- (-267.585) (-266.354) [-269.135] (-267.089) * (-273.046) (-269.960) [-267.626] (-268.788) -- 0:00:48
250000 -- (-271.590) [-267.390] (-268.862) (-270.188) * (-278.643) (-276.001) [-268.020] (-270.790) -- 0:00:48
Average standard deviation of split frequencies: 0.018142
250500 -- (-270.494) (-269.453) (-268.426) [-267.376] * (-281.246) (-268.775) (-271.576) [-270.517] -- 0:00:50
251000 -- (-271.492) (-269.592) [-266.853] (-267.375) * [-268.120] (-268.929) (-266.519) (-268.315) -- 0:00:50
251500 -- (-268.816) (-270.094) [-267.696] (-268.342) * (-268.158) (-267.822) [-268.493] (-269.987) -- 0:00:50
252000 -- (-268.488) (-269.877) (-267.143) [-267.229] * (-271.421) [-271.479] (-266.175) (-267.841) -- 0:00:50
252500 -- [-268.037] (-268.798) (-271.162) (-268.444) * (-272.277) [-271.939] (-267.014) (-268.216) -- 0:00:50
253000 -- [-267.464] (-266.839) (-274.249) (-274.572) * [-270.443] (-268.048) (-267.823) (-271.528) -- 0:00:50
253500 -- (-269.232) [-267.591] (-270.164) (-269.074) * (-270.380) [-267.768] (-269.371) (-271.445) -- 0:00:50
254000 -- (-268.749) [-269.008] (-269.257) (-267.741) * [-270.301] (-267.335) (-268.206) (-268.199) -- 0:00:49
254500 -- (-271.330) [-269.250] (-275.322) (-269.238) * (-268.813) (-269.030) [-267.404] (-269.520) -- 0:00:49
255000 -- (-268.014) (-268.686) [-272.505] (-272.443) * (-269.593) [-265.464] (-268.934) (-270.749) -- 0:00:49
Average standard deviation of split frequencies: 0.017439
255500 -- (-268.689) (-266.846) (-271.479) [-267.738] * (-268.074) (-270.759) (-266.790) [-268.337] -- 0:00:49
256000 -- (-268.054) (-267.040) [-270.723] (-267.916) * (-269.535) (-277.335) [-268.512] (-268.600) -- 0:00:49
256500 -- (-268.326) [-266.886] (-269.295) (-267.534) * [-271.811] (-269.510) (-266.424) (-268.868) -- 0:00:49
257000 -- (-270.905) (-270.760) (-268.035) [-266.898] * (-268.240) (-268.389) [-266.510] (-268.960) -- 0:00:49
257500 -- (-268.602) [-270.577] (-268.164) (-268.460) * [-266.343] (-273.756) (-269.143) (-270.121) -- 0:00:49
258000 -- (-269.131) [-268.205] (-269.115) (-267.709) * (-267.765) (-268.244) (-270.878) [-268.848] -- 0:00:48
258500 -- (-268.143) (-269.641) [-266.104] (-267.654) * (-272.514) [-270.620] (-270.790) (-276.583) -- 0:00:48
259000 -- [-268.668] (-269.057) (-268.671) (-268.236) * (-268.549) (-268.389) [-268.161] (-270.045) -- 0:00:48
259500 -- [-267.559] (-270.281) (-270.859) (-270.565) * (-268.575) (-268.772) [-266.874] (-269.861) -- 0:00:48
260000 -- (-267.435) [-267.124] (-266.366) (-267.958) * (-269.018) (-268.356) [-268.863] (-267.648) -- 0:00:48
Average standard deviation of split frequencies: 0.017281
260500 -- (-270.041) [-267.047] (-268.646) (-267.918) * [-266.452] (-271.108) (-268.880) (-270.120) -- 0:00:48
261000 -- (-267.765) (-269.041) (-267.959) [-269.524] * (-269.010) (-267.038) [-268.498] (-269.845) -- 0:00:48
261500 -- (-268.171) [-268.212] (-270.518) (-270.843) * (-268.890) [-267.034] (-269.507) (-270.252) -- 0:00:48
262000 -- (-269.425) (-267.728) (-268.868) [-271.397] * (-267.535) [-268.167] (-271.167) (-270.515) -- 0:00:47
262500 -- (-269.757) [-270.991] (-267.467) (-274.629) * (-268.429) [-266.869] (-271.821) (-269.628) -- 0:00:47
263000 -- (-267.484) (-269.330) [-267.992] (-267.711) * [-269.499] (-266.565) (-275.420) (-270.801) -- 0:00:47
263500 -- (-268.432) [-270.621] (-267.550) (-269.509) * [-271.744] (-272.463) (-268.932) (-272.522) -- 0:00:47
264000 -- [-269.750] (-266.794) (-267.216) (-267.285) * (-267.225) (-269.023) [-268.209] (-266.780) -- 0:00:47
264500 -- (-270.846) (-268.159) [-266.404] (-265.434) * [-266.498] (-269.106) (-270.703) (-267.878) -- 0:00:47
265000 -- [-265.887] (-268.341) (-269.427) (-269.816) * [-270.167] (-270.854) (-271.400) (-267.446) -- 0:00:47
Average standard deviation of split frequencies: 0.016836
265500 -- (-269.584) (-269.251) [-269.648] (-269.316) * (-267.711) [-268.860] (-272.370) (-268.089) -- 0:00:47
266000 -- (-270.318) (-266.632) [-266.852] (-269.888) * (-269.609) (-266.876) (-268.352) [-268.501] -- 0:00:46
266500 -- (-268.388) [-267.471] (-269.608) (-267.726) * (-267.438) [-266.807] (-270.706) (-268.545) -- 0:00:49
267000 -- (-266.542) (-269.396) (-267.768) [-267.446] * (-271.494) (-268.406) [-268.893] (-271.471) -- 0:00:49
267500 -- (-270.510) [-272.088] (-268.264) (-267.689) * (-267.320) (-270.568) [-267.701] (-269.003) -- 0:00:49
268000 -- (-269.628) (-273.544) [-266.561] (-267.672) * (-266.921) [-268.226] (-269.831) (-269.255) -- 0:00:49
268500 -- [-269.066] (-270.129) (-265.724) (-265.831) * (-266.591) (-267.361) [-268.318] (-269.933) -- 0:00:49
269000 -- [-270.761] (-269.587) (-269.724) (-267.612) * (-269.504) (-268.426) (-268.175) [-267.854] -- 0:00:48
269500 -- [-267.644] (-269.107) (-267.619) (-268.005) * (-271.124) (-267.348) (-268.564) [-268.217] -- 0:00:48
270000 -- (-266.818) (-268.854) (-272.199) [-268.425] * (-271.584) [-273.542] (-271.827) (-272.571) -- 0:00:48
Average standard deviation of split frequencies: 0.014855
270500 -- (-266.605) (-267.802) (-267.667) [-266.976] * (-274.570) (-270.645) [-267.265] (-269.387) -- 0:00:48
271000 -- (-267.261) [-268.523] (-267.274) (-266.969) * (-272.402) (-266.973) [-265.968] (-270.297) -- 0:00:48
271500 -- (-267.240) (-267.255) [-269.322] (-268.556) * (-266.203) [-267.580] (-268.439) (-269.393) -- 0:00:48
272000 -- (-269.645) (-266.748) (-266.923) [-266.665] * (-268.680) (-269.846) (-267.649) [-268.751] -- 0:00:48
272500 -- [-268.795] (-267.475) (-272.185) (-270.237) * [-268.588] (-268.234) (-267.381) (-271.184) -- 0:00:48
273000 -- (-269.612) (-267.639) (-269.169) [-268.736] * [-269.656] (-267.457) (-269.081) (-269.369) -- 0:00:47
273500 -- [-269.324] (-267.176) (-269.599) (-268.904) * (-271.235) (-268.654) (-269.684) [-270.219] -- 0:00:47
274000 -- (-270.394) (-265.676) [-268.960] (-267.487) * (-275.006) (-267.104) (-267.451) [-270.992] -- 0:00:47
274500 -- [-268.532] (-267.052) (-268.198) (-267.667) * (-271.748) (-269.583) (-268.994) [-268.695] -- 0:00:47
275000 -- (-268.323) (-270.049) (-270.914) [-267.461] * (-270.066) (-268.263) [-267.025] (-273.831) -- 0:00:47
Average standard deviation of split frequencies: 0.015673
275500 -- (-266.892) (-271.749) [-270.923] (-266.198) * (-268.699) [-266.490] (-268.068) (-270.428) -- 0:00:47
276000 -- [-270.816] (-274.800) (-268.272) (-268.175) * (-266.890) (-269.406) [-267.135] (-271.126) -- 0:00:47
276500 -- [-271.806] (-268.800) (-273.097) (-274.310) * [-269.188] (-267.624) (-268.638) (-270.261) -- 0:00:47
277000 -- (-270.157) [-269.939] (-269.960) (-270.979) * (-268.062) [-267.197] (-269.333) (-276.510) -- 0:00:46
277500 -- [-269.032] (-268.930) (-269.423) (-268.120) * [-269.081] (-268.051) (-268.075) (-270.938) -- 0:00:46
278000 -- (-267.447) [-273.544] (-268.821) (-267.087) * [-270.115] (-267.923) (-268.901) (-272.141) -- 0:00:46
278500 -- (-269.443) [-268.494] (-271.932) (-267.530) * [-270.370] (-268.733) (-270.604) (-269.651) -- 0:00:46
279000 -- (-272.054) (-269.652) (-268.717) [-268.115] * (-269.047) [-269.350] (-268.796) (-269.847) -- 0:00:46
279500 -- (-269.585) [-271.390] (-268.638) (-267.381) * (-272.922) (-267.990) [-272.769] (-271.231) -- 0:00:46
280000 -- (-271.407) [-268.895] (-275.825) (-274.574) * (-268.786) (-268.748) (-267.391) [-270.052] -- 0:00:46
Average standard deviation of split frequencies: 0.014277
280500 -- (-271.032) (-269.450) [-269.746] (-270.303) * (-269.733) [-269.194] (-266.909) (-269.176) -- 0:00:46
281000 -- (-272.799) (-268.308) [-268.154] (-269.127) * (-267.515) (-270.428) (-269.836) [-271.074] -- 0:00:46
281500 -- (-266.658) [-269.394] (-268.113) (-270.475) * (-268.655) [-267.521] (-272.825) (-269.328) -- 0:00:45
282000 -- (-271.119) (-269.799) [-266.705] (-271.163) * (-271.957) [-268.788] (-267.670) (-267.358) -- 0:00:45
282500 -- (-270.696) (-269.930) [-268.633] (-268.671) * (-269.163) [-268.450] (-266.560) (-268.431) -- 0:00:48
283000 -- (-271.160) (-269.981) [-268.058] (-266.383) * (-268.655) (-268.658) (-268.752) [-273.102] -- 0:00:48
283500 -- (-269.996) (-267.890) [-267.690] (-269.118) * (-267.490) (-271.350) (-270.099) [-267.088] -- 0:00:48
284000 -- (-267.946) [-268.927] (-267.929) (-268.827) * (-267.908) (-268.033) (-268.260) [-266.863] -- 0:00:47
284500 -- (-269.140) [-269.906] (-270.063) (-271.832) * (-270.670) (-268.598) [-268.969] (-272.047) -- 0:00:47
285000 -- [-268.502] (-268.797) (-274.075) (-268.557) * (-270.189) [-266.019] (-268.659) (-271.585) -- 0:00:47
Average standard deviation of split frequencies: 0.014059
285500 -- (-268.676) [-269.220] (-271.118) (-268.084) * (-272.840) [-269.908] (-268.900) (-269.095) -- 0:00:47
286000 -- (-267.062) (-269.868) [-269.940] (-268.826) * [-274.940] (-269.174) (-268.683) (-269.441) -- 0:00:47
286500 -- (-268.899) [-268.876] (-268.364) (-272.870) * (-265.862) [-268.170] (-271.864) (-273.540) -- 0:00:47
287000 -- (-267.948) [-266.450] (-270.283) (-271.436) * (-273.709) (-273.270) (-271.084) [-269.579] -- 0:00:47
287500 -- (-269.997) [-269.697] (-269.016) (-271.243) * (-273.178) (-272.475) [-267.742] (-274.072) -- 0:00:47
288000 -- (-270.603) (-272.822) [-268.821] (-272.051) * (-268.840) (-268.998) (-266.340) [-274.426] -- 0:00:46
288500 -- (-268.186) [-270.838] (-271.232) (-270.417) * (-270.478) (-268.365) [-268.233] (-270.228) -- 0:00:46
289000 -- [-270.539] (-268.826) (-271.644) (-268.179) * [-266.606] (-267.152) (-268.029) (-270.818) -- 0:00:46
289500 -- (-270.051) (-272.164) (-271.190) [-267.670] * (-266.563) [-266.572] (-268.389) (-268.936) -- 0:00:46
290000 -- [-266.667] (-270.047) (-267.985) (-267.850) * [-270.254] (-267.838) (-268.337) (-268.129) -- 0:00:46
Average standard deviation of split frequencies: 0.013076
290500 -- (-268.585) (-267.866) (-270.112) [-268.773] * (-267.962) [-267.256] (-268.597) (-270.260) -- 0:00:46
291000 -- (-269.083) (-272.373) [-266.389] (-269.648) * (-268.682) (-269.926) [-270.704] (-266.791) -- 0:00:46
291500 -- [-266.758] (-271.111) (-269.819) (-268.156) * [-267.049] (-270.454) (-269.712) (-268.700) -- 0:00:46
292000 -- (-267.438) [-266.835] (-271.679) (-268.110) * (-270.506) (-272.320) [-267.633] (-270.168) -- 0:00:46
292500 -- (-270.137) (-270.595) (-267.906) [-267.964] * (-265.727) (-269.462) (-270.010) [-266.678] -- 0:00:45
293000 -- (-273.387) (-267.286) [-270.021] (-269.129) * (-266.716) [-267.988] (-269.018) (-268.302) -- 0:00:45
293500 -- [-271.402] (-267.673) (-270.076) (-275.455) * (-273.129) (-269.562) [-269.252] (-267.519) -- 0:00:45
294000 -- [-275.747] (-268.783) (-267.942) (-273.269) * (-269.651) (-270.377) [-269.302] (-267.080) -- 0:00:45
294500 -- (-267.540) (-267.899) (-269.199) [-273.052] * [-266.733] (-270.067) (-269.420) (-266.411) -- 0:00:45
295000 -- (-267.188) (-268.834) (-267.754) [-269.087] * [-265.843] (-270.638) (-268.495) (-268.495) -- 0:00:45
Average standard deviation of split frequencies: 0.013039
295500 -- (-271.289) (-269.351) [-270.123] (-268.675) * (-270.293) [-268.626] (-271.841) (-268.904) -- 0:00:45
296000 -- (-268.819) [-270.820] (-270.473) (-268.506) * (-267.687) (-268.203) [-268.775] (-270.115) -- 0:00:45
296500 -- [-269.265] (-269.312) (-272.526) (-268.437) * (-265.360) (-265.683) (-267.561) [-268.869] -- 0:00:45
297000 -- [-265.802] (-270.137) (-272.492) (-269.412) * (-265.937) (-267.740) [-268.724] (-270.277) -- 0:00:44
297500 -- (-267.122) (-270.819) [-266.582] (-266.042) * (-266.301) [-267.331] (-268.780) (-267.314) -- 0:00:44
298000 -- (-268.632) (-266.769) [-272.737] (-270.597) * (-273.447) (-266.817) (-269.989) [-270.200] -- 0:00:47
298500 -- [-268.557] (-268.372) (-268.657) (-269.407) * (-273.885) [-268.013] (-270.164) (-269.640) -- 0:00:47
299000 -- (-271.009) (-266.513) (-268.557) [-267.536] * [-266.801] (-270.638) (-268.393) (-267.480) -- 0:00:46
299500 -- [-269.870] (-268.675) (-267.940) (-266.579) * (-268.160) [-269.541] (-268.375) (-276.350) -- 0:00:46
300000 -- (-268.197) (-272.667) (-270.994) [-268.036] * [-269.401] (-270.106) (-268.268) (-269.820) -- 0:00:46
Average standard deviation of split frequencies: 0.013523
300500 -- (-269.461) (-270.767) [-267.674] (-269.467) * [-266.907] (-267.395) (-269.938) (-270.272) -- 0:00:46
301000 -- [-267.020] (-271.919) (-267.614) (-267.944) * [-267.916] (-269.546) (-272.975) (-267.937) -- 0:00:46
301500 -- (-266.677) [-272.969] (-272.048) (-270.316) * (-266.448) (-267.934) [-273.364] (-266.635) -- 0:00:46
302000 -- (-268.175) (-268.359) [-269.256] (-270.373) * (-268.026) (-268.730) (-269.068) [-266.974] -- 0:00:46
302500 -- (-273.396) (-269.887) [-269.055] (-270.929) * [-268.794] (-268.094) (-268.321) (-268.001) -- 0:00:46
303000 -- [-266.048] (-272.749) (-275.061) (-269.028) * (-269.680) (-267.243) [-268.893] (-266.641) -- 0:00:46
303500 -- (-266.160) [-268.964] (-270.935) (-266.336) * (-267.341) (-267.963) [-267.736] (-275.042) -- 0:00:45
304000 -- [-266.827] (-269.221) (-275.321) (-269.555) * (-266.965) [-269.241] (-268.618) (-271.105) -- 0:00:45
304500 -- [-268.108] (-267.963) (-270.693) (-268.562) * (-272.838) (-266.748) (-269.253) [-270.087] -- 0:00:45
305000 -- (-267.107) [-269.801] (-267.911) (-269.354) * (-269.679) [-269.081] (-269.268) (-267.687) -- 0:00:45
Average standard deviation of split frequencies: 0.013287
305500 -- (-268.952) (-267.418) [-268.683] (-271.494) * [-269.793] (-267.859) (-268.851) (-265.580) -- 0:00:45
306000 -- (-267.423) [-268.469] (-268.597) (-271.991) * [-266.904] (-270.580) (-270.253) (-270.389) -- 0:00:45
306500 -- (-268.504) [-268.593] (-268.654) (-270.394) * (-270.121) [-266.883] (-268.797) (-269.771) -- 0:00:45
307000 -- [-268.003] (-265.869) (-267.919) (-268.189) * [-271.903] (-269.628) (-270.413) (-276.296) -- 0:00:45
307500 -- (-271.791) (-268.345) [-269.988] (-272.940) * (-267.923) [-270.318] (-271.045) (-268.767) -- 0:00:45
308000 -- [-269.628] (-269.071) (-271.908) (-266.808) * (-266.896) (-273.133) [-271.747] (-269.814) -- 0:00:44
308500 -- (-267.774) (-268.866) (-270.387) [-269.263] * (-269.107) (-268.174) (-269.270) [-271.530] -- 0:00:44
309000 -- (-266.510) (-267.740) [-268.101] (-272.411) * (-268.691) (-267.757) (-271.225) [-272.847] -- 0:00:44
309500 -- (-268.871) (-268.260) (-268.813) [-268.921] * (-267.775) (-269.935) (-267.858) [-271.209] -- 0:00:44
310000 -- (-269.854) (-270.892) [-265.948] (-267.144) * (-267.847) (-269.853) (-269.576) [-270.327] -- 0:00:44
Average standard deviation of split frequencies: 0.012519
310500 -- [-267.795] (-266.947) (-266.830) (-268.808) * (-268.048) (-272.054) [-273.309] (-269.992) -- 0:00:44
311000 -- (-270.119) [-266.660] (-271.508) (-268.806) * [-268.317] (-268.235) (-272.786) (-269.702) -- 0:00:44
311500 -- (-269.843) [-267.376] (-267.681) (-268.352) * (-269.393) [-267.080] (-268.942) (-270.466) -- 0:00:44
312000 -- [-269.675] (-267.760) (-269.774) (-268.214) * (-271.457) (-269.155) [-269.191] (-269.137) -- 0:00:44
312500 -- (-270.202) (-268.165) (-269.140) [-267.116] * [-269.396] (-269.615) (-269.789) (-268.077) -- 0:00:44
313000 -- (-270.680) (-267.366) (-271.854) [-266.867] * (-268.535) (-272.105) [-267.931] (-266.948) -- 0:00:43
313500 -- (-272.234) (-267.779) [-267.006] (-269.994) * (-267.470) (-269.565) (-268.499) [-267.163] -- 0:00:43
314000 -- (-269.702) (-271.593) (-270.686) [-267.717] * (-267.728) (-268.217) [-266.267] (-269.824) -- 0:00:45
314500 -- [-267.628] (-270.109) (-273.244) (-269.161) * (-268.566) [-267.669] (-274.862) (-271.992) -- 0:00:45
315000 -- [-268.107] (-268.878) (-268.257) (-268.138) * (-266.800) (-268.352) (-269.634) [-266.366] -- 0:00:45
Average standard deviation of split frequencies: 0.012867
315500 -- (-268.076) [-268.247] (-266.608) (-269.513) * (-266.785) (-270.054) [-269.460] (-268.792) -- 0:00:45
316000 -- (-269.290) (-267.912) (-268.395) [-265.636] * (-269.240) (-269.594) [-268.032] (-271.401) -- 0:00:45
316500 -- (-268.609) (-271.144) (-278.599) [-269.025] * [-267.212] (-272.908) (-267.821) (-269.153) -- 0:00:45
317000 -- (-271.614) [-268.781] (-270.541) (-266.114) * (-270.209) (-269.153) (-268.392) [-267.992] -- 0:00:45
317500 -- [-268.330] (-275.784) (-271.136) (-266.974) * (-274.301) (-271.577) (-270.673) [-274.297] -- 0:00:45
318000 -- (-271.854) (-268.696) [-272.503] (-268.161) * [-269.420] (-270.343) (-270.889) (-267.830) -- 0:00:45
318500 -- (-276.017) (-274.904) [-266.829] (-269.174) * (-269.297) (-265.199) (-267.771) [-268.298] -- 0:00:44
319000 -- [-268.503] (-269.319) (-274.016) (-269.447) * (-271.388) (-270.506) (-270.930) [-267.591] -- 0:00:44
319500 -- [-269.161] (-270.508) (-267.925) (-270.175) * (-271.501) (-270.413) (-268.594) [-267.544] -- 0:00:44
320000 -- (-268.691) [-267.327] (-268.229) (-269.864) * (-270.063) [-270.330] (-271.807) (-267.331) -- 0:00:44
Average standard deviation of split frequencies: 0.013047
320500 -- (-269.861) [-268.073] (-270.627) (-273.415) * (-269.053) (-268.110) [-271.905] (-270.219) -- 0:00:44
321000 -- [-270.661] (-269.407) (-269.049) (-268.032) * (-274.105) (-267.031) [-268.387] (-268.789) -- 0:00:44
321500 -- (-270.616) (-268.815) [-269.126] (-270.780) * [-268.865] (-267.608) (-272.720) (-270.397) -- 0:00:44
322000 -- (-265.963) [-268.182] (-267.292) (-265.922) * (-266.674) [-268.633] (-268.477) (-271.179) -- 0:00:44
322500 -- (-268.663) (-267.039) [-266.960] (-272.071) * (-269.368) [-269.990] (-268.791) (-268.905) -- 0:00:44
323000 -- (-273.369) (-267.412) [-269.178] (-269.624) * [-267.023] (-275.237) (-268.844) (-267.502) -- 0:00:44
323500 -- (-272.561) [-270.058] (-268.649) (-269.221) * (-268.582) (-268.719) (-269.119) [-268.662] -- 0:00:43
324000 -- (-271.240) [-267.939] (-269.325) (-270.444) * [-270.819] (-267.770) (-269.294) (-267.666) -- 0:00:43
324500 -- (-271.264) [-269.370] (-270.384) (-269.760) * (-268.316) [-267.369] (-270.763) (-267.474) -- 0:00:43
325000 -- (-267.478) (-272.033) [-268.303] (-268.817) * (-267.717) (-269.096) (-267.592) [-267.781] -- 0:00:43
Average standard deviation of split frequencies: 0.011026
325500 -- (-268.723) [-270.057] (-270.174) (-268.298) * (-270.088) [-265.749] (-269.128) (-269.722) -- 0:00:43
326000 -- (-268.394) [-266.441] (-267.407) (-266.466) * (-267.687) (-270.281) (-267.532) [-274.396] -- 0:00:43
326500 -- [-267.776] (-268.931) (-266.669) (-267.738) * (-270.146) (-266.576) (-268.282) [-266.244] -- 0:00:43
327000 -- (-269.888) (-269.239) [-268.244] (-269.801) * [-270.472] (-266.912) (-269.938) (-270.312) -- 0:00:43
327500 -- [-268.939] (-271.154) (-267.475) (-267.027) * (-272.543) (-272.424) (-267.714) [-265.893] -- 0:00:43
328000 -- (-270.013) (-267.863) [-268.095] (-266.549) * (-266.513) (-267.245) [-266.684] (-266.966) -- 0:00:43
328500 -- (-269.905) (-267.681) [-267.771] (-268.232) * (-270.556) (-268.429) [-269.315] (-267.467) -- 0:00:42
329000 -- (-268.304) (-269.674) [-267.031] (-266.797) * (-268.219) (-269.199) (-270.099) [-269.195] -- 0:00:42
329500 -- (-269.800) (-268.481) (-268.895) [-267.563] * (-269.698) [-267.725] (-271.292) (-269.242) -- 0:00:42
330000 -- (-272.480) [-266.273] (-271.422) (-269.545) * (-267.415) (-269.493) [-267.444] (-271.588) -- 0:00:44
Average standard deviation of split frequencies: 0.011049
330500 -- (-273.648) (-267.710) (-273.657) [-270.404] * (-270.419) (-269.388) (-267.368) [-266.646] -- 0:00:44
331000 -- (-273.236) (-270.062) [-268.257] (-268.758) * [-270.029] (-271.143) (-269.634) (-271.070) -- 0:00:44
331500 -- [-268.355] (-271.325) (-267.528) (-270.317) * (-270.024) (-269.657) [-266.238] (-268.043) -- 0:00:44
332000 -- (-271.003) [-269.199] (-267.705) (-265.954) * (-268.136) [-270.183] (-269.477) (-269.104) -- 0:00:44
332500 -- (-270.873) [-268.090] (-267.815) (-269.205) * [-268.730] (-269.698) (-268.488) (-270.962) -- 0:00:44
333000 -- (-269.858) (-268.399) [-268.718] (-272.212) * [-270.227] (-275.599) (-269.445) (-268.461) -- 0:00:44
333500 -- [-266.065] (-269.743) (-267.467) (-270.449) * [-266.909] (-267.665) (-268.000) (-269.942) -- 0:00:43
334000 -- (-268.216) (-269.586) (-267.306) [-267.773] * (-266.841) (-272.670) (-267.334) [-268.277] -- 0:00:43
334500 -- (-267.018) (-268.756) (-268.999) [-267.021] * (-268.856) (-268.184) (-270.812) [-267.447] -- 0:00:43
335000 -- (-269.203) (-270.466) [-270.773] (-266.326) * (-268.799) (-265.791) [-272.041] (-269.566) -- 0:00:43
Average standard deviation of split frequencies: 0.011224
335500 -- [-267.963] (-270.872) (-268.079) (-271.435) * (-269.486) [-265.674] (-270.528) (-270.394) -- 0:00:43
336000 -- (-268.489) (-268.676) (-269.410) [-265.693] * (-270.375) (-270.544) (-271.292) [-266.290] -- 0:00:43
336500 -- (-269.701) (-270.429) [-271.435] (-267.277) * (-273.930) [-265.946] (-267.397) (-270.643) -- 0:00:43
337000 -- (-269.395) [-268.168] (-270.197) (-267.025) * (-270.239) (-267.640) (-266.725) [-269.890] -- 0:00:43
337500 -- (-271.524) [-268.322] (-267.894) (-267.176) * (-271.860) (-268.143) (-269.805) [-268.074] -- 0:00:43
338000 -- [-269.429] (-267.660) (-274.327) (-267.331) * (-271.010) [-271.698] (-269.879) (-267.801) -- 0:00:43
338500 -- [-265.289] (-269.856) (-268.039) (-266.432) * (-272.548) (-270.839) (-272.294) [-267.790] -- 0:00:42
339000 -- (-272.288) [-268.130] (-270.477) (-268.623) * (-269.639) (-266.237) (-268.579) [-270.280] -- 0:00:42
339500 -- [-270.333] (-267.278) (-266.375) (-268.911) * (-267.578) (-272.421) (-269.132) [-269.406] -- 0:00:42
340000 -- [-271.503] (-266.104) (-267.042) (-269.034) * (-267.621) (-275.531) (-270.076) [-268.128] -- 0:00:42
Average standard deviation of split frequencies: 0.010724
340500 -- (-268.684) [-266.055] (-266.361) (-272.446) * (-269.846) [-268.610] (-267.385) (-271.877) -- 0:00:42
341000 -- (-271.266) [-267.915] (-270.441) (-271.725) * (-267.767) [-268.197] (-269.965) (-268.271) -- 0:00:42
341500 -- (-268.186) [-268.421] (-266.905) (-265.590) * (-269.813) [-271.792] (-270.114) (-272.270) -- 0:00:42
342000 -- (-270.358) (-268.074) [-267.651] (-265.834) * (-269.131) (-268.845) [-268.794] (-270.175) -- 0:00:42
342500 -- (-268.270) (-271.140) [-266.100] (-269.384) * [-268.238] (-271.355) (-267.572) (-270.351) -- 0:00:42
343000 -- (-266.989) [-267.876] (-268.967) (-268.807) * (-267.092) [-266.239] (-271.011) (-271.414) -- 0:00:42
343500 -- [-269.343] (-271.562) (-271.789) (-269.515) * (-266.715) [-269.522] (-271.261) (-269.335) -- 0:00:42
344000 -- (-269.925) [-268.404] (-268.733) (-271.294) * (-270.204) (-269.332) (-268.718) [-269.924] -- 0:00:41
344500 -- (-269.692) (-272.866) [-267.609] (-268.494) * (-271.909) (-267.249) (-267.664) [-267.491] -- 0:00:41
345000 -- [-267.257] (-267.878) (-268.592) (-268.441) * (-268.662) [-267.614] (-270.745) (-273.879) -- 0:00:41
Average standard deviation of split frequencies: 0.010900
345500 -- (-266.702) [-268.830] (-268.994) (-266.713) * (-275.736) [-268.968] (-275.045) (-270.373) -- 0:00:43
346000 -- (-268.608) [-265.960] (-265.490) (-272.212) * (-269.934) (-273.881) (-266.181) [-268.700] -- 0:00:43
346500 -- (-271.749) (-267.688) (-271.895) [-269.761] * [-267.634] (-268.831) (-266.272) (-272.582) -- 0:00:43
347000 -- [-266.406] (-268.882) (-268.866) (-267.324) * [-265.746] (-273.990) (-267.801) (-270.527) -- 0:00:43
347500 -- (-266.985) (-266.431) [-268.730] (-267.597) * (-267.726) (-272.625) (-269.145) [-267.583] -- 0:00:43
348000 -- (-270.246) [-265.581] (-267.674) (-269.270) * [-271.238] (-267.868) (-272.627) (-265.436) -- 0:00:43
348500 -- (-267.206) (-268.474) (-268.979) [-267.374] * (-268.243) (-270.129) (-266.677) [-267.949] -- 0:00:42
349000 -- (-269.298) [-265.910] (-274.378) (-267.313) * (-268.813) (-267.209) [-267.395] (-268.172) -- 0:00:42
349500 -- (-268.193) [-268.121] (-270.044) (-268.279) * (-267.713) (-269.574) [-272.819] (-268.664) -- 0:00:42
350000 -- (-269.503) [-269.306] (-268.971) (-269.349) * (-267.977) (-267.339) [-271.393] (-269.726) -- 0:00:42
Average standard deviation of split frequencies: 0.011763
350500 -- [-271.756] (-268.796) (-269.138) (-267.539) * [-267.334] (-270.450) (-270.173) (-266.599) -- 0:00:42
351000 -- (-271.985) (-271.607) (-267.938) [-268.762] * (-267.991) (-271.175) (-271.914) [-267.182] -- 0:00:42
351500 -- [-271.760] (-268.661) (-271.507) (-272.016) * (-268.756) (-270.915) (-269.635) [-271.007] -- 0:00:42
352000 -- [-270.800] (-268.043) (-266.554) (-273.527) * (-269.209) (-268.078) (-265.855) [-270.654] -- 0:00:42
352500 -- (-270.701) (-270.163) [-266.791] (-274.201) * (-267.881) [-268.240] (-268.701) (-274.002) -- 0:00:42
353000 -- (-269.917) [-266.158] (-268.166) (-271.208) * [-268.061] (-274.373) (-269.039) (-270.374) -- 0:00:42
353500 -- (-270.128) (-266.462) [-269.101] (-268.078) * (-266.685) (-273.395) (-269.138) [-265.911] -- 0:00:42
354000 -- [-267.927] (-270.322) (-266.694) (-269.122) * [-267.950] (-271.204) (-269.346) (-268.352) -- 0:00:41
354500 -- (-269.145) (-270.931) (-270.442) [-269.646] * [-271.424] (-271.415) (-268.196) (-268.712) -- 0:00:41
355000 -- (-268.676) (-271.790) (-269.740) [-268.311] * (-269.281) (-270.253) [-267.503] (-272.721) -- 0:00:41
Average standard deviation of split frequencies: 0.011255
355500 -- (-268.102) (-268.056) (-271.215) [-268.241] * (-270.417) (-267.329) [-268.850] (-272.215) -- 0:00:41
356000 -- (-270.052) (-267.118) [-265.892] (-269.692) * [-268.425] (-266.575) (-269.317) (-268.907) -- 0:00:41
356500 -- (-265.979) (-269.858) [-265.746] (-270.510) * (-267.565) [-270.974] (-268.719) (-269.057) -- 0:00:41
357000 -- (-267.582) (-265.975) [-270.174] (-272.374) * (-268.708) [-268.742] (-269.978) (-269.171) -- 0:00:41
357500 -- (-268.634) (-269.325) [-273.027] (-266.356) * (-271.257) (-268.614) [-269.762] (-269.467) -- 0:00:41
358000 -- (-269.258) [-268.506] (-271.508) (-271.130) * [-267.722] (-268.603) (-269.494) (-268.169) -- 0:00:41
358500 -- [-270.750] (-270.843) (-269.426) (-272.078) * (-267.616) (-269.807) [-269.763] (-269.491) -- 0:00:41
359000 -- (-267.791) (-268.709) [-268.335] (-269.606) * (-269.185) (-269.301) (-270.941) [-269.570] -- 0:00:41
359500 -- (-266.633) (-270.318) (-266.819) [-269.407] * (-266.653) (-269.605) (-270.370) [-267.491] -- 0:00:40
360000 -- [-275.197] (-268.852) (-269.356) (-273.475) * (-269.399) (-272.774) (-268.518) [-266.242] -- 0:00:40
Average standard deviation of split frequencies: 0.010783
360500 -- (-271.309) (-267.664) [-269.100] (-272.010) * (-268.545) [-266.588] (-268.888) (-269.044) -- 0:00:40
361000 -- (-270.412) [-269.601] (-268.724) (-269.693) * [-266.754] (-269.729) (-268.701) (-270.810) -- 0:00:40
361500 -- (-271.590) (-268.013) [-266.597] (-267.028) * (-270.568) [-267.487] (-269.255) (-266.010) -- 0:00:42
362000 -- (-270.499) (-267.490) [-266.757] (-271.363) * (-268.451) [-268.376] (-271.002) (-272.179) -- 0:00:42
362500 -- (-270.646) (-266.429) [-265.284] (-269.382) * [-268.833] (-268.989) (-270.149) (-269.871) -- 0:00:42
363000 -- (-269.733) [-266.603] (-266.667) (-269.193) * (-269.412) (-267.107) [-266.543] (-269.063) -- 0:00:42
363500 -- (-269.014) (-269.150) [-268.437] (-269.043) * [-267.118] (-269.255) (-270.020) (-265.723) -- 0:00:42
364000 -- (-268.793) (-268.732) [-266.683] (-269.149) * (-267.191) (-268.080) (-269.370) [-269.277] -- 0:00:41
364500 -- (-268.018) [-267.833] (-267.954) (-275.382) * (-272.002) [-267.826] (-268.105) (-270.932) -- 0:00:41
365000 -- (-268.177) (-270.542) [-267.059] (-266.193) * (-267.671) [-267.520] (-268.081) (-267.369) -- 0:00:41
Average standard deviation of split frequencies: 0.010062
365500 -- (-270.272) [-267.324] (-269.657) (-269.101) * (-267.200) [-267.495] (-271.714) (-268.391) -- 0:00:41
366000 -- (-271.192) (-268.149) (-271.172) [-269.945] * (-268.962) [-268.856] (-268.872) (-266.773) -- 0:00:41
366500 -- (-268.312) (-271.408) (-268.983) [-267.327] * (-269.558) [-267.801] (-268.529) (-268.438) -- 0:00:41
367000 -- (-268.796) (-270.287) (-267.814) [-269.097] * (-271.895) [-268.662] (-270.442) (-267.301) -- 0:00:41
367500 -- (-271.773) (-268.340) [-267.514] (-267.603) * (-270.789) [-269.259] (-270.250) (-266.539) -- 0:00:41
368000 -- (-272.212) (-269.918) (-268.759) [-267.502] * (-269.277) (-268.949) (-267.887) [-269.574] -- 0:00:41
368500 -- [-267.640] (-268.993) (-269.359) (-271.356) * (-269.080) (-269.881) [-269.911] (-267.884) -- 0:00:41
369000 -- (-270.179) [-267.022] (-270.463) (-269.737) * (-269.877) (-269.841) [-268.431] (-266.749) -- 0:00:41
369500 -- [-268.013] (-270.754) (-269.734) (-270.113) * (-268.435) [-270.531] (-271.038) (-267.771) -- 0:00:40
370000 -- (-272.936) (-268.068) (-272.163) [-265.640] * (-273.384) (-269.870) [-267.319] (-268.602) -- 0:00:40
Average standard deviation of split frequencies: 0.008902
370500 -- (-268.089) (-268.761) (-271.330) [-270.974] * (-270.318) (-269.176) [-266.641] (-267.166) -- 0:00:40
371000 -- (-271.191) [-269.819] (-271.163) (-270.799) * (-270.273) [-268.194] (-268.409) (-270.391) -- 0:00:40
371500 -- (-268.537) [-268.928] (-267.391) (-266.735) * (-269.142) (-268.945) [-272.212] (-267.971) -- 0:00:40
372000 -- (-271.521) [-270.972] (-272.107) (-268.247) * [-269.869] (-267.356) (-272.203) (-271.496) -- 0:00:40
372500 -- (-271.156) (-269.409) (-268.115) [-266.307] * [-267.217] (-270.495) (-269.367) (-269.939) -- 0:00:40
373000 -- (-268.855) [-269.263] (-269.456) (-268.265) * (-268.059) (-270.143) (-268.771) [-268.600] -- 0:00:40
373500 -- (-267.792) (-268.701) [-269.953] (-268.192) * [-267.053] (-271.428) (-269.001) (-269.260) -- 0:00:40
374000 -- (-270.794) (-270.574) [-268.227] (-268.043) * (-269.784) (-274.600) (-268.824) [-268.610] -- 0:00:40
374500 -- (-269.962) [-268.633] (-265.705) (-269.244) * (-269.417) (-269.210) (-273.160) [-271.329] -- 0:00:40
375000 -- (-268.992) (-269.965) [-266.615] (-267.224) * (-271.310) (-271.864) (-267.904) [-270.487] -- 0:00:40
Average standard deviation of split frequencies: 0.009325
375500 -- [-266.432] (-267.948) (-269.182) (-268.238) * (-267.848) (-270.628) [-274.404] (-268.377) -- 0:00:39
376000 -- [-268.103] (-267.913) (-270.311) (-269.412) * (-268.049) (-269.285) (-267.833) [-267.555] -- 0:00:39
376500 -- (-269.665) [-266.833] (-268.871) (-268.674) * (-269.984) [-266.642] (-269.037) (-276.001) -- 0:00:39
377000 -- (-269.107) (-267.683) (-267.659) [-269.394] * (-268.773) (-266.608) [-268.781] (-268.943) -- 0:00:39
377500 -- (-275.636) (-268.287) [-268.344] (-269.041) * [-268.597] (-270.082) (-267.880) (-268.520) -- 0:00:41
378000 -- (-269.895) (-266.957) [-271.351] (-270.236) * [-268.665] (-267.284) (-269.047) (-270.710) -- 0:00:41
378500 -- (-269.777) [-270.764] (-268.428) (-271.487) * (-270.693) (-273.177) [-268.596] (-268.283) -- 0:00:41
379000 -- (-268.307) (-273.052) (-268.051) [-269.158] * (-268.791) (-270.390) [-269.896] (-266.874) -- 0:00:40
379500 -- (-270.146) (-271.959) [-267.296] (-272.570) * (-268.758) [-274.198] (-268.570) (-268.308) -- 0:00:40
380000 -- (-268.393) (-268.453) (-268.504) [-266.151] * (-267.679) (-270.904) (-268.865) [-268.130] -- 0:00:40
Average standard deviation of split frequencies: 0.009443
380500 -- [-268.144] (-268.222) (-272.733) (-271.174) * (-273.621) (-270.526) [-267.550] (-266.380) -- 0:00:40
381000 -- (-268.611) [-266.520] (-270.925) (-270.193) * (-271.308) [-268.935] (-269.108) (-269.273) -- 0:00:40
381500 -- (-269.849) [-266.053] (-266.719) (-269.565) * [-267.699] (-273.668) (-268.994) (-266.156) -- 0:00:40
382000 -- [-268.551] (-268.128) (-270.079) (-267.678) * (-270.616) [-274.234] (-267.698) (-270.225) -- 0:00:40
382500 -- [-269.873] (-267.871) (-275.713) (-273.592) * (-271.526) (-269.218) (-267.955) [-264.821] -- 0:00:40
383000 -- (-267.048) (-267.258) [-268.583] (-272.864) * (-265.524) (-272.276) (-268.515) [-268.750] -- 0:00:40
383500 -- (-269.448) (-271.560) [-267.517] (-271.344) * (-267.717) (-272.650) (-268.287) [-268.962] -- 0:00:40
384000 -- [-270.812] (-267.635) (-267.903) (-268.921) * [-269.147] (-269.164) (-269.843) (-267.066) -- 0:00:40
384500 -- (-270.592) [-267.819] (-268.052) (-272.909) * (-266.921) [-268.409] (-268.797) (-266.370) -- 0:00:40
385000 -- (-272.059) [-267.230] (-270.572) (-269.428) * (-267.305) (-269.717) [-269.121] (-266.282) -- 0:00:39
Average standard deviation of split frequencies: 0.010228
385500 -- [-274.564] (-268.826) (-268.662) (-272.112) * (-267.269) [-266.448] (-267.891) (-271.246) -- 0:00:39
386000 -- (-267.649) (-268.261) [-268.040] (-270.991) * (-268.873) (-269.009) [-268.097] (-269.761) -- 0:00:39
386500 -- (-268.397) [-267.621] (-268.361) (-273.464) * (-269.966) (-267.794) [-268.950] (-268.374) -- 0:00:39
387000 -- (-268.126) [-268.043] (-267.115) (-272.059) * (-269.794) (-269.043) (-269.832) [-266.168] -- 0:00:39
387500 -- (-269.951) (-268.175) (-270.444) [-267.549] * (-273.483) (-269.567) (-271.783) [-268.024] -- 0:00:39
388000 -- (-270.554) (-269.927) (-274.259) [-268.845] * (-272.609) (-270.117) (-271.341) [-266.680] -- 0:00:39
388500 -- [-266.896] (-269.663) (-270.854) (-269.168) * (-271.567) (-266.723) [-268.394] (-267.980) -- 0:00:39
389000 -- (-265.877) (-275.073) [-267.999] (-272.032) * (-267.247) (-269.001) [-269.150] (-267.116) -- 0:00:39
389500 -- (-267.702) [-267.124] (-268.897) (-267.091) * [-267.016] (-273.944) (-269.822) (-270.828) -- 0:00:39
390000 -- (-268.749) (-269.238) [-266.110] (-269.170) * [-267.494] (-268.147) (-268.714) (-266.965) -- 0:00:39
Average standard deviation of split frequencies: 0.010935
390500 -- (-269.607) (-269.309) [-268.526] (-274.370) * (-267.264) (-267.350) [-265.210] (-268.075) -- 0:00:39
391000 -- (-269.943) (-276.312) [-267.629] (-268.428) * (-268.847) (-269.441) (-268.019) [-270.897] -- 0:00:38
391500 -- (-269.186) (-272.821) (-266.845) [-267.682] * [-266.319] (-271.893) (-271.453) (-267.200) -- 0:00:38
392000 -- [-267.422] (-271.488) (-271.232) (-267.828) * [-266.635] (-266.937) (-266.107) (-266.641) -- 0:00:38
392500 -- [-267.292] (-266.280) (-272.118) (-271.089) * (-269.652) [-267.929] (-266.902) (-270.197) -- 0:00:38
393000 -- (-271.634) [-267.567] (-269.433) (-273.744) * [-267.052] (-267.008) (-272.837) (-271.291) -- 0:00:38
393500 -- [-265.722] (-268.915) (-268.440) (-271.875) * (-266.504) (-267.491) [-272.001] (-273.246) -- 0:00:40
394000 -- (-268.278) [-264.975] (-271.302) (-271.061) * (-266.349) (-269.371) [-269.136] (-268.097) -- 0:00:39
394500 -- [-267.700] (-267.592) (-268.229) (-270.345) * (-267.787) [-271.130] (-274.537) (-274.175) -- 0:00:39
395000 -- (-270.108) [-269.292] (-269.427) (-270.167) * (-266.979) (-267.044) (-268.800) [-270.926] -- 0:00:39
Average standard deviation of split frequencies: 0.010937
395500 -- (-266.731) (-267.629) (-268.711) [-269.877] * (-266.656) [-270.138] (-266.073) (-269.507) -- 0:00:39
396000 -- (-269.885) [-266.680] (-268.812) (-268.985) * (-268.356) (-268.942) (-265.991) [-273.423] -- 0:00:39
396500 -- (-266.559) [-266.419] (-268.315) (-268.269) * (-272.565) (-268.277) (-267.419) [-267.846] -- 0:00:39
397000 -- [-269.076] (-268.036) (-267.024) (-271.379) * (-267.268) (-268.374) (-268.853) [-269.321] -- 0:00:39
397500 -- (-274.100) (-269.444) [-266.240] (-268.381) * (-267.610) [-268.158] (-268.574) (-268.563) -- 0:00:39
398000 -- (-272.119) [-271.962] (-267.853) (-267.665) * (-269.026) (-268.386) [-268.113] (-268.647) -- 0:00:39
398500 -- [-270.146] (-272.022) (-269.496) (-268.960) * (-269.861) (-267.608) (-268.428) [-266.037] -- 0:00:39
399000 -- (-270.707) (-268.279) (-267.892) [-268.502] * [-265.857] (-268.244) (-271.876) (-265.666) -- 0:00:39
399500 -- (-271.762) (-269.431) [-269.957] (-267.507) * (-270.700) [-270.398] (-270.753) (-267.262) -- 0:00:39
400000 -- (-273.082) [-268.190] (-272.395) (-267.994) * (-267.663) (-268.987) [-268.555] (-266.122) -- 0:00:39
Average standard deviation of split frequencies: 0.010662
400500 -- (-270.032) [-270.520] (-269.775) (-269.960) * [-270.110] (-269.425) (-267.914) (-268.690) -- 0:00:38
401000 -- (-269.710) [-269.987] (-271.940) (-270.879) * (-270.784) (-268.195) (-269.264) [-269.134] -- 0:00:38
401500 -- [-270.897] (-266.742) (-272.914) (-272.810) * [-269.622] (-271.277) (-266.754) (-272.883) -- 0:00:38
402000 -- (-274.004) (-268.860) [-267.213] (-271.384) * [-269.847] (-268.355) (-268.116) (-267.179) -- 0:00:38
402500 -- [-266.445] (-268.249) (-268.421) (-275.141) * (-269.160) (-269.024) (-268.585) [-272.778] -- 0:00:38
403000 -- (-271.058) (-269.165) [-266.299] (-268.198) * (-269.353) (-278.741) (-267.379) [-270.550] -- 0:00:38
403500 -- (-273.469) (-267.738) (-270.372) [-269.023] * (-267.420) (-268.487) (-269.138) [-268.799] -- 0:00:38
404000 -- [-266.443] (-266.488) (-271.664) (-269.494) * (-269.388) (-270.826) [-269.525] (-273.695) -- 0:00:38
404500 -- (-268.326) (-268.334) [-270.924] (-269.153) * (-270.126) [-274.335] (-268.963) (-270.729) -- 0:00:38
405000 -- [-267.118] (-270.076) (-269.578) (-269.093) * (-269.455) [-273.013] (-267.828) (-270.575) -- 0:00:38
Average standard deviation of split frequencies: 0.010885
405500 -- (-267.293) (-269.794) [-268.866] (-268.494) * [-268.297] (-273.508) (-268.528) (-267.921) -- 0:00:38
406000 -- (-269.366) (-267.418) [-268.695] (-268.180) * (-268.088) (-267.935) (-267.606) [-267.369] -- 0:00:38
406500 -- (-271.535) (-268.027) (-270.848) [-266.427] * [-268.045] (-268.348) (-268.457) (-267.977) -- 0:00:37
407000 -- (-270.313) (-268.685) [-270.584] (-268.877) * (-266.908) [-266.874] (-268.945) (-269.978) -- 0:00:37
407500 -- (-268.382) [-267.993] (-272.358) (-266.553) * (-268.076) (-272.345) (-268.024) [-268.799] -- 0:00:37
408000 -- [-270.214] (-269.832) (-268.981) (-269.958) * (-268.732) (-267.702) [-270.425] (-273.729) -- 0:00:37
408500 -- [-273.559] (-268.387) (-270.379) (-267.472) * (-271.526) (-268.204) [-269.645] (-273.891) -- 0:00:37
409000 -- (-272.149) (-268.365) (-269.411) [-267.068] * [-269.307] (-271.308) (-268.545) (-270.467) -- 0:00:37
409500 -- [-268.333] (-267.886) (-269.102) (-267.620) * (-266.795) (-271.425) [-267.326] (-273.018) -- 0:00:38
410000 -- (-268.029) (-272.959) [-267.897] (-268.836) * (-267.730) [-267.704] (-268.698) (-270.236) -- 0:00:38
Average standard deviation of split frequencies: 0.010833
410500 -- (-270.237) (-268.921) (-266.013) [-268.384] * (-269.468) [-268.491] (-269.174) (-268.643) -- 0:00:38
411000 -- (-268.990) (-269.950) (-266.852) [-269.192] * (-265.982) [-267.396] (-270.122) (-272.242) -- 0:00:38
411500 -- (-269.552) (-268.247) [-267.400] (-265.724) * [-269.017] (-269.714) (-271.535) (-270.670) -- 0:00:38
412000 -- (-271.306) [-269.378] (-268.995) (-269.108) * [-268.604] (-269.917) (-267.779) (-268.406) -- 0:00:38
412500 -- [-269.264] (-269.002) (-273.786) (-270.644) * [-265.867] (-273.658) (-267.185) (-268.966) -- 0:00:38
413000 -- (-270.762) (-269.168) [-269.245] (-268.705) * (-269.794) (-271.848) [-267.594] (-270.830) -- 0:00:38
413500 -- (-270.543) (-269.991) [-267.883] (-269.266) * (-272.273) (-271.697) (-268.796) [-271.201] -- 0:00:38
414000 -- [-269.427] (-268.178) (-267.355) (-269.097) * (-267.405) [-272.173] (-270.812) (-269.662) -- 0:00:38
414500 -- [-269.651] (-267.674) (-271.886) (-268.588) * (-272.285) [-269.345] (-269.814) (-268.357) -- 0:00:38
415000 -- [-269.728] (-271.795) (-267.382) (-268.050) * (-267.580) [-267.401] (-269.080) (-270.151) -- 0:00:38
Average standard deviation of split frequencies: 0.009278
415500 -- (-271.047) (-272.663) [-268.532] (-267.895) * (-267.544) (-268.801) (-267.793) [-268.801] -- 0:00:37
416000 -- (-269.691) (-271.893) [-270.565] (-266.810) * (-271.114) (-268.118) (-269.284) [-268.434] -- 0:00:37
416500 -- [-268.177] (-268.163) (-269.720) (-270.043) * (-270.608) (-268.514) [-268.793] (-269.733) -- 0:00:37
417000 -- (-268.646) [-275.137] (-268.920) (-271.429) * (-267.315) (-270.237) [-265.356] (-270.728) -- 0:00:37
417500 -- [-269.392] (-269.726) (-270.790) (-269.477) * [-270.171] (-267.460) (-266.114) (-269.486) -- 0:00:37
418000 -- (-271.345) [-268.747] (-271.259) (-267.036) * (-271.078) (-268.341) [-265.729] (-269.104) -- 0:00:37
418500 -- [-269.974] (-269.614) (-269.854) (-269.342) * (-270.625) (-267.190) [-266.567] (-271.069) -- 0:00:37
419000 -- (-268.335) (-267.330) (-267.575) [-267.821] * [-266.062] (-268.563) (-267.821) (-269.295) -- 0:00:37
419500 -- (-268.349) (-268.045) [-266.132] (-273.531) * (-266.915) (-269.787) [-265.795] (-268.033) -- 0:00:37
420000 -- (-275.247) (-269.124) (-267.502) [-269.168] * (-272.413) (-269.764) [-269.697] (-267.631) -- 0:00:37
Average standard deviation of split frequencies: 0.008825
420500 -- (-270.324) (-271.811) (-269.682) [-267.086] * [-271.324] (-268.768) (-270.178) (-267.361) -- 0:00:37
421000 -- [-267.685] (-271.970) (-269.394) (-267.043) * (-270.306) (-268.246) [-269.328] (-268.928) -- 0:00:37
421500 -- (-268.662) (-270.158) (-267.701) [-266.800] * (-267.033) (-270.367) (-272.746) [-267.684] -- 0:00:37
422000 -- (-269.450) [-272.374] (-269.464) (-270.043) * (-278.097) (-269.452) (-271.640) [-268.042] -- 0:00:36
422500 -- (-269.814) (-269.399) [-268.993] (-272.101) * (-269.001) (-271.384) (-270.214) [-268.048] -- 0:00:36
423000 -- (-269.777) (-269.287) [-270.828] (-269.166) * (-269.079) (-268.051) [-268.945] (-272.311) -- 0:00:36
423500 -- (-276.127) [-270.194] (-269.148) (-267.578) * (-268.477) (-269.072) [-267.591] (-268.565) -- 0:00:36
424000 -- (-271.328) (-267.920) (-268.466) [-270.628] * [-267.709] (-272.352) (-270.128) (-272.258) -- 0:00:36
424500 -- (-269.364) (-269.356) (-268.045) [-265.508] * (-269.925) (-268.556) [-269.778] (-271.361) -- 0:00:36
425000 -- (-268.965) [-266.286] (-270.597) (-271.296) * (-275.586) [-268.982] (-268.788) (-269.081) -- 0:00:36
Average standard deviation of split frequencies: 0.008853
425500 -- (-268.839) (-268.399) [-268.399] (-269.291) * (-273.762) (-266.207) (-267.848) [-269.443] -- 0:00:37
426000 -- (-268.630) (-267.989) (-270.302) [-268.879] * (-266.851) (-268.652) [-268.035] (-268.193) -- 0:00:37
426500 -- (-269.117) (-269.562) (-268.284) [-267.164] * (-266.902) (-270.211) (-271.201) [-268.445] -- 0:00:37
427000 -- (-271.275) (-267.238) (-269.831) [-269.749] * [-267.741] (-270.271) (-268.542) (-267.549) -- 0:00:37
427500 -- (-270.041) (-268.143) [-268.568] (-269.723) * (-269.084) (-271.703) [-266.426] (-268.394) -- 0:00:37
428000 -- (-268.486) (-268.180) [-269.179] (-266.640) * (-271.183) (-272.004) [-271.516] (-266.061) -- 0:00:37
428500 -- (-268.698) (-269.865) (-265.996) [-265.644] * (-275.788) (-267.222) (-275.585) [-268.943] -- 0:00:37
429000 -- [-267.442] (-270.085) (-269.137) (-268.812) * (-268.595) [-274.933] (-272.390) (-268.114) -- 0:00:37
429500 -- (-267.551) [-269.722] (-266.204) (-267.419) * (-269.586) (-268.257) [-267.725] (-269.039) -- 0:00:37
430000 -- (-269.635) (-273.073) (-268.337) [-267.469] * [-267.742] (-272.629) (-267.047) (-269.211) -- 0:00:37
Average standard deviation of split frequencies: 0.009547
430500 -- (-269.816) (-267.743) (-268.602) [-266.108] * (-267.978) (-270.635) (-276.151) [-267.175] -- 0:00:37
431000 -- (-269.830) (-267.196) (-268.863) [-268.227] * (-268.648) (-267.330) (-269.362) [-269.351] -- 0:00:36
431500 -- [-267.953] (-269.692) (-266.705) (-268.815) * (-267.721) (-267.652) (-269.409) [-267.072] -- 0:00:36
432000 -- [-269.277] (-269.479) (-267.833) (-273.575) * (-269.413) (-266.446) (-269.769) [-267.597] -- 0:00:36
432500 -- (-269.856) (-268.670) (-269.126) [-266.264] * (-268.586) [-269.903] (-269.939) (-275.858) -- 0:00:36
433000 -- [-269.599] (-267.940) (-270.825) (-270.131) * (-267.005) (-273.126) (-270.381) [-272.695] -- 0:00:36
433500 -- [-268.494] (-270.599) (-268.733) (-274.353) * (-266.756) (-268.464) [-269.450] (-270.710) -- 0:00:36
434000 -- (-266.058) (-269.347) [-269.731] (-268.536) * [-266.585] (-269.951) (-267.850) (-270.285) -- 0:00:36
434500 -- (-269.907) (-267.922) (-269.326) [-268.756] * (-269.499) (-267.988) [-266.094] (-271.464) -- 0:00:36
435000 -- (-275.969) (-270.129) (-273.899) [-268.521] * (-270.089) (-268.904) (-268.317) [-268.831] -- 0:00:36
Average standard deviation of split frequencies: 0.009130
435500 -- (-272.863) (-267.955) [-268.958] (-267.530) * (-267.032) (-268.360) [-269.110] (-267.534) -- 0:00:36
436000 -- (-269.600) (-268.991) (-268.859) [-268.079] * (-269.269) (-275.494) [-272.790] (-268.422) -- 0:00:36
436500 -- (-266.588) (-272.979) (-271.158) [-272.483] * (-268.654) [-269.385] (-270.052) (-268.025) -- 0:00:36
437000 -- [-269.203] (-267.840) (-268.865) (-267.824) * (-267.719) [-266.140] (-266.958) (-266.765) -- 0:00:36
437500 -- (-271.954) [-270.429] (-268.332) (-268.279) * (-274.258) (-271.142) [-268.003] (-268.018) -- 0:00:36
438000 -- (-270.980) [-267.836] (-267.887) (-270.915) * [-271.290] (-270.437) (-267.461) (-270.765) -- 0:00:35
438500 -- (-267.593) (-270.801) [-269.551] (-273.769) * (-268.050) (-274.433) [-266.505] (-268.112) -- 0:00:35
439000 -- (-268.982) (-269.089) [-269.532] (-269.332) * (-268.743) [-271.416] (-268.190) (-268.291) -- 0:00:35
439500 -- (-272.444) [-271.200] (-268.755) (-269.685) * (-268.491) (-270.320) (-266.261) [-269.266] -- 0:00:35
440000 -- (-271.469) (-268.904) (-268.219) [-268.456] * (-270.074) (-269.010) [-267.523] (-272.521) -- 0:00:35
Average standard deviation of split frequencies: 0.009866
440500 -- [-269.964] (-271.186) (-269.109) (-271.959) * [-267.611] (-267.355) (-265.725) (-266.991) -- 0:00:35
441000 -- (-268.032) [-269.109] (-269.219) (-270.274) * (-266.653) (-268.988) (-266.097) [-269.498] -- 0:00:35
441500 -- (-273.040) [-266.510] (-267.950) (-268.903) * (-270.943) (-268.915) [-265.479] (-267.494) -- 0:00:36
442000 -- (-268.959) [-267.482] (-268.611) (-268.348) * (-268.040) [-270.653] (-269.034) (-270.655) -- 0:00:36
442500 -- (-268.455) (-270.780) [-268.658] (-269.633) * (-268.470) (-268.924) (-278.042) [-267.133] -- 0:00:36
443000 -- [-267.579] (-268.823) (-268.266) (-268.655) * [-269.297] (-267.830) (-270.358) (-269.973) -- 0:00:36
443500 -- (-266.328) [-269.660] (-267.091) (-268.757) * [-266.583] (-268.308) (-266.519) (-268.907) -- 0:00:36
444000 -- (-266.033) (-267.384) (-267.897) [-270.965] * [-268.154] (-268.666) (-273.546) (-269.938) -- 0:00:36
444500 -- [-267.665] (-271.511) (-268.437) (-269.049) * [-269.196] (-266.948) (-267.842) (-269.769) -- 0:00:36
445000 -- [-268.498] (-273.612) (-269.155) (-271.039) * (-269.839) [-267.723] (-267.576) (-268.162) -- 0:00:36
Average standard deviation of split frequencies: 0.009806
445500 -- (-269.695) (-268.926) [-269.211] (-268.532) * [-267.088] (-269.504) (-271.413) (-266.401) -- 0:00:36
446000 -- [-268.363] (-267.615) (-269.993) (-267.642) * (-267.701) [-267.855] (-266.893) (-266.434) -- 0:00:36
446500 -- (-268.163) [-269.048] (-269.838) (-272.026) * [-269.979] (-271.700) (-270.217) (-268.322) -- 0:00:35
447000 -- (-267.655) (-266.612) (-268.287) [-269.093] * (-268.626) (-272.361) (-267.796) [-266.321] -- 0:00:35
447500 -- (-271.489) (-268.331) (-269.937) [-270.333] * [-268.439] (-266.275) (-265.716) (-265.653) -- 0:00:35
448000 -- (-268.489) (-267.534) [-270.600] (-273.359) * [-267.868] (-268.678) (-269.199) (-271.326) -- 0:00:35
448500 -- [-268.333] (-268.708) (-268.540) (-268.982) * (-272.838) (-266.837) [-268.266] (-266.353) -- 0:00:35
449000 -- (-270.458) (-270.219) (-273.353) [-266.787] * (-270.697) [-268.671] (-273.444) (-267.986) -- 0:00:35
449500 -- (-269.444) (-270.924) [-269.022] (-268.047) * [-267.344] (-270.553) (-267.733) (-269.206) -- 0:00:35
450000 -- (-271.190) (-273.854) [-266.126] (-268.841) * (-269.539) [-269.559] (-275.624) (-267.355) -- 0:00:35
Average standard deviation of split frequencies: 0.010111
450500 -- [-271.936] (-274.231) (-267.987) (-268.277) * (-273.952) [-268.996] (-268.924) (-274.158) -- 0:00:35
451000 -- [-267.834] (-269.437) (-271.141) (-271.124) * (-270.091) (-270.225) [-267.515] (-268.500) -- 0:00:35
451500 -- (-268.164) [-268.646] (-273.143) (-271.133) * (-268.320) (-267.394) (-269.559) [-266.934] -- 0:00:35
452000 -- [-270.272] (-272.846) (-270.493) (-269.459) * [-270.364] (-267.494) (-267.087) (-267.453) -- 0:00:35
452500 -- (-270.368) (-268.624) (-269.390) [-269.013] * [-266.590] (-271.224) (-268.576) (-267.693) -- 0:00:35
453000 -- [-269.164] (-268.377) (-271.782) (-270.905) * [-266.689] (-273.343) (-269.556) (-271.088) -- 0:00:35
453500 -- [-270.607] (-269.079) (-267.557) (-270.874) * [-268.502] (-275.382) (-273.000) (-271.968) -- 0:00:34
454000 -- (-270.077) [-269.363] (-266.613) (-268.029) * (-268.357) (-272.055) (-264.470) [-269.857] -- 0:00:34
454500 -- (-270.368) [-271.505] (-269.615) (-270.467) * (-271.877) (-268.909) (-268.454) [-267.871] -- 0:00:34
455000 -- (-267.081) (-270.030) (-272.021) [-265.450] * (-268.142) [-271.505] (-265.061) (-267.607) -- 0:00:34
Average standard deviation of split frequencies: 0.009706
455500 -- (-270.139) (-270.727) (-269.265) [-269.900] * (-270.254) (-269.414) [-268.521] (-266.981) -- 0:00:34
456000 -- [-271.178] (-267.618) (-271.325) (-267.480) * (-266.011) (-267.294) (-268.974) [-268.611] -- 0:00:34
456500 -- (-269.732) (-268.471) (-270.081) [-270.837] * (-267.379) (-269.914) (-267.458) [-265.479] -- 0:00:34
457000 -- (-266.897) [-269.406] (-270.281) (-267.770) * (-270.382) [-266.715] (-266.672) (-268.383) -- 0:00:35
457500 -- (-268.144) (-270.478) [-267.465] (-271.651) * (-267.015) [-268.496] (-267.023) (-267.057) -- 0:00:35
458000 -- (-270.039) (-266.768) [-275.937] (-272.008) * (-268.092) [-268.457] (-266.087) (-267.442) -- 0:00:35
458500 -- (-267.001) (-268.329) (-271.215) [-268.474] * (-270.066) [-268.048] (-267.410) (-271.042) -- 0:00:35
459000 -- (-269.206) [-268.386] (-269.939) (-269.602) * [-269.202] (-267.100) (-270.522) (-269.480) -- 0:00:35
459500 -- (-268.004) [-269.514] (-271.340) (-267.768) * [-270.103] (-269.501) (-267.575) (-267.377) -- 0:00:35
460000 -- (-273.192) [-270.414] (-268.366) (-268.366) * (-267.712) (-268.058) [-268.193] (-267.545) -- 0:00:35
Average standard deviation of split frequencies: 0.008869
460500 -- (-268.812) (-270.995) (-270.389) [-267.733] * (-268.440) (-267.287) [-270.421] (-268.921) -- 0:00:35
461000 -- (-265.068) (-272.585) [-267.506] (-269.988) * [-266.798] (-266.854) (-268.358) (-269.308) -- 0:00:35
461500 -- (-268.603) [-272.058] (-268.103) (-267.830) * [-267.904] (-268.236) (-267.335) (-271.236) -- 0:00:35
462000 -- (-269.702) [-270.331] (-269.871) (-268.491) * [-270.875] (-269.740) (-267.904) (-270.053) -- 0:00:34
462500 -- (-266.247) [-270.118] (-270.313) (-267.837) * [-273.821] (-268.923) (-267.047) (-269.909) -- 0:00:34
463000 -- [-267.716] (-266.733) (-269.287) (-272.291) * (-272.772) (-271.334) (-270.654) [-267.804] -- 0:00:34
463500 -- (-268.098) [-268.077] (-267.698) (-269.277) * (-269.269) [-271.241] (-268.103) (-267.478) -- 0:00:34
464000 -- [-267.722] (-269.043) (-268.042) (-270.873) * (-267.078) (-268.892) [-267.880] (-268.234) -- 0:00:34
464500 -- (-268.003) (-269.521) (-268.400) [-270.771] * (-268.778) (-268.864) (-270.377) [-267.368] -- 0:00:34
465000 -- (-271.876) [-269.933] (-269.768) (-269.905) * (-269.868) (-270.101) (-271.238) [-268.645] -- 0:00:34
Average standard deviation of split frequencies: 0.008655
465500 -- [-271.915] (-272.868) (-269.604) (-269.442) * (-270.830) (-267.697) [-270.284] (-269.084) -- 0:00:34
466000 -- (-268.277) [-268.270] (-269.273) (-268.236) * [-268.472] (-269.503) (-272.415) (-268.166) -- 0:00:34
466500 -- [-269.666] (-267.997) (-266.651) (-270.276) * (-270.036) [-267.318] (-274.133) (-269.101) -- 0:00:34
467000 -- (-269.166) [-268.252] (-270.816) (-267.131) * (-266.896) (-267.626) (-273.256) [-268.312] -- 0:00:34
467500 -- (-267.385) [-272.034] (-267.817) (-265.990) * [-267.246] (-267.739) (-276.673) (-268.743) -- 0:00:34
468000 -- (-269.091) [-271.070] (-268.567) (-270.399) * (-268.640) (-269.217) (-271.101) [-266.060] -- 0:00:34
468500 -- (-267.358) (-270.991) (-268.457) [-267.933] * (-270.073) (-267.075) [-273.211] (-267.239) -- 0:00:34
469000 -- (-269.937) [-268.602] (-268.646) (-268.212) * (-270.838) (-270.412) (-273.979) [-267.197] -- 0:00:33
469500 -- (-266.329) [-270.267] (-272.586) (-269.983) * (-267.468) (-267.306) [-267.992] (-266.666) -- 0:00:33
470000 -- (-271.760) (-271.292) (-270.494) [-270.527] * (-266.987) (-265.216) (-267.983) [-265.984] -- 0:00:33
Average standard deviation of split frequencies: 0.007901
470500 -- (-272.458) [-270.053] (-269.145) (-269.943) * (-266.784) (-272.054) [-268.659] (-266.689) -- 0:00:33
471000 -- (-273.508) (-266.871) [-268.697] (-270.683) * (-269.397) (-269.343) (-266.973) [-267.309] -- 0:00:33
471500 -- (-268.396) [-267.599] (-268.666) (-268.808) * (-267.013) (-268.834) (-269.733) [-265.124] -- 0:00:33
472000 -- (-267.001) [-270.268] (-275.666) (-268.154) * (-266.148) (-267.139) (-269.345) [-267.845] -- 0:00:33
472500 -- (-267.245) [-270.342] (-271.877) (-270.530) * (-268.184) (-271.788) [-269.250] (-267.682) -- 0:00:34
473000 -- (-268.541) [-268.434] (-266.450) (-270.463) * (-268.589) [-270.785] (-270.580) (-269.976) -- 0:00:34
473500 -- (-267.672) [-266.872] (-267.919) (-267.130) * [-270.212] (-269.200) (-268.061) (-270.931) -- 0:00:34
474000 -- (-270.915) (-268.203) [-268.741] (-271.384) * (-268.165) (-267.438) [-271.197] (-268.855) -- 0:00:34
474500 -- (-269.604) (-270.163) [-267.300] (-269.067) * [-267.053] (-267.193) (-275.511) (-267.465) -- 0:00:34
475000 -- (-269.554) (-269.201) [-266.879] (-268.731) * (-268.722) (-270.885) (-273.362) [-268.502] -- 0:00:34
Average standard deviation of split frequencies: 0.008356
475500 -- (-270.767) [-268.558] (-266.169) (-271.515) * (-272.874) (-267.653) [-270.544] (-270.352) -- 0:00:34
476000 -- (-269.798) (-268.571) (-270.682) [-266.160] * (-268.173) (-268.778) [-268.769] (-270.959) -- 0:00:34
476500 -- (-271.433) [-269.145] (-274.085) (-273.242) * (-268.093) (-271.682) [-268.998] (-271.151) -- 0:00:34
477000 -- (-268.091) (-270.771) (-269.292) [-267.791] * (-268.119) (-274.094) [-269.300] (-268.565) -- 0:00:33
477500 -- (-268.039) (-268.989) [-265.942] (-269.410) * (-267.766) [-272.104] (-267.511) (-266.998) -- 0:00:33
478000 -- (-266.276) (-269.127) [-267.787] (-270.037) * (-274.996) (-268.834) [-266.877] (-273.630) -- 0:00:33
478500 -- [-267.458] (-267.079) (-266.133) (-266.475) * [-268.033] (-280.750) (-267.349) (-268.044) -- 0:00:33
479000 -- [-268.131] (-269.479) (-266.826) (-270.363) * [-267.563] (-271.530) (-269.773) (-266.730) -- 0:00:33
479500 -- (-268.967) (-266.871) (-269.253) [-266.108] * (-275.492) [-266.933] (-267.013) (-267.827) -- 0:00:33
480000 -- (-267.207) [-269.356] (-270.864) (-271.392) * (-269.876) [-270.780] (-270.354) (-268.105) -- 0:00:33
Average standard deviation of split frequencies: 0.008152
480500 -- (-267.750) (-270.642) (-269.410) [-266.920] * (-272.506) (-268.471) (-268.460) [-269.089] -- 0:00:33
481000 -- (-268.954) (-269.803) (-267.207) [-266.319] * (-270.503) (-266.234) [-272.022] (-268.823) -- 0:00:33
481500 -- (-269.636) [-268.496] (-269.577) (-271.423) * [-270.785] (-270.354) (-271.843) (-268.927) -- 0:00:33
482000 -- (-269.191) (-269.961) (-267.357) [-273.801] * [-269.063] (-270.967) (-267.865) (-267.645) -- 0:00:33
482500 -- (-268.726) (-267.974) [-267.821] (-267.998) * (-269.174) (-269.303) (-270.073) [-268.265] -- 0:00:33
483000 -- (-269.140) (-267.482) (-269.112) [-270.247] * (-269.841) [-267.807] (-268.358) (-266.970) -- 0:00:33
483500 -- (-267.863) [-268.354] (-269.954) (-273.489) * (-269.339) (-268.658) [-269.162] (-265.771) -- 0:00:33
484000 -- [-270.356] (-270.543) (-274.317) (-268.717) * (-272.916) [-269.369] (-266.450) (-266.113) -- 0:00:33
484500 -- (-269.426) (-272.096) [-269.746] (-267.247) * (-268.109) (-269.493) (-273.280) [-268.314] -- 0:00:32
485000 -- (-270.161) (-272.713) (-269.954) [-267.563] * (-268.201) (-267.480) (-269.359) [-265.022] -- 0:00:32
Average standard deviation of split frequencies: 0.007942
485500 -- (-266.906) [-269.434] (-268.766) (-270.106) * [-266.117] (-270.749) (-270.620) (-266.890) -- 0:00:32
486000 -- (-268.468) (-267.147) [-266.199] (-269.855) * (-267.248) (-267.029) (-269.367) [-268.603] -- 0:00:32
486500 -- [-268.699] (-266.719) (-269.382) (-270.685) * (-269.585) (-268.600) [-268.789] (-269.448) -- 0:00:32
487000 -- (-271.549) (-268.519) [-268.870] (-269.546) * (-268.004) (-266.778) [-267.188] (-268.138) -- 0:00:32
487500 -- [-266.635] (-268.729) (-267.419) (-270.656) * [-269.550] (-268.085) (-267.547) (-270.129) -- 0:00:32
488000 -- (-267.773) [-267.989] (-269.038) (-269.481) * (-269.504) [-266.768] (-267.073) (-271.753) -- 0:00:32
488500 -- (-270.018) (-268.014) (-271.575) [-267.950] * (-268.659) [-265.986] (-267.456) (-271.900) -- 0:00:33
489000 -- (-268.591) [-267.208] (-270.365) (-266.833) * (-268.172) (-270.239) [-268.145] (-269.207) -- 0:00:33
489500 -- (-269.504) (-268.819) [-266.803] (-271.502) * (-271.380) [-269.384] (-268.453) (-270.811) -- 0:00:33
490000 -- (-269.458) [-266.781] (-267.152) (-270.361) * (-271.689) [-270.979] (-267.894) (-268.870) -- 0:00:33
Average standard deviation of split frequencies: 0.008647
490500 -- (-270.673) (-268.045) [-267.916] (-269.044) * [-267.004] (-267.099) (-269.004) (-267.545) -- 0:00:33
491000 -- (-269.220) [-267.821] (-273.308) (-269.134) * (-270.533) (-271.169) [-267.692] (-268.528) -- 0:00:33
491500 -- [-267.916] (-267.317) (-269.733) (-269.340) * (-271.307) [-272.783] (-269.126) (-268.132) -- 0:00:33
492000 -- (-271.246) (-270.809) [-270.101] (-269.926) * [-269.144] (-274.836) (-268.587) (-268.742) -- 0:00:33
492500 -- [-272.727] (-269.303) (-269.340) (-267.445) * (-270.748) (-267.686) (-268.348) [-268.799] -- 0:00:32
493000 -- [-270.580] (-270.663) (-270.485) (-269.972) * (-268.254) [-266.469] (-270.930) (-268.569) -- 0:00:32
493500 -- (-269.148) (-268.701) [-268.974] (-270.314) * (-267.817) (-267.126) (-269.944) [-269.040] -- 0:00:32
494000 -- [-270.301] (-269.854) (-276.832) (-270.061) * (-269.645) (-266.888) (-270.242) [-270.577] -- 0:00:32
494500 -- (-269.400) (-269.859) (-275.534) [-268.622] * (-269.899) (-271.445) (-268.193) [-267.632] -- 0:00:32
495000 -- (-269.064) (-268.596) [-272.117] (-272.146) * [-269.172] (-268.793) (-269.285) (-270.686) -- 0:00:32
Average standard deviation of split frequencies: 0.008197
495500 -- (-270.584) (-267.121) (-272.974) [-267.788] * (-268.042) (-266.555) [-270.752] (-269.702) -- 0:00:32
496000 -- (-269.754) (-266.493) [-268.403] (-268.227) * (-269.129) (-268.816) [-265.995] (-271.647) -- 0:00:32
496500 -- (-268.850) (-267.806) [-273.566] (-270.302) * (-272.166) (-267.171) [-267.662] (-269.845) -- 0:00:32
497000 -- (-269.740) (-271.277) [-267.684] (-268.231) * (-271.155) (-270.145) (-269.921) [-269.157] -- 0:00:32
497500 -- (-268.842) [-269.708] (-269.952) (-268.224) * (-268.620) (-267.162) (-268.051) [-270.717] -- 0:00:32
498000 -- (-267.374) (-270.856) (-267.265) [-265.470] * (-269.178) [-268.170] (-271.570) (-271.434) -- 0:00:32
498500 -- [-271.536] (-269.319) (-271.412) (-270.287) * (-267.705) (-269.737) [-267.896] (-269.929) -- 0:00:32
499000 -- (-269.913) [-268.786] (-274.919) (-267.826) * (-270.693) (-274.649) [-271.313] (-272.428) -- 0:00:32
499500 -- (-269.434) (-268.708) [-267.894] (-269.223) * (-268.580) (-267.523) [-269.244] (-268.979) -- 0:00:32
500000 -- (-268.466) (-269.212) [-267.385] (-268.570) * (-274.759) [-267.203] (-271.701) (-270.585) -- 0:00:32
Average standard deviation of split frequencies: 0.008592
500500 -- (-268.940) (-271.471) [-269.116] (-270.892) * [-269.045] (-268.755) (-270.041) (-270.004) -- 0:00:31
501000 -- [-268.972] (-271.026) (-269.388) (-268.546) * (-269.474) (-268.969) (-271.056) [-268.426] -- 0:00:31
501500 -- [-269.630] (-269.518) (-268.725) (-269.798) * [-272.228] (-269.534) (-269.265) (-268.203) -- 0:00:31
502000 -- (-269.542) (-268.003) (-267.566) [-266.578] * (-269.561) (-266.537) [-268.611] (-267.879) -- 0:00:31
502500 -- [-271.183] (-266.571) (-268.885) (-271.354) * (-269.611) (-268.403) (-270.197) [-266.628] -- 0:00:31
503000 -- (-270.230) (-270.147) (-268.009) [-268.730] * (-268.850) (-269.379) (-268.931) [-267.974] -- 0:00:31
503500 -- (-268.213) (-270.851) [-270.141] (-268.845) * (-266.377) (-267.582) [-269.716] (-268.658) -- 0:00:31
504000 -- (-270.239) (-270.942) (-269.135) [-270.511] * [-266.611] (-268.314) (-269.922) (-271.105) -- 0:00:31
504500 -- [-267.803] (-269.102) (-268.441) (-268.702) * (-271.429) (-270.159) [-266.830] (-268.828) -- 0:00:32
505000 -- (-269.713) [-269.445] (-270.693) (-270.605) * (-269.213) [-265.944] (-269.633) (-270.604) -- 0:00:32
Average standard deviation of split frequencies: 0.008501
505500 -- (-273.298) (-268.119) (-267.117) [-266.776] * (-267.098) (-265.790) [-271.244] (-269.153) -- 0:00:32
506000 -- (-268.428) (-267.766) (-266.167) [-267.196] * (-267.132) (-268.899) (-265.920) [-267.907] -- 0:00:32
506500 -- (-269.257) (-268.063) [-269.304] (-267.104) * [-271.317] (-268.962) (-270.975) (-266.575) -- 0:00:32
507000 -- (-273.589) [-267.450] (-267.154) (-267.909) * (-268.050) (-270.290) [-271.324] (-267.100) -- 0:00:32
507500 -- (-267.527) (-269.581) (-272.410) [-267.322] * [-269.416] (-270.418) (-266.766) (-269.664) -- 0:00:32
508000 -- [-269.612] (-266.627) (-270.436) (-271.226) * (-270.021) (-270.422) [-266.723] (-267.647) -- 0:00:31
508500 -- [-265.766] (-268.655) (-267.435) (-270.553) * (-268.487) (-268.447) (-270.589) [-267.918] -- 0:00:31
509000 -- (-272.209) (-267.120) (-267.844) [-272.819] * (-269.121) [-268.335] (-265.519) (-266.890) -- 0:00:31
509500 -- [-268.366] (-267.629) (-272.896) (-272.900) * [-273.537] (-268.122) (-268.687) (-266.158) -- 0:00:31
510000 -- (-268.704) (-268.065) (-268.349) [-274.419] * [-265.971] (-272.880) (-274.214) (-268.825) -- 0:00:31
Average standard deviation of split frequencies: 0.008135
510500 -- [-270.843] (-268.861) (-271.100) (-268.875) * [-269.828] (-268.282) (-271.132) (-276.256) -- 0:00:31
511000 -- (-268.043) [-265.220] (-268.327) (-269.433) * (-269.993) (-268.844) (-267.304) [-275.712] -- 0:00:31
511500 -- (-267.960) [-267.090] (-268.220) (-269.657) * (-267.824) [-267.428] (-269.338) (-276.689) -- 0:00:31
512000 -- (-268.822) [-268.312] (-269.247) (-267.105) * [-273.574] (-269.090) (-266.796) (-269.658) -- 0:00:31
512500 -- (-267.872) (-271.864) (-269.438) [-268.347] * (-270.795) (-266.509) [-267.240] (-270.311) -- 0:00:31
513000 -- (-271.219) [-271.156] (-268.430) (-267.838) * (-269.051) (-268.308) (-270.662) [-269.979] -- 0:00:31
513500 -- (-271.687) [-268.113] (-268.409) (-266.957) * (-268.529) [-268.488] (-268.596) (-269.446) -- 0:00:31
514000 -- (-271.647) (-265.170) [-268.785] (-267.085) * (-273.550) (-267.283) [-270.176] (-269.527) -- 0:00:31
514500 -- (-270.110) (-267.175) (-268.540) [-267.394] * (-268.077) [-266.329] (-271.521) (-268.491) -- 0:00:31
515000 -- [-268.578] (-268.568) (-266.842) (-268.526) * (-268.135) (-269.749) [-269.553] (-267.434) -- 0:00:31
Average standard deviation of split frequencies: 0.008222
515500 -- [-270.517] (-267.539) (-267.413) (-268.189) * (-270.670) [-268.694] (-270.101) (-271.393) -- 0:00:31
516000 -- [-268.708] (-268.836) (-268.778) (-270.746) * (-267.426) (-269.237) (-269.771) [-267.719] -- 0:00:30
516500 -- (-269.392) (-266.494) [-270.943] (-269.493) * [-269.536] (-268.018) (-269.289) (-269.690) -- 0:00:30
517000 -- [-272.250] (-266.686) (-268.493) (-268.389) * (-269.976) (-269.524) (-270.019) [-273.317] -- 0:00:30
517500 -- [-271.086] (-270.348) (-268.582) (-271.202) * (-266.734) (-267.804) (-271.785) [-270.018] -- 0:00:30
518000 -- (-267.955) (-265.294) (-269.136) [-269.244] * (-272.372) (-269.595) (-271.829) [-268.853] -- 0:00:30
518500 -- (-268.297) [-266.713] (-268.470) (-270.097) * [-272.416] (-267.351) (-268.682) (-270.146) -- 0:00:30
519000 -- [-268.990] (-269.406) (-268.461) (-268.384) * (-273.132) [-271.833] (-272.246) (-268.855) -- 0:00:30
519500 -- [-270.182] (-267.424) (-266.555) (-268.523) * (-267.370) (-268.355) [-267.131] (-269.714) -- 0:00:30
520000 -- (-268.018) [-266.920] (-267.173) (-268.591) * [-268.615] (-268.697) (-269.735) (-267.285) -- 0:00:30
Average standard deviation of split frequencies: 0.008148
520500 -- (-268.554) (-267.502) (-270.435) [-271.361] * [-267.016] (-266.046) (-268.733) (-268.940) -- 0:00:31
521000 -- (-269.431) (-266.657) [-266.532] (-268.653) * (-268.781) (-267.149) [-267.475] (-266.451) -- 0:00:31
521500 -- [-268.346] (-272.840) (-269.282) (-268.151) * (-268.676) (-269.024) (-270.661) [-267.661] -- 0:00:31
522000 -- [-268.915] (-271.827) (-266.607) (-273.116) * (-268.110) (-269.470) (-269.641) [-267.848] -- 0:00:31
522500 -- (-266.470) (-268.607) [-265.279] (-269.367) * (-268.260) (-269.623) [-269.604] (-268.883) -- 0:00:31
523000 -- (-267.609) (-271.368) [-266.309] (-267.922) * [-265.523] (-267.104) (-267.560) (-268.851) -- 0:00:31
523500 -- (-267.074) (-268.214) [-267.183] (-270.823) * (-266.093) (-270.296) (-266.886) [-267.272] -- 0:00:30
524000 -- (-267.831) (-268.487) [-267.000] (-269.479) * (-268.552) (-270.463) [-269.385] (-271.572) -- 0:00:30
524500 -- (-268.238) (-271.021) (-272.413) [-270.909] * [-268.942] (-267.522) (-268.110) (-268.444) -- 0:00:30
525000 -- (-270.286) [-269.990] (-272.416) (-274.764) * (-267.472) (-267.493) [-267.033] (-267.262) -- 0:00:30
Average standard deviation of split frequencies: 0.008570
525500 -- (-266.861) (-265.825) [-267.304] (-268.846) * (-267.832) [-271.509] (-268.637) (-266.607) -- 0:00:30
526000 -- (-265.844) (-269.716) [-268.099] (-267.141) * [-267.354] (-269.154) (-271.118) (-267.234) -- 0:00:30
526500 -- (-272.735) (-267.446) [-267.234] (-268.629) * [-266.217] (-266.598) (-270.307) (-269.709) -- 0:00:30
527000 -- [-269.591] (-267.847) (-268.470) (-274.211) * (-267.471) (-267.143) [-272.496] (-268.724) -- 0:00:30
527500 -- (-269.624) [-270.663] (-267.315) (-270.228) * [-268.917] (-269.495) (-269.687) (-270.031) -- 0:00:30
528000 -- (-271.233) (-269.588) [-268.583] (-270.318) * [-272.145] (-268.254) (-273.525) (-271.981) -- 0:00:30
528500 -- [-272.813] (-268.973) (-268.490) (-269.781) * (-267.622) (-267.181) [-269.883] (-269.782) -- 0:00:30
529000 -- (-268.878) [-267.973] (-270.199) (-268.537) * (-269.576) [-268.430] (-271.198) (-271.751) -- 0:00:30
529500 -- [-270.533] (-266.276) (-270.846) (-271.012) * [-267.646] (-267.533) (-273.072) (-267.697) -- 0:00:30
530000 -- (-269.759) (-269.439) (-268.429) [-269.294] * (-268.178) [-266.496] (-269.584) (-267.071) -- 0:00:30
Average standard deviation of split frequencies: 0.008831
530500 -- [-268.901] (-270.834) (-271.027) (-269.559) * (-267.712) [-267.800] (-270.467) (-265.523) -- 0:00:30
531000 -- (-271.650) (-271.681) [-270.022] (-269.941) * (-265.369) (-268.324) (-268.051) [-267.484] -- 0:00:30
531500 -- (-272.205) (-271.413) [-270.606] (-267.931) * (-269.177) (-268.741) [-265.539] (-268.569) -- 0:00:29
532000 -- [-266.007] (-270.299) (-269.337) (-268.738) * [-269.929] (-269.080) (-268.873) (-269.071) -- 0:00:29
532500 -- [-267.275] (-272.099) (-267.946) (-268.215) * (-272.952) (-267.154) [-269.267] (-269.631) -- 0:00:29
533000 -- (-268.352) (-270.646) (-267.474) [-267.512] * (-275.446) [-269.484] (-268.851) (-268.173) -- 0:00:29
533500 -- (-267.256) (-269.063) (-272.639) [-267.134] * [-269.279] (-268.192) (-267.017) (-267.130) -- 0:00:29
534000 -- [-268.938] (-269.857) (-271.427) (-268.915) * [-268.369] (-267.719) (-270.520) (-268.623) -- 0:00:29
534500 -- [-268.707] (-269.051) (-267.844) (-267.122) * (-267.437) (-267.562) [-269.083] (-269.202) -- 0:00:29
535000 -- (-270.489) (-267.109) [-268.514] (-266.740) * (-270.148) (-267.403) [-268.206] (-267.247) -- 0:00:29
Average standard deviation of split frequencies: 0.008795
535500 -- (-268.642) [-266.617] (-266.337) (-272.320) * (-269.403) [-268.354] (-268.399) (-267.493) -- 0:00:29
536000 -- (-267.491) (-270.365) (-272.006) [-267.998] * (-270.792) [-267.669] (-269.204) (-268.901) -- 0:00:29
536500 -- (-269.412) (-268.152) (-268.706) [-267.228] * (-275.272) [-264.801] (-268.673) (-266.869) -- 0:00:30
537000 -- (-268.244) [-270.123] (-268.365) (-268.292) * [-268.186] (-271.229) (-266.462) (-269.019) -- 0:00:30
537500 -- (-268.877) (-269.628) (-269.242) [-266.287] * (-271.830) (-268.548) (-272.059) [-268.185] -- 0:00:30
538000 -- (-270.701) (-268.955) [-269.083] (-272.021) * (-270.076) [-266.541] (-271.355) (-269.571) -- 0:00:30
538500 -- (-274.190) [-267.718] (-269.237) (-268.985) * (-267.639) (-271.677) (-273.160) [-268.725] -- 0:00:29
539000 -- (-268.742) (-268.246) [-266.389] (-272.670) * (-270.530) (-268.824) (-267.967) [-268.339] -- 0:00:29
539500 -- (-271.728) (-275.623) [-268.832] (-272.821) * (-270.140) (-266.471) (-267.487) [-269.248] -- 0:00:29
540000 -- (-267.572) [-269.125] (-267.862) (-269.114) * (-274.570) (-266.814) [-270.338] (-265.862) -- 0:00:29
Average standard deviation of split frequencies: 0.009126
540500 -- [-267.776] (-270.639) (-272.980) (-272.303) * [-270.363] (-268.204) (-269.265) (-266.099) -- 0:00:29
541000 -- (-268.680) (-271.064) [-268.060] (-269.989) * [-267.937] (-270.185) (-268.369) (-267.269) -- 0:00:29
541500 -- (-267.549) (-271.249) (-267.563) [-268.185] * (-268.700) (-273.221) (-267.883) [-271.497] -- 0:00:29
542000 -- [-269.881] (-268.924) (-267.937) (-267.868) * [-269.361] (-269.985) (-267.768) (-266.317) -- 0:00:29
542500 -- (-271.324) [-269.671] (-269.678) (-270.408) * (-271.876) (-268.296) (-270.476) [-268.264] -- 0:00:29
543000 -- (-269.760) (-269.287) [-271.297] (-270.882) * (-269.722) (-276.812) [-266.785] (-268.246) -- 0:00:29
543500 -- [-268.115] (-268.742) (-267.165) (-272.952) * (-269.451) (-271.217) (-269.372) [-268.735] -- 0:00:29
544000 -- (-269.308) [-267.927] (-266.546) (-272.085) * (-266.957) (-271.061) [-270.083] (-267.722) -- 0:00:29
544500 -- (-269.929) (-269.386) (-268.067) [-268.774] * (-268.564) (-270.301) [-272.297] (-267.611) -- 0:00:29
545000 -- (-270.431) (-270.015) [-267.845] (-271.696) * (-269.898) [-268.970] (-270.313) (-267.835) -- 0:00:29
Average standard deviation of split frequencies: 0.008837
545500 -- (-279.576) (-269.443) [-268.087] (-270.178) * (-267.705) [-269.019] (-270.203) (-268.294) -- 0:00:29
546000 -- (-273.358) (-269.079) (-269.783) [-266.880] * [-268.387] (-268.184) (-267.938) (-269.391) -- 0:00:29
546500 -- (-267.876) (-274.504) [-267.313] (-268.022) * (-269.566) (-267.343) [-267.227] (-266.249) -- 0:00:29
547000 -- (-267.315) (-268.708) [-273.359] (-270.405) * (-269.850) (-270.445) [-266.825] (-266.932) -- 0:00:28
547500 -- (-267.320) (-269.616) [-269.326] (-267.695) * (-267.601) (-268.400) [-268.338] (-266.764) -- 0:00:28
548000 -- (-273.747) [-269.735] (-269.333) (-268.594) * (-269.429) (-269.967) (-266.544) [-268.287] -- 0:00:28
548500 -- (-273.959) (-268.738) [-268.801] (-282.015) * (-269.383) [-267.091] (-266.805) (-266.895) -- 0:00:28
549000 -- [-266.919] (-271.456) (-267.953) (-267.630) * (-268.718) (-269.400) (-266.671) [-267.742] -- 0:00:28
549500 -- (-266.173) [-269.676] (-269.281) (-268.432) * (-269.401) (-270.355) [-266.387] (-267.503) -- 0:00:28
550000 -- [-268.563] (-269.875) (-269.652) (-270.913) * (-268.035) (-268.417) [-271.191] (-270.063) -- 0:00:28
Average standard deviation of split frequencies: 0.009366
550500 -- (-269.895) (-269.708) (-266.456) [-269.991] * (-271.412) [-268.734] (-269.117) (-268.745) -- 0:00:28
551000 -- (-270.018) [-267.450] (-269.167) (-266.723) * (-270.887) (-271.163) (-272.561) [-268.982] -- 0:00:28
551500 -- (-268.308) (-268.952) (-269.092) [-266.687] * (-267.271) (-271.051) (-266.562) [-266.585] -- 0:00:28
552000 -- (-268.978) [-267.209] (-270.022) (-266.908) * [-270.701] (-268.922) (-268.416) (-272.321) -- 0:00:28
552500 -- (-273.470) (-268.172) (-265.810) [-268.902] * (-269.667) (-268.050) [-268.005] (-270.849) -- 0:00:29
553000 -- (-271.489) [-268.237] (-270.078) (-270.102) * (-268.115) (-269.154) [-268.137] (-272.205) -- 0:00:29
553500 -- (-267.531) (-267.372) (-266.631) [-267.731] * (-268.402) [-271.976] (-266.279) (-271.742) -- 0:00:29
554000 -- (-268.192) (-271.048) [-268.696] (-270.699) * (-268.972) [-272.910] (-272.047) (-269.169) -- 0:00:28
554500 -- [-269.166] (-268.240) (-268.844) (-268.405) * [-267.056] (-266.127) (-269.519) (-270.197) -- 0:00:28
555000 -- (-269.046) (-268.539) (-267.720) [-269.392] * (-265.867) [-268.878] (-268.838) (-266.645) -- 0:00:28
Average standard deviation of split frequencies: 0.009526
555500 -- [-268.567] (-269.277) (-266.989) (-268.399) * (-270.501) (-270.530) (-267.796) [-266.680] -- 0:00:28
556000 -- (-270.451) (-268.241) (-267.121) [-268.810] * [-269.365] (-270.273) (-271.849) (-267.528) -- 0:00:28
556500 -- (-267.122) (-269.543) (-270.169) [-267.036] * (-269.741) (-267.352) [-269.753] (-270.702) -- 0:00:28
557000 -- (-267.971) [-270.018] (-277.121) (-268.455) * [-268.117] (-268.785) (-268.519) (-270.773) -- 0:00:28
557500 -- (-267.993) (-269.399) [-270.396] (-266.126) * (-266.433) (-269.893) [-270.904] (-268.618) -- 0:00:28
558000 -- [-268.134] (-267.375) (-271.154) (-274.291) * [-267.939] (-269.428) (-269.575) (-266.288) -- 0:00:28
558500 -- (-269.822) (-268.669) (-268.956) [-269.499] * (-267.833) (-269.543) [-268.823] (-268.230) -- 0:00:28
559000 -- (-267.461) (-273.211) (-270.672) [-268.164] * [-272.735] (-268.987) (-268.154) (-271.543) -- 0:00:28
559500 -- (-266.946) (-270.807) (-267.492) [-271.382] * (-270.899) [-270.716] (-267.864) (-271.154) -- 0:00:28
560000 -- (-266.202) (-270.531) (-269.448) [-271.710] * (-270.884) (-270.297) (-266.609) [-272.244] -- 0:00:28
Average standard deviation of split frequencies: 0.009644
560500 -- (-267.963) (-273.215) (-272.567) [-266.187] * (-269.123) (-275.598) [-267.164] (-269.107) -- 0:00:28
561000 -- (-267.611) [-266.705] (-268.225) (-269.639) * (-267.454) (-269.049) (-267.845) [-272.276] -- 0:00:28
561500 -- [-269.214] (-270.617) (-267.878) (-268.769) * [-269.671] (-268.607) (-271.285) (-271.696) -- 0:00:28
562000 -- (-269.936) (-268.950) [-270.190] (-271.224) * (-267.786) [-270.512] (-271.702) (-269.832) -- 0:00:28
562500 -- (-268.459) (-270.014) [-267.016] (-268.350) * [-266.991] (-268.889) (-271.792) (-271.288) -- 0:00:28
563000 -- (-267.416) (-271.429) (-268.705) [-267.722] * (-267.084) (-273.790) [-266.940] (-269.328) -- 0:00:27
563500 -- [-268.281] (-266.822) (-267.797) (-267.261) * [-266.573] (-269.235) (-266.295) (-270.819) -- 0:00:27
564000 -- (-266.732) [-269.512] (-268.556) (-270.515) * (-266.468) (-268.253) [-268.075] (-268.451) -- 0:00:27
564500 -- (-268.508) (-269.508) [-266.012] (-269.752) * [-270.462] (-266.147) (-271.213) (-275.092) -- 0:00:27
565000 -- (-271.285) (-268.772) (-269.983) [-268.051] * (-271.683) [-270.607] (-270.681) (-269.577) -- 0:00:27
Average standard deviation of split frequencies: 0.009211
565500 -- (-268.980) (-266.396) [-268.076] (-272.647) * (-273.800) (-269.337) [-272.809] (-271.112) -- 0:00:27
566000 -- [-267.877] (-269.144) (-270.683) (-269.173) * (-269.928) [-267.140] (-274.686) (-271.087) -- 0:00:27
566500 -- [-268.031] (-269.533) (-268.714) (-270.130) * (-269.342) (-269.573) (-269.668) [-269.113] -- 0:00:27
567000 -- (-268.335) [-269.869] (-268.999) (-267.693) * (-268.404) (-269.508) [-269.416] (-269.876) -- 0:00:27
567500 -- (-267.581) [-270.232] (-268.671) (-269.097) * (-267.570) (-268.826) [-271.124] (-270.197) -- 0:00:27
568000 -- (-268.003) [-267.599] (-271.338) (-266.514) * (-268.997) [-271.092] (-270.710) (-267.834) -- 0:00:27
568500 -- (-269.619) (-269.279) (-268.198) [-268.521] * (-269.065) [-267.750] (-269.821) (-269.931) -- 0:00:28
569000 -- (-267.026) [-268.426] (-272.284) (-269.725) * (-269.978) (-269.237) (-269.930) [-271.392] -- 0:00:28
569500 -- [-267.444] (-270.474) (-267.912) (-269.525) * [-270.616] (-272.003) (-267.151) (-269.611) -- 0:00:27
570000 -- [-267.654] (-270.779) (-271.304) (-272.317) * (-269.903) (-267.592) [-269.393] (-267.723) -- 0:00:27
Average standard deviation of split frequencies: 0.009378
570500 -- [-267.809] (-267.469) (-272.198) (-267.429) * (-270.479) [-266.578] (-271.726) (-266.850) -- 0:00:27
571000 -- (-267.140) [-269.964] (-271.181) (-270.406) * (-267.986) (-271.663) [-267.282] (-266.276) -- 0:00:27
571500 -- [-271.694] (-269.638) (-270.148) (-269.868) * (-270.782) (-270.411) [-269.889] (-266.616) -- 0:00:27
572000 -- (-272.610) (-269.436) [-269.292] (-269.006) * (-268.270) [-268.536] (-267.417) (-269.082) -- 0:00:27
572500 -- (-269.401) (-268.783) [-267.852] (-268.676) * [-268.964] (-270.578) (-265.710) (-270.092) -- 0:00:27
573000 -- [-268.363] (-267.653) (-270.303) (-271.514) * (-268.760) (-267.545) [-266.787] (-267.486) -- 0:00:27
573500 -- [-269.625] (-266.966) (-267.258) (-268.450) * (-268.578) [-269.263] (-270.652) (-272.236) -- 0:00:27
574000 -- (-270.992) (-266.622) [-266.801] (-268.695) * (-270.764) (-269.276) [-270.028] (-267.868) -- 0:00:27
574500 -- (-267.364) (-267.606) [-269.274] (-268.038) * (-268.635) (-269.702) (-267.521) [-267.885] -- 0:00:27
575000 -- (-267.977) [-267.831] (-268.827) (-268.693) * (-269.727) [-268.768] (-272.299) (-268.853) -- 0:00:27
Average standard deviation of split frequencies: 0.009616
575500 -- (-272.381) [-268.790] (-268.956) (-269.333) * (-267.735) (-267.425) [-268.850] (-268.706) -- 0:00:27
576000 -- (-271.440) [-266.456] (-266.840) (-268.857) * (-270.699) (-266.330) (-266.285) [-268.524] -- 0:00:27
576500 -- (-267.363) (-266.377) [-270.379] (-268.755) * (-272.186) (-269.154) (-268.820) [-269.630] -- 0:00:27
577000 -- (-265.659) (-266.883) [-268.521] (-268.459) * [-267.741] (-266.987) (-269.494) (-268.203) -- 0:00:27
577500 -- (-267.614) (-269.862) [-267.886] (-267.445) * (-266.909) (-268.520) (-268.410) [-270.534] -- 0:00:27
578000 -- (-267.784) [-268.146] (-268.609) (-267.652) * (-271.310) [-269.189] (-272.309) (-270.643) -- 0:00:27
578500 -- (-269.524) [-268.765] (-268.921) (-266.680) * (-271.526) (-277.489) [-272.407] (-270.042) -- 0:00:26
579000 -- [-267.586] (-268.908) (-271.903) (-266.081) * [-267.960] (-271.648) (-269.416) (-269.931) -- 0:00:26
579500 -- (-269.517) (-269.796) (-272.859) [-267.789] * (-271.372) [-269.587] (-272.197) (-270.361) -- 0:00:26
580000 -- [-267.235] (-267.270) (-270.700) (-266.134) * (-271.275) (-268.314) [-268.754] (-269.023) -- 0:00:26
Average standard deviation of split frequencies: 0.009235
580500 -- [-266.093] (-268.165) (-271.822) (-268.231) * (-270.573) (-270.914) [-271.305] (-269.092) -- 0:00:26
581000 -- (-269.656) (-269.398) [-267.083] (-269.153) * (-269.584) (-269.818) [-268.196] (-271.080) -- 0:00:26
581500 -- (-268.302) [-267.422] (-268.854) (-268.336) * (-267.706) (-274.200) [-269.265] (-273.429) -- 0:00:26
582000 -- [-266.222] (-269.661) (-269.739) (-267.407) * (-268.313) (-270.712) [-267.510] (-269.302) -- 0:00:26
582500 -- (-269.717) (-266.868) [-267.479] (-267.947) * (-267.731) [-268.983] (-271.918) (-272.735) -- 0:00:26
583000 -- (-269.024) (-267.625) (-270.072) [-266.596] * (-267.806) (-268.204) [-267.821] (-268.746) -- 0:00:26
583500 -- (-268.665) [-267.589] (-268.284) (-267.090) * (-270.764) [-267.362] (-266.411) (-269.189) -- 0:00:26
584000 -- [-267.663] (-267.544) (-267.119) (-266.890) * (-268.864) (-268.874) (-268.951) [-268.564] -- 0:00:26
584500 -- (-267.957) (-267.475) [-267.635] (-268.856) * (-268.921) (-266.603) [-269.933] (-268.830) -- 0:00:27
585000 -- [-269.019] (-271.573) (-269.990) (-266.309) * (-273.402) [-270.504] (-273.023) (-267.922) -- 0:00:26
Average standard deviation of split frequencies: 0.009804
585500 -- (-271.596) [-269.514] (-269.041) (-269.922) * [-267.363] (-269.470) (-270.743) (-268.205) -- 0:00:26
586000 -- (-269.780) (-271.146) (-266.474) [-265.761] * (-265.974) (-267.897) (-271.778) [-268.456] -- 0:00:26
586500 -- [-270.855] (-272.186) (-270.304) (-267.222) * (-267.117) (-270.486) (-270.251) [-271.420] -- 0:00:26
587000 -- [-270.052] (-274.089) (-267.856) (-268.019) * (-268.408) (-269.189) (-269.273) [-267.794] -- 0:00:26
587500 -- [-268.207] (-267.446) (-270.354) (-266.417) * [-266.279] (-269.855) (-275.675) (-268.750) -- 0:00:26
588000 -- (-276.456) [-269.759] (-272.545) (-269.149) * [-266.878] (-270.057) (-273.173) (-269.786) -- 0:00:26
588500 -- (-269.131) (-269.488) (-270.412) [-272.174] * [-271.042] (-268.838) (-272.691) (-269.580) -- 0:00:26
589000 -- (-266.749) (-267.260) [-269.512] (-269.110) * (-269.176) (-269.539) [-271.602] (-267.164) -- 0:00:26
589500 -- (-269.869) (-267.105) (-267.523) [-268.493] * [-267.328] (-267.250) (-272.034) (-269.916) -- 0:00:26
590000 -- (-270.686) (-267.845) [-267.578] (-270.947) * (-269.194) [-266.272] (-273.259) (-268.567) -- 0:00:26
Average standard deviation of split frequencies: 0.009527
590500 -- (-268.581) (-268.211) [-268.422] (-267.552) * (-273.201) [-268.429] (-275.669) (-268.573) -- 0:00:26
591000 -- (-269.349) (-266.881) (-270.638) [-271.710] * (-268.058) (-266.482) [-267.855] (-268.017) -- 0:00:26
591500 -- (-268.945) (-271.225) (-271.524) [-270.734] * (-270.823) (-270.743) [-274.878] (-267.792) -- 0:00:26
592000 -- (-268.928) (-270.776) (-273.492) [-270.767] * [-273.276] (-269.227) (-267.171) (-269.369) -- 0:00:26
592500 -- (-269.001) [-268.506] (-268.333) (-269.963) * [-269.848] (-270.777) (-269.029) (-267.409) -- 0:00:26
593000 -- (-271.400) (-267.973) [-265.966] (-266.807) * (-269.633) (-267.537) [-268.570] (-270.547) -- 0:00:26
593500 -- (-267.669) (-268.387) [-268.097] (-267.523) * (-267.340) [-267.994] (-270.953) (-267.545) -- 0:00:26
594000 -- (-267.558) [-269.261] (-267.502) (-269.625) * (-267.971) (-266.469) (-271.407) [-269.795] -- 0:00:25
594500 -- [-268.302] (-272.272) (-267.237) (-267.573) * (-271.240) (-271.351) (-267.480) [-266.867] -- 0:00:25
595000 -- (-267.340) (-268.257) (-269.006) [-268.915] * (-269.713) [-268.603] (-267.211) (-267.702) -- 0:00:25
Average standard deviation of split frequencies: 0.009046
595500 -- (-268.641) (-268.838) [-269.256] (-267.358) * (-270.753) (-271.278) (-275.848) [-268.107] -- 0:00:25
596000 -- (-268.239) (-268.024) [-268.864] (-269.116) * [-267.793] (-269.533) (-268.137) (-270.289) -- 0:00:25
596500 -- (-270.550) (-270.050) [-267.977] (-268.916) * (-272.490) (-267.998) (-268.559) [-266.767] -- 0:00:25
597000 -- [-268.402] (-268.613) (-273.273) (-272.769) * (-269.025) [-268.989] (-268.972) (-269.244) -- 0:00:25
597500 -- (-270.860) (-268.924) [-271.195] (-275.532) * (-268.629) (-269.152) (-268.405) [-268.701] -- 0:00:25
598000 -- (-270.178) (-270.117) [-270.774] (-268.476) * (-269.590) (-270.214) (-271.123) [-267.389] -- 0:00:25
598500 -- [-269.181] (-270.361) (-271.086) (-269.161) * (-272.862) (-266.446) [-267.915] (-271.897) -- 0:00:25
599000 -- (-267.237) (-268.574) (-270.638) [-268.270] * (-272.725) (-267.793) (-271.469) [-265.969] -- 0:00:25
599500 -- (-267.637) [-271.385] (-269.443) (-267.923) * (-265.928) (-270.972) [-268.754] (-267.639) -- 0:00:25
600000 -- (-269.521) (-269.714) [-268.216] (-268.430) * [-268.891] (-266.012) (-272.063) (-266.993) -- 0:00:25
Average standard deviation of split frequencies: 0.009156
600500 -- (-267.631) [-269.658] (-267.132) (-267.672) * [-268.693] (-267.615) (-269.170) (-270.549) -- 0:00:25
601000 -- (-269.644) (-267.951) (-270.336) [-270.060] * [-267.918] (-270.260) (-272.812) (-266.904) -- 0:00:25
601500 -- (-268.093) (-268.590) (-268.778) [-267.669] * [-267.142] (-268.452) (-266.019) (-266.987) -- 0:00:25
602000 -- (-272.347) (-269.389) (-270.640) [-266.059] * (-266.240) (-268.733) (-267.168) [-267.354] -- 0:00:25
602500 -- [-270.548] (-269.484) (-271.285) (-269.467) * (-267.850) [-268.293] (-276.499) (-269.346) -- 0:00:25
603000 -- (-268.678) [-274.473] (-269.882) (-267.643) * [-270.582] (-269.981) (-268.378) (-267.109) -- 0:00:25
603500 -- (-271.325) (-270.188) (-270.444) [-267.952] * (-270.052) (-270.812) [-267.995] (-268.773) -- 0:00:25
604000 -- (-267.338) [-269.167] (-270.062) (-267.895) * [-268.561] (-268.471) (-269.036) (-270.578) -- 0:00:25
604500 -- (-267.846) (-269.327) [-268.754] (-275.006) * [-267.600] (-270.837) (-267.435) (-268.161) -- 0:00:25
605000 -- (-269.152) (-269.298) (-269.153) [-269.495] * (-267.942) (-269.043) [-267.446] (-268.851) -- 0:00:25
Average standard deviation of split frequencies: 0.008764
605500 -- [-266.585] (-266.043) (-270.061) (-271.876) * (-268.619) [-271.464] (-268.841) (-270.875) -- 0:00:25
606000 -- (-269.610) [-269.470] (-269.506) (-266.643) * (-267.631) [-268.595] (-269.981) (-270.688) -- 0:00:25
606500 -- [-267.174] (-268.361) (-268.621) (-268.152) * (-272.733) (-269.012) [-267.601] (-268.847) -- 0:00:25
607000 -- (-267.757) (-268.308) (-267.225) [-266.999] * [-270.449] (-276.019) (-266.875) (-269.399) -- 0:00:25
607500 -- [-268.127] (-268.156) (-268.864) (-270.028) * (-268.888) [-267.354] (-267.298) (-267.856) -- 0:00:25
608000 -- (-269.186) (-269.605) (-267.388) [-270.661] * (-267.813) (-269.376) [-269.577] (-268.199) -- 0:00:25
608500 -- (-266.866) (-269.467) [-268.512] (-268.340) * (-268.925) [-267.556] (-272.155) (-267.465) -- 0:00:25
609000 -- (-267.055) (-269.998) (-269.058) [-268.917] * (-270.917) (-270.453) (-269.589) [-266.649] -- 0:00:25
609500 -- [-267.505] (-268.040) (-269.594) (-269.835) * (-271.985) [-266.053] (-269.441) (-269.344) -- 0:00:24
610000 -- (-266.817) [-267.842] (-269.765) (-267.645) * (-273.122) (-270.826) [-271.965] (-268.920) -- 0:00:24
Average standard deviation of split frequencies: 0.008389
610500 -- (-268.983) (-267.195) (-269.903) [-268.271] * (-272.002) (-268.420) (-268.453) [-271.828] -- 0:00:24
611000 -- (-267.831) (-267.543) [-268.699] (-268.966) * [-267.139] (-270.266) (-271.173) (-268.192) -- 0:00:24
611500 -- [-270.219] (-267.592) (-269.156) (-272.382) * [-267.763] (-268.032) (-270.644) (-266.100) -- 0:00:24
612000 -- [-268.095] (-269.433) (-269.365) (-269.605) * (-268.513) (-270.766) [-269.551] (-271.392) -- 0:00:24
612500 -- (-271.404) (-266.694) (-268.237) [-266.989] * (-272.009) (-267.636) [-270.889] (-267.778) -- 0:00:24
613000 -- (-267.884) (-267.563) (-268.482) [-269.952] * (-269.570) (-268.367) [-267.946] (-269.676) -- 0:00:24
613500 -- (-270.896) (-268.682) (-267.599) [-268.360] * (-267.896) (-268.522) (-270.155) [-269.788] -- 0:00:24
614000 -- [-273.433] (-266.724) (-269.028) (-269.801) * [-271.302] (-268.788) (-268.094) (-269.250) -- 0:00:24
614500 -- (-273.201) [-268.402] (-271.041) (-269.138) * [-268.594] (-270.631) (-269.971) (-271.519) -- 0:00:24
615000 -- (-272.365) (-269.067) [-267.830] (-267.542) * (-268.979) (-272.850) [-271.637] (-266.735) -- 0:00:24
Average standard deviation of split frequencies: 0.008673
615500 -- [-269.672] (-271.390) (-269.212) (-271.814) * (-270.311) [-267.175] (-268.479) (-268.867) -- 0:00:24
616000 -- (-275.339) (-276.666) (-268.830) [-268.669] * (-267.355) [-269.211] (-267.624) (-271.800) -- 0:00:24
616500 -- (-271.745) [-268.124] (-269.438) (-266.633) * (-267.921) (-268.609) (-268.357) [-273.275] -- 0:00:24
617000 -- (-273.674) (-271.317) (-269.453) [-268.330] * (-269.191) (-271.198) (-273.859) [-269.264] -- 0:00:24
617500 -- (-266.582) (-271.020) (-272.638) [-270.280] * [-267.869] (-268.991) (-270.048) (-268.416) -- 0:00:24
618000 -- [-266.900] (-266.916) (-270.486) (-267.929) * [-269.586] (-268.325) (-274.232) (-267.466) -- 0:00:24
618500 -- (-270.549) (-268.024) (-268.390) [-267.031] * (-271.113) [-268.514] (-267.603) (-268.940) -- 0:00:24
619000 -- (-270.839) [-265.615] (-268.845) (-268.795) * (-268.060) [-267.133] (-268.509) (-269.085) -- 0:00:24
619500 -- (-267.844) [-268.645] (-272.804) (-267.024) * [-266.490] (-269.293) (-268.023) (-269.711) -- 0:00:24
620000 -- (-267.191) [-265.983] (-271.217) (-269.181) * [-268.806] (-271.049) (-270.440) (-272.311) -- 0:00:24
Average standard deviation of split frequencies: 0.009257
620500 -- [-270.394] (-270.499) (-271.002) (-268.539) * (-270.721) [-269.612] (-268.883) (-267.800) -- 0:00:24
621000 -- (-269.337) (-267.875) [-271.004] (-267.508) * (-269.469) (-271.399) (-267.142) [-267.306] -- 0:00:24
621500 -- (-268.698) [-266.519] (-273.006) (-269.494) * (-269.561) [-271.771] (-267.972) (-269.447) -- 0:00:24
622000 -- (-269.297) (-269.105) (-269.974) [-266.566] * (-267.393) (-269.785) (-269.691) [-270.109] -- 0:00:24
622500 -- (-270.355) [-270.319] (-273.564) (-267.748) * (-268.826) [-272.593] (-270.457) (-269.234) -- 0:00:24
623000 -- (-272.559) (-269.635) (-268.046) [-269.576] * [-267.791] (-268.963) (-267.619) (-266.871) -- 0:00:24
623500 -- [-269.000] (-268.250) (-269.850) (-269.988) * (-267.634) (-270.730) [-264.998] (-268.245) -- 0:00:24
624000 -- [-269.283] (-268.321) (-267.430) (-270.307) * (-268.496) [-269.862] (-274.771) (-269.441) -- 0:00:24
624500 -- (-267.936) (-266.454) [-266.385] (-270.170) * (-267.525) (-270.680) (-266.170) [-269.695] -- 0:00:24
625000 -- (-271.361) [-269.213] (-267.504) (-266.783) * [-265.997] (-271.218) (-270.379) (-269.416) -- 0:00:24
Average standard deviation of split frequencies: 0.008936
625500 -- (-269.181) (-268.622) (-267.436) [-272.036] * [-265.204] (-270.006) (-271.579) (-269.985) -- 0:00:23
626000 -- [-268.395] (-270.415) (-267.649) (-269.488) * (-267.658) (-267.629) [-269.754] (-270.793) -- 0:00:23
626500 -- (-269.923) (-265.526) [-271.222] (-268.532) * (-268.513) (-269.424) (-269.587) [-267.675] -- 0:00:23
627000 -- (-272.209) (-267.193) [-268.176] (-270.743) * [-269.094] (-268.122) (-268.577) (-269.876) -- 0:00:23
627500 -- [-271.519] (-269.170) (-272.693) (-271.162) * (-266.598) (-270.601) (-274.202) [-269.269] -- 0:00:23
628000 -- [-266.263] (-268.868) (-275.152) (-269.188) * [-267.560] (-267.238) (-268.649) (-269.615) -- 0:00:23
628500 -- (-268.418) [-270.003] (-271.648) (-267.828) * (-274.293) (-269.469) [-268.279] (-270.150) -- 0:00:23
629000 -- (-269.227) (-267.768) [-270.471] (-272.037) * [-269.948] (-267.833) (-269.029) (-271.194) -- 0:00:23
629500 -- (-270.718) (-267.726) [-268.090] (-276.774) * [-270.907] (-269.276) (-274.374) (-269.069) -- 0:00:23
630000 -- [-268.948] (-266.931) (-268.254) (-271.244) * [-268.751] (-270.112) (-269.264) (-274.816) -- 0:00:23
Average standard deviation of split frequencies: 0.009119
630500 -- [-268.818] (-266.929) (-269.447) (-269.962) * [-270.948] (-269.593) (-267.753) (-266.826) -- 0:00:23
631000 -- (-266.965) [-269.558] (-269.743) (-268.267) * (-267.358) [-268.884] (-269.715) (-267.510) -- 0:00:23
631500 -- [-267.023] (-267.317) (-267.924) (-267.775) * (-267.684) (-269.337) [-268.915] (-266.996) -- 0:00:23
632000 -- (-268.939) (-267.672) [-268.246] (-267.457) * (-267.710) [-271.108] (-271.714) (-271.141) -- 0:00:23
632500 -- [-268.330] (-267.176) (-269.967) (-268.891) * [-267.690] (-274.565) (-272.819) (-272.072) -- 0:00:23
633000 -- (-271.337) (-266.358) [-269.580] (-268.472) * (-266.270) (-270.283) [-268.787] (-268.019) -- 0:00:23
633500 -- (-272.507) (-268.670) [-269.293] (-273.612) * (-266.184) [-266.961] (-271.598) (-266.319) -- 0:00:23
634000 -- (-267.744) (-268.079) [-268.144] (-268.953) * (-269.443) (-273.827) [-266.581] (-267.055) -- 0:00:23
634500 -- (-267.330) (-269.200) (-269.853) [-267.030] * (-267.565) (-269.327) [-267.884] (-267.631) -- 0:00:23
635000 -- (-269.505) (-266.058) [-270.248] (-269.442) * (-271.705) (-266.409) (-268.267) [-269.326] -- 0:00:23
Average standard deviation of split frequencies: 0.008894
635500 -- (-270.977) (-266.380) [-268.964] (-267.859) * (-270.802) (-269.422) (-268.891) [-271.090] -- 0:00:23
636000 -- (-277.519) [-265.655] (-267.598) (-268.753) * (-268.053) [-265.904] (-269.034) (-269.555) -- 0:00:23
636500 -- [-267.514] (-268.590) (-271.561) (-267.799) * (-269.804) [-267.740] (-269.465) (-269.517) -- 0:00:23
637000 -- (-269.438) (-266.820) [-267.133] (-267.447) * (-270.695) [-267.842] (-270.344) (-268.595) -- 0:00:23
637500 -- (-266.272) (-268.196) [-267.324] (-273.758) * [-267.243] (-268.414) (-270.035) (-270.405) -- 0:00:23
638000 -- (-268.271) [-268.240] (-268.761) (-271.455) * (-269.489) (-272.580) (-267.076) [-267.259] -- 0:00:23
638500 -- (-268.897) (-270.813) [-266.372] (-270.395) * (-267.450) [-269.739] (-271.120) (-268.531) -- 0:00:23
639000 -- (-268.326) [-265.593] (-267.120) (-271.126) * (-268.209) [-270.673] (-267.205) (-267.043) -- 0:00:23
639500 -- [-269.817] (-269.694) (-267.223) (-267.981) * (-267.057) (-269.467) [-266.794] (-268.925) -- 0:00:23
640000 -- [-271.748] (-276.728) (-270.600) (-271.015) * (-267.626) (-271.910) (-270.397) [-266.766] -- 0:00:23
Average standard deviation of split frequencies: 0.008692
640500 -- [-273.237] (-268.631) (-267.944) (-266.869) * (-267.603) (-275.524) [-269.886] (-271.208) -- 0:00:23
641000 -- (-270.806) (-268.389) (-278.735) [-266.843] * [-269.437] (-271.211) (-271.952) (-271.947) -- 0:00:22
641500 -- [-274.029] (-269.554) (-277.762) (-266.723) * (-268.894) (-266.993) [-271.300] (-271.361) -- 0:00:22
642000 -- (-269.775) (-271.573) [-268.279] (-268.953) * (-272.396) (-277.607) [-267.799] (-271.090) -- 0:00:22
642500 -- [-269.535] (-268.956) (-275.110) (-265.901) * (-269.734) (-275.782) [-269.813] (-271.001) -- 0:00:22
643000 -- [-271.995] (-271.310) (-272.392) (-269.522) * (-268.772) [-268.093] (-268.118) (-270.139) -- 0:00:22
643500 -- (-269.882) (-271.660) [-271.595] (-269.064) * [-267.257] (-269.887) (-267.016) (-268.649) -- 0:00:22
644000 -- (-270.227) (-268.286) (-268.941) [-268.480] * (-267.637) [-268.841] (-270.735) (-270.253) -- 0:00:22
644500 -- [-271.136] (-270.312) (-272.321) (-271.468) * (-274.481) (-269.073) [-271.632] (-273.756) -- 0:00:22
645000 -- [-268.737] (-268.604) (-266.551) (-268.639) * [-272.757] (-267.136) (-269.041) (-271.165) -- 0:00:22
Average standard deviation of split frequencies: 0.008620
645500 -- (-269.187) (-267.444) [-267.535] (-269.137) * (-270.900) [-267.996] (-267.928) (-270.120) -- 0:00:22
646000 -- (-271.592) (-267.801) (-268.662) [-268.025] * (-268.612) [-267.350] (-270.760) (-272.745) -- 0:00:22
646500 -- [-265.823] (-266.976) (-268.904) (-269.322) * (-270.413) [-268.155] (-274.974) (-268.725) -- 0:00:22
647000 -- (-265.745) (-268.946) [-269.285] (-269.576) * [-269.514] (-270.019) (-271.062) (-267.343) -- 0:00:22
647500 -- (-267.348) (-267.571) (-266.843) [-268.839] * (-267.939) (-270.640) (-269.963) [-268.765] -- 0:00:22
648000 -- [-267.428] (-270.234) (-268.936) (-269.411) * (-272.541) (-269.131) (-268.558) [-269.636] -- 0:00:22
648500 -- (-267.658) (-269.242) [-267.538] (-271.108) * (-272.236) (-270.906) (-268.633) [-269.560] -- 0:00:22
649000 -- (-269.501) (-272.622) [-273.235] (-271.272) * [-270.732] (-272.411) (-270.068) (-272.939) -- 0:00:22
649500 -- (-267.279) (-271.645) [-267.845] (-270.030) * (-268.309) (-270.436) (-266.951) [-267.534] -- 0:00:22
650000 -- (-266.885) (-271.115) (-267.876) [-267.884] * (-268.200) [-268.444] (-267.616) (-267.767) -- 0:00:22
Average standard deviation of split frequencies: 0.009056
650500 -- (-270.383) [-268.203] (-267.395) (-270.085) * [-268.113] (-267.666) (-270.517) (-268.573) -- 0:00:22
651000 -- [-271.514] (-271.257) (-268.310) (-269.614) * (-269.746) [-267.792] (-267.235) (-267.285) -- 0:00:22
651500 -- (-271.892) (-270.830) [-267.543] (-269.267) * [-267.681] (-272.798) (-269.331) (-267.192) -- 0:00:22
652000 -- (-269.583) (-268.030) [-269.542] (-268.947) * [-269.532] (-267.700) (-269.558) (-267.344) -- 0:00:22
652500 -- (-266.255) (-266.931) [-267.858] (-272.316) * (-268.529) (-270.511) [-268.227] (-269.617) -- 0:00:22
653000 -- [-271.466] (-267.918) (-268.051) (-269.503) * [-266.052] (-272.476) (-271.278) (-266.064) -- 0:00:22
653500 -- (-272.091) [-268.432] (-270.071) (-271.216) * (-267.798) [-267.727] (-268.424) (-268.659) -- 0:00:22
654000 -- (-273.334) (-268.296) (-271.028) [-270.506] * (-269.430) [-269.936] (-270.786) (-268.411) -- 0:00:22
654500 -- (-269.917) [-271.070] (-270.554) (-272.616) * [-267.611] (-268.194) (-268.391) (-267.848) -- 0:00:22
655000 -- (-267.599) [-268.753] (-266.711) (-273.873) * (-268.574) (-270.513) [-269.255] (-268.307) -- 0:00:22
Average standard deviation of split frequencies: 0.008848
655500 -- (-269.066) (-268.037) [-269.965] (-270.518) * (-270.852) (-269.682) (-270.464) [-273.450] -- 0:00:22
656000 -- (-269.590) [-268.105] (-271.358) (-267.855) * (-267.756) [-266.979] (-266.214) (-270.464) -- 0:00:22
656500 -- (-270.443) (-271.464) [-267.793] (-269.438) * [-267.899] (-267.414) (-266.157) (-271.582) -- 0:00:21
657000 -- (-268.405) (-269.444) (-269.559) [-271.106] * (-268.818) [-267.667] (-266.157) (-268.130) -- 0:00:21
657500 -- (-266.670) [-269.680] (-267.910) (-267.671) * (-266.440) (-268.683) (-267.509) [-269.616] -- 0:00:21
658000 -- [-269.760] (-269.414) (-270.329) (-270.089) * (-270.727) (-266.765) [-269.054] (-271.363) -- 0:00:21
658500 -- (-272.481) [-267.625] (-272.609) (-268.946) * (-271.748) [-268.216] (-268.690) (-268.148) -- 0:00:21
659000 -- (-269.007) [-269.249] (-270.637) (-268.795) * (-267.715) [-266.819] (-268.374) (-269.050) -- 0:00:21
659500 -- (-269.830) [-269.604] (-269.052) (-270.314) * [-268.914] (-267.717) (-270.640) (-270.613) -- 0:00:21
660000 -- (-268.736) (-268.288) (-269.363) [-267.096] * (-269.736) (-268.751) [-268.365] (-267.349) -- 0:00:21
Average standard deviation of split frequencies: 0.008696
660500 -- [-266.650] (-269.371) (-270.067) (-269.984) * (-279.631) [-267.579] (-270.149) (-268.446) -- 0:00:21
661000 -- (-267.826) (-268.256) (-269.785) [-268.608] * (-273.471) (-268.883) (-270.833) [-268.786] -- 0:00:21
661500 -- (-268.050) (-266.648) [-269.320] (-266.469) * (-269.046) (-269.301) [-265.388] (-270.375) -- 0:00:21
662000 -- (-268.411) [-273.009] (-276.397) (-267.969) * (-267.596) [-267.580] (-271.911) (-270.423) -- 0:00:21
662500 -- [-268.207] (-269.015) (-281.590) (-269.566) * [-270.101] (-271.703) (-267.875) (-268.476) -- 0:00:21
663000 -- (-271.810) (-268.093) (-271.620) [-267.771] * [-266.859] (-267.641) (-268.462) (-270.598) -- 0:00:21
663500 -- [-266.930] (-269.543) (-270.019) (-270.151) * (-273.213) (-267.208) (-271.130) [-268.955] -- 0:00:21
664000 -- [-267.582] (-268.620) (-269.332) (-269.509) * (-267.571) [-268.964] (-270.742) (-269.745) -- 0:00:21
664500 -- (-268.702) (-268.133) (-273.784) [-267.062] * (-268.853) [-268.311] (-267.745) (-269.763) -- 0:00:21
665000 -- (-271.028) (-267.907) (-269.563) [-268.402] * [-267.869] (-266.800) (-266.547) (-274.483) -- 0:00:21
Average standard deviation of split frequencies: 0.008538
665500 -- [-268.244] (-268.904) (-269.840) (-269.999) * [-267.092] (-267.474) (-266.901) (-271.767) -- 0:00:21
666000 -- (-268.558) (-270.078) (-268.268) [-269.563] * [-269.040] (-266.156) (-267.499) (-267.651) -- 0:00:21
666500 -- (-268.512) [-269.260] (-272.323) (-269.135) * (-268.519) (-268.442) (-266.727) [-267.829] -- 0:00:21
667000 -- [-272.862] (-267.171) (-267.016) (-271.559) * (-267.041) (-269.308) [-267.047] (-270.868) -- 0:00:21
667500 -- [-273.093] (-271.997) (-273.441) (-270.399) * (-268.935) [-268.707] (-272.984) (-268.358) -- 0:00:21
668000 -- (-269.648) [-270.268] (-270.037) (-271.809) * (-269.240) [-269.714] (-270.133) (-274.183) -- 0:00:21
668500 -- (-268.038) (-269.048) [-270.309] (-275.376) * (-268.620) (-268.313) (-270.361) [-268.364] -- 0:00:21
669000 -- (-268.579) (-266.011) (-273.196) [-266.036] * (-271.843) [-267.758] (-270.471) (-271.758) -- 0:00:21
669500 -- (-271.848) [-266.914] (-273.324) (-267.425) * (-272.590) (-269.782) [-268.371] (-270.208) -- 0:00:21
670000 -- [-267.617] (-266.584) (-270.820) (-267.300) * (-270.316) (-269.348) [-273.018] (-268.461) -- 0:00:21
Average standard deviation of split frequencies: 0.008786
670500 -- (-270.468) (-270.229) [-268.712] (-267.791) * (-270.053) (-268.435) (-267.826) [-268.040] -- 0:00:21
671000 -- (-270.636) [-269.316] (-269.607) (-266.703) * (-267.349) (-267.001) (-264.997) [-267.685] -- 0:00:21
671500 -- (-268.485) (-267.154) [-268.948] (-267.674) * [-268.367] (-267.178) (-270.292) (-268.484) -- 0:00:21
672000 -- (-271.996) (-268.143) (-266.978) [-265.787] * (-268.923) (-267.029) [-267.706] (-267.980) -- 0:00:20
672500 -- [-267.278] (-267.153) (-268.542) (-266.833) * (-268.851) (-268.277) (-266.910) [-268.713] -- 0:00:20
673000 -- [-268.330] (-269.450) (-270.435) (-267.857) * (-273.245) (-268.164) (-267.346) [-266.851] -- 0:00:20
673500 -- (-268.914) [-267.329] (-266.948) (-265.962) * [-266.675] (-269.821) (-270.047) (-269.681) -- 0:00:20
674000 -- (-269.818) (-268.858) [-269.254] (-270.785) * (-268.574) (-268.173) (-271.449) [-268.978] -- 0:00:20
674500 -- (-269.191) (-268.601) (-270.599) [-270.391] * (-268.523) (-266.527) [-270.371] (-271.044) -- 0:00:20
675000 -- (-270.632) (-269.925) (-270.578) [-269.467] * (-267.520) (-266.720) (-268.910) [-268.865] -- 0:00:20
Average standard deviation of split frequencies: 0.008760
675500 -- (-270.300) [-268.444] (-268.202) (-277.792) * [-268.440] (-266.535) (-268.661) (-269.165) -- 0:00:20
676000 -- [-268.523] (-269.666) (-271.245) (-267.219) * (-270.518) [-270.037] (-270.294) (-273.282) -- 0:00:20
676500 -- (-270.128) (-266.517) (-266.311) [-268.384] * (-268.696) [-271.535] (-275.210) (-272.369) -- 0:00:20
677000 -- (-267.896) [-268.559] (-267.627) (-269.024) * (-271.301) (-267.709) [-268.183] (-268.600) -- 0:00:20
677500 -- (-271.269) (-267.803) [-270.048] (-268.984) * (-274.085) (-265.805) [-267.640] (-268.094) -- 0:00:20
678000 -- (-269.205) [-269.902] (-271.195) (-269.177) * (-271.042) [-267.821] (-270.022) (-269.175) -- 0:00:20
678500 -- [-269.537] (-268.624) (-272.854) (-269.132) * (-265.923) (-270.237) (-270.934) [-268.335] -- 0:00:20
679000 -- (-266.444) (-267.092) [-266.672] (-270.559) * [-268.894] (-267.916) (-269.291) (-266.711) -- 0:00:20
679500 -- [-268.699] (-269.739) (-267.164) (-268.815) * [-269.926] (-268.091) (-274.762) (-268.216) -- 0:00:20
680000 -- [-270.696] (-267.065) (-269.447) (-267.478) * (-269.522) (-267.334) [-269.397] (-270.111) -- 0:00:20
Average standard deviation of split frequencies: 0.008787
680500 -- [-270.695] (-268.152) (-269.390) (-266.108) * (-266.554) [-266.287] (-270.041) (-269.144) -- 0:00:20
681000 -- [-267.553] (-269.390) (-267.916) (-268.058) * (-267.617) (-266.875) (-266.349) [-268.264] -- 0:00:20
681500 -- (-269.283) [-272.155] (-267.535) (-267.572) * (-266.592) (-268.361) (-269.072) [-266.948] -- 0:00:20
682000 -- [-268.107] (-267.638) (-269.253) (-269.404) * (-265.967) (-267.028) [-268.500] (-271.942) -- 0:00:20
682500 -- (-269.933) [-270.043] (-270.762) (-269.150) * (-268.782) (-271.269) [-267.802] (-270.252) -- 0:00:20
683000 -- (-268.731) (-268.515) (-271.846) [-266.318] * [-272.149] (-269.387) (-275.315) (-269.548) -- 0:00:20
683500 -- (-266.853) [-268.431] (-268.450) (-268.280) * (-269.108) (-268.292) [-267.685] (-267.933) -- 0:00:20
684000 -- (-269.249) (-272.134) [-267.431] (-267.056) * (-270.617) (-269.200) [-273.593] (-268.428) -- 0:00:20
684500 -- (-272.023) (-270.128) [-266.270] (-268.264) * (-269.545) [-267.515] (-267.470) (-271.166) -- 0:00:20
685000 -- (-267.026) (-270.134) [-266.939] (-267.384) * (-267.210) (-269.242) [-274.461] (-267.701) -- 0:00:20
Average standard deviation of split frequencies: 0.008633
685500 -- (-267.264) (-267.847) (-266.140) [-267.751] * (-267.168) (-271.520) [-269.786] (-266.210) -- 0:00:20
686000 -- (-268.198) (-267.800) [-270.352] (-272.637) * (-269.729) (-274.567) [-269.851] (-271.226) -- 0:00:20
686500 -- (-267.812) (-270.932) [-266.640] (-276.927) * (-266.730) [-267.168] (-270.302) (-270.496) -- 0:00:20
687000 -- (-268.920) (-266.286) [-271.448] (-269.502) * [-268.805] (-273.567) (-274.797) (-268.046) -- 0:00:20
687500 -- [-268.018] (-268.938) (-269.546) (-266.883) * (-268.254) (-273.316) (-269.664) [-267.380] -- 0:00:20
688000 -- [-266.716] (-268.469) (-270.908) (-269.081) * (-265.817) (-269.004) [-268.959] (-269.905) -- 0:00:19
688500 -- (-266.988) (-269.695) (-275.780) [-267.108] * (-267.899) [-268.677] (-269.495) (-268.860) -- 0:00:19
689000 -- [-267.660] (-267.693) (-269.175) (-267.884) * (-266.790) (-271.300) [-265.603] (-270.663) -- 0:00:19
689500 -- [-269.078] (-270.730) (-268.964) (-267.043) * (-268.306) (-267.595) (-268.754) [-269.069] -- 0:00:19
690000 -- (-268.265) (-267.803) [-267.990] (-265.791) * (-268.257) (-270.128) [-269.225] (-269.647) -- 0:00:19
Average standard deviation of split frequencies: 0.008702
690500 -- (-273.203) (-273.831) (-268.153) [-266.380] * (-266.165) (-270.993) [-268.543] (-272.189) -- 0:00:19
691000 -- [-266.944] (-270.894) (-269.442) (-266.097) * [-269.113] (-269.975) (-266.564) (-268.084) -- 0:00:19
691500 -- (-268.298) (-269.097) [-269.589] (-271.192) * (-268.566) (-270.012) [-267.547] (-271.271) -- 0:00:19
692000 -- (-274.097) (-268.919) [-266.814] (-271.270) * (-274.144) (-267.726) (-269.535) [-269.748] -- 0:00:19
692500 -- [-268.684] (-266.073) (-267.451) (-270.376) * [-271.216] (-268.996) (-270.267) (-270.094) -- 0:00:19
693000 -- (-267.718) (-266.629) [-266.205] (-268.660) * (-273.179) (-269.380) (-267.257) [-268.980] -- 0:00:19
693500 -- (-268.302) [-268.112] (-269.528) (-266.512) * (-268.214) (-269.807) [-267.673] (-272.701) -- 0:00:19
694000 -- (-266.823) (-270.965) [-266.893] (-267.412) * (-269.616) [-269.751] (-270.495) (-270.111) -- 0:00:19
694500 -- (-270.346) (-271.724) (-267.874) [-268.367] * (-265.788) [-268.152] (-266.166) (-267.030) -- 0:00:19
695000 -- (-268.720) (-270.624) (-267.097) [-271.183] * [-270.016] (-268.955) (-270.665) (-268.101) -- 0:00:19
Average standard deviation of split frequencies: 0.008339
695500 -- (-267.433) (-269.024) [-266.235] (-270.802) * (-268.929) (-269.412) (-269.768) [-266.889] -- 0:00:19
696000 -- (-268.921) (-271.562) (-266.343) [-268.237] * (-266.229) [-267.736] (-266.098) (-266.679) -- 0:00:19
696500 -- (-267.713) (-268.330) (-268.013) [-268.141] * (-271.015) (-267.814) (-265.852) [-269.295] -- 0:00:19
697000 -- (-276.616) [-270.386] (-266.155) (-270.347) * (-270.758) (-268.645) [-268.902] (-271.333) -- 0:00:19
697500 -- (-269.281) (-268.449) [-266.416] (-268.740) * [-268.420] (-270.356) (-269.482) (-268.159) -- 0:00:19
698000 -- [-269.469] (-267.969) (-266.557) (-269.837) * (-270.995) [-267.713] (-268.495) (-267.826) -- 0:00:19
698500 -- (-270.999) [-268.030] (-270.926) (-268.780) * (-267.594) [-269.323] (-273.477) (-269.188) -- 0:00:19
699000 -- (-268.360) (-272.753) [-267.951] (-269.211) * [-270.842] (-267.345) (-270.349) (-270.198) -- 0:00:19
699500 -- (-271.865) [-269.263] (-269.128) (-267.320) * [-266.727] (-269.230) (-269.336) (-271.454) -- 0:00:19
700000 -- (-271.843) [-267.894] (-268.454) (-268.492) * (-269.239) (-267.589) (-267.538) [-266.493] -- 0:00:19
Average standard deviation of split frequencies: 0.007905
700500 -- (-267.267) [-266.879] (-268.215) (-270.325) * (-269.670) (-268.744) [-269.147] (-267.820) -- 0:00:19
701000 -- (-270.520) [-269.414] (-274.762) (-269.422) * (-266.512) [-269.694] (-266.033) (-273.542) -- 0:00:19
701500 -- (-270.442) [-269.182] (-270.861) (-268.361) * (-269.235) (-268.653) [-269.183] (-268.889) -- 0:00:19
702000 -- (-270.031) (-268.920) [-267.062] (-268.471) * (-268.437) (-266.450) [-270.376] (-270.907) -- 0:00:19
702500 -- [-269.149] (-270.609) (-266.283) (-269.230) * (-269.643) (-267.117) [-271.414] (-267.696) -- 0:00:19
703000 -- (-269.362) (-268.165) [-267.832] (-270.783) * [-268.569] (-267.717) (-269.261) (-267.992) -- 0:00:19
703500 -- [-268.720] (-268.059) (-271.260) (-270.194) * [-267.495] (-265.686) (-268.365) (-267.997) -- 0:00:18
704000 -- (-267.853) (-270.800) (-269.141) [-268.506] * (-269.031) [-266.266] (-269.353) (-270.651) -- 0:00:18
704500 -- (-267.253) (-269.469) [-267.378] (-267.155) * (-265.893) (-267.480) (-267.753) [-271.196] -- 0:00:18
705000 -- [-269.789] (-270.122) (-266.403) (-267.607) * (-267.927) (-267.761) [-266.150] (-268.855) -- 0:00:18
Average standard deviation of split frequencies: 0.007637
705500 -- (-268.709) (-269.803) [-269.648] (-268.999) * [-268.641] (-270.806) (-270.180) (-271.378) -- 0:00:18
706000 -- (-266.265) (-267.824) (-268.890) [-270.422] * (-268.534) (-269.503) (-271.305) [-266.932] -- 0:00:18
706500 -- (-268.916) (-266.847) [-268.642] (-267.436) * (-266.971) (-273.546) [-266.784] (-272.491) -- 0:00:18
707000 -- (-270.747) (-267.354) (-268.176) [-266.934] * (-270.955) (-271.840) (-269.637) [-269.106] -- 0:00:18
707500 -- (-267.412) (-266.207) (-270.838) [-270.367] * (-268.478) (-270.110) (-267.107) [-267.639] -- 0:00:18
708000 -- (-272.162) (-268.352) [-271.000] (-270.000) * (-268.003) (-266.540) (-269.483) [-267.840] -- 0:00:18
708500 -- (-269.525) (-267.599) [-269.233] (-268.541) * (-273.012) (-268.467) (-267.031) [-268.972] -- 0:00:18
709000 -- [-270.349] (-268.565) (-271.066) (-273.269) * (-268.727) (-269.807) (-266.115) [-268.513] -- 0:00:18
709500 -- [-271.685] (-266.428) (-272.684) (-276.274) * (-269.111) (-270.919) [-267.443] (-269.677) -- 0:00:18
710000 -- (-270.304) (-268.140) [-267.241] (-268.804) * (-267.939) [-271.355] (-273.291) (-269.375) -- 0:00:18
Average standard deviation of split frequencies: 0.007255
710500 -- (-269.174) [-267.428] (-269.934) (-272.947) * (-272.548) (-271.261) (-267.916) [-269.050] -- 0:00:18
711000 -- (-268.955) (-267.606) [-267.435] (-266.602) * (-271.907) (-270.344) (-267.262) [-269.898] -- 0:00:18
711500 -- (-267.920) [-271.186] (-270.633) (-267.830) * [-267.277] (-271.639) (-270.051) (-269.046) -- 0:00:18
712000 -- (-271.914) [-268.156] (-268.467) (-268.100) * (-268.570) [-266.740] (-270.516) (-268.399) -- 0:00:18
712500 -- [-265.880] (-266.044) (-267.343) (-277.214) * (-267.849) [-267.722] (-267.368) (-272.148) -- 0:00:18
713000 -- [-269.165] (-266.811) (-270.018) (-267.400) * (-270.068) (-274.273) [-267.203] (-274.177) -- 0:00:18
713500 -- (-269.806) [-266.314] (-271.570) (-269.514) * (-269.872) (-272.766) (-272.064) [-268.701] -- 0:00:18
714000 -- (-270.239) (-268.353) [-269.675] (-269.346) * (-267.063) (-272.841) (-277.768) [-270.125] -- 0:00:18
714500 -- (-271.226) [-267.667] (-273.328) (-267.240) * (-273.999) [-268.265] (-275.220) (-269.863) -- 0:00:18
715000 -- (-265.504) (-268.273) (-273.496) [-268.869] * (-270.795) (-269.370) [-266.974] (-272.033) -- 0:00:18
Average standard deviation of split frequencies: 0.007242
715500 -- (-267.770) [-272.546] (-270.220) (-269.498) * (-269.492) (-269.442) (-267.741) [-274.157] -- 0:00:18
716000 -- (-267.382) (-269.470) [-266.872] (-269.101) * (-266.721) (-268.857) [-267.791] (-273.398) -- 0:00:18
716500 -- (-268.299) (-269.837) (-269.507) [-268.027] * [-268.134] (-266.777) (-272.058) (-268.720) -- 0:00:18
717000 -- [-269.445] (-269.963) (-270.702) (-268.730) * (-268.430) (-267.451) [-268.369] (-269.060) -- 0:00:18
717500 -- (-269.372) (-270.181) (-268.347) [-266.826] * (-266.423) (-269.968) (-269.871) [-270.062] -- 0:00:18
718000 -- (-269.973) [-268.652] (-268.040) (-274.726) * (-267.431) (-268.315) (-272.659) [-269.090] -- 0:00:18
718500 -- [-269.329] (-267.771) (-270.538) (-269.197) * (-268.087) [-266.947] (-268.702) (-269.807) -- 0:00:18
719000 -- [-268.866] (-268.412) (-270.035) (-270.948) * [-271.951] (-269.278) (-269.747) (-267.354) -- 0:00:17
719500 -- (-267.549) (-268.881) [-269.343] (-269.800) * [-269.365] (-266.938) (-268.442) (-268.615) -- 0:00:17
720000 -- (-269.761) (-268.131) (-268.055) [-269.030] * [-267.668] (-272.993) (-270.113) (-269.134) -- 0:00:17
Average standard deviation of split frequencies: 0.006991
720500 -- [-267.018] (-272.998) (-270.511) (-269.559) * [-269.082] (-268.658) (-271.542) (-269.981) -- 0:00:17
721000 -- (-270.230) (-267.721) [-267.585] (-269.332) * (-267.859) (-266.710) [-269.340] (-271.067) -- 0:00:17
721500 -- (-266.891) (-269.236) (-269.530) [-265.897] * (-269.367) [-267.467] (-268.786) (-270.279) -- 0:00:17
722000 -- (-269.923) [-266.566] (-269.667) (-266.711) * [-267.406] (-269.945) (-270.640) (-269.735) -- 0:00:17
722500 -- (-267.245) [-266.828] (-272.708) (-267.670) * (-269.213) (-269.289) (-271.082) [-271.664] -- 0:00:17
723000 -- (-270.729) [-266.974] (-271.670) (-267.698) * [-270.460] (-270.034) (-271.434) (-269.947) -- 0:00:17
723500 -- (-274.809) (-271.806) [-272.507] (-271.166) * [-268.817] (-268.676) (-270.330) (-268.123) -- 0:00:17
724000 -- (-272.258) (-270.071) [-267.009] (-278.235) * (-270.448) [-270.429] (-266.553) (-268.872) -- 0:00:17
724500 -- (-271.837) (-268.273) [-268.487] (-270.948) * [-267.019] (-270.134) (-269.233) (-266.532) -- 0:00:17
725000 -- (-270.165) (-266.828) [-270.648] (-272.021) * [-266.960] (-267.260) (-269.862) (-268.733) -- 0:00:17
Average standard deviation of split frequencies: 0.006737
725500 -- (-270.385) [-273.873] (-266.988) (-269.207) * (-269.496) (-270.483) (-271.231) [-265.832] -- 0:00:17
726000 -- (-267.387) [-269.710] (-269.667) (-271.104) * (-269.412) (-265.730) [-268.406] (-269.580) -- 0:00:17
726500 -- (-267.996) [-267.950] (-266.368) (-270.161) * (-268.155) [-266.332] (-270.329) (-270.207) -- 0:00:17
727000 -- (-269.244) (-270.923) (-267.043) [-270.082] * (-269.652) [-268.064] (-270.259) (-269.075) -- 0:00:17
727500 -- (-267.202) (-270.932) (-266.909) [-268.683] * (-268.344) (-268.252) (-267.099) [-267.868] -- 0:00:17
728000 -- [-270.360] (-272.532) (-266.560) (-269.047) * (-271.831) [-269.381] (-266.945) (-277.900) -- 0:00:17
728500 -- [-270.612] (-269.481) (-266.347) (-268.818) * [-269.864] (-271.038) (-267.665) (-270.110) -- 0:00:17
729000 -- (-268.212) (-270.048) [-269.035] (-267.781) * (-272.064) (-268.597) [-267.789] (-268.857) -- 0:00:17
729500 -- (-272.298) (-269.576) (-272.258) [-269.604] * (-273.268) (-269.015) [-270.276] (-269.182) -- 0:00:17
730000 -- (-267.943) [-269.438] (-270.046) (-270.574) * [-268.747] (-268.507) (-268.834) (-267.885) -- 0:00:17
Average standard deviation of split frequencies: 0.006210
730500 -- (-268.267) (-268.823) (-267.528) [-269.107] * (-271.862) (-267.975) (-268.287) [-266.683] -- 0:00:17
731000 -- (-269.266) [-269.276] (-267.129) (-269.675) * (-271.825) (-266.334) (-271.931) [-269.173] -- 0:00:17
731500 -- (-270.485) (-268.083) [-267.851] (-267.856) * [-266.891] (-268.246) (-270.955) (-266.554) -- 0:00:17
732000 -- [-272.898] (-269.081) (-268.607) (-268.080) * [-276.031] (-267.859) (-270.082) (-269.182) -- 0:00:17
732500 -- (-267.858) (-269.598) [-270.290] (-268.154) * (-277.291) (-268.430) [-271.003] (-265.751) -- 0:00:17
733000 -- (-266.820) (-268.922) [-268.717] (-268.925) * [-267.552] (-267.832) (-269.327) (-272.045) -- 0:00:17
733500 -- [-268.287] (-269.558) (-271.208) (-273.984) * (-268.782) (-266.253) [-269.644] (-267.242) -- 0:00:17
734000 -- (-268.925) (-271.078) [-267.604] (-269.665) * [-267.573] (-269.747) (-270.290) (-268.653) -- 0:00:17
734500 -- (-265.973) (-270.294) [-266.712] (-270.036) * (-270.033) (-270.846) [-267.099] (-271.929) -- 0:00:16
735000 -- (-266.315) [-269.917] (-267.194) (-268.172) * (-269.837) (-266.861) (-268.092) [-267.594] -- 0:00:16
Average standard deviation of split frequencies: 0.006485
735500 -- [-267.483] (-269.228) (-267.445) (-271.227) * (-266.956) (-267.524) (-271.073) [-269.387] -- 0:00:16
736000 -- (-269.578) (-269.385) [-268.314] (-269.100) * (-267.968) (-271.137) (-270.125) [-265.984] -- 0:00:16
736500 -- (-266.437) [-270.498] (-271.552) (-271.568) * (-268.964) [-269.905] (-269.886) (-269.721) -- 0:00:16
737000 -- (-272.180) (-271.547) (-266.875) [-267.966] * (-269.501) (-267.997) (-267.860) [-270.127] -- 0:00:16
737500 -- [-268.223] (-274.499) (-267.859) (-268.052) * [-267.755] (-269.955) (-268.333) (-269.445) -- 0:00:16
738000 -- (-269.894) (-267.981) [-267.069] (-268.652) * (-266.312) (-272.268) (-270.533) [-268.541] -- 0:00:16
738500 -- (-269.445) (-268.429) [-267.961] (-268.345) * (-269.929) [-270.454] (-265.697) (-267.142) -- 0:00:16
739000 -- (-267.139) (-268.278) (-271.216) [-274.133] * (-268.235) (-270.359) [-267.333] (-266.686) -- 0:00:16
739500 -- (-270.966) [-267.227] (-269.694) (-267.413) * (-265.983) (-268.711) (-268.747) [-269.260] -- 0:00:16
740000 -- (-266.794) (-271.306) (-268.327) [-265.286] * [-270.646] (-269.560) (-270.181) (-269.475) -- 0:00:16
Average standard deviation of split frequencies: 0.006563
740500 -- (-270.052) [-270.996] (-268.355) (-270.411) * [-272.025] (-269.085) (-269.973) (-266.589) -- 0:00:16
741000 -- (-267.686) (-270.248) (-268.174) [-266.933] * (-268.924) (-267.809) (-267.982) [-268.477] -- 0:00:16
741500 -- (-268.898) (-270.498) (-269.060) [-268.586] * (-270.128) (-268.845) [-270.005] (-269.908) -- 0:00:16
742000 -- [-267.680] (-269.347) (-271.291) (-268.606) * (-268.029) (-268.214) (-270.582) [-268.624] -- 0:00:16
742500 -- (-267.016) (-274.157) (-267.957) [-269.201] * (-270.963) (-270.245) (-271.069) [-268.211] -- 0:00:16
743000 -- [-270.770] (-273.801) (-267.803) (-272.529) * (-268.376) (-270.696) [-269.249] (-269.388) -- 0:00:16
743500 -- (-266.000) [-270.585] (-269.312) (-269.289) * (-267.544) [-269.184] (-269.073) (-274.857) -- 0:00:16
744000 -- (-267.847) (-267.245) [-267.960] (-268.804) * (-269.066) (-271.855) [-267.517] (-269.014) -- 0:00:16
744500 -- (-272.666) [-268.953] (-268.179) (-268.851) * (-267.586) (-268.102) [-269.562] (-271.982) -- 0:00:16
745000 -- (-267.211) (-269.941) [-267.722] (-267.721) * (-267.687) [-273.083] (-270.906) (-267.294) -- 0:00:16
Average standard deviation of split frequencies: 0.007227
745500 -- [-266.575] (-271.404) (-267.462) (-270.544) * [-265.872] (-269.969) (-267.110) (-268.482) -- 0:00:16
746000 -- (-268.466) (-268.647) (-268.359) [-268.752] * [-267.189] (-269.221) (-265.495) (-269.741) -- 0:00:16
746500 -- (-270.918) [-268.421] (-266.202) (-269.393) * [-266.453] (-269.271) (-268.435) (-269.632) -- 0:00:16
747000 -- (-273.861) (-267.939) (-271.288) [-268.345] * (-268.541) [-269.813] (-268.084) (-271.151) -- 0:00:16
747500 -- (-267.516) (-274.055) (-270.171) [-266.836] * [-270.079] (-275.388) (-267.753) (-271.322) -- 0:00:16
748000 -- [-270.888] (-266.768) (-268.212) (-268.742) * [-267.802] (-271.010) (-270.166) (-270.830) -- 0:00:16
748500 -- (-272.937) [-267.431] (-266.186) (-266.204) * [-266.302] (-270.644) (-266.532) (-265.300) -- 0:00:16
749000 -- (-277.794) (-269.373) [-266.659] (-267.925) * [-266.106] (-268.110) (-269.348) (-266.534) -- 0:00:16
749500 -- (-269.948) (-268.456) [-269.022] (-268.648) * (-267.227) (-266.763) [-269.429] (-268.523) -- 0:00:16
750000 -- (-267.826) (-268.177) (-267.817) [-271.162] * (-266.666) (-267.402) (-269.915) [-266.787] -- 0:00:16
Average standard deviation of split frequencies: 0.007104
750500 -- (-272.183) (-266.769) [-268.824] (-269.036) * (-267.348) (-271.198) (-266.935) [-266.882] -- 0:00:15
751000 -- [-268.223] (-272.638) (-268.555) (-270.778) * (-269.662) (-268.562) [-266.098] (-272.132) -- 0:00:15
751500 -- (-267.066) (-268.810) (-266.493) [-267.118] * [-267.297] (-271.830) (-268.137) (-270.011) -- 0:00:15
752000 -- (-269.418) (-270.672) (-266.808) [-267.467] * (-270.695) [-270.154] (-272.736) (-270.253) -- 0:00:15
752500 -- [-270.027] (-266.648) (-268.144) (-269.731) * (-271.293) (-271.216) (-271.128) [-268.179] -- 0:00:15
753000 -- [-268.607] (-270.440) (-269.660) (-269.613) * (-269.182) (-270.278) [-270.460] (-267.517) -- 0:00:15
753500 -- (-268.608) (-271.024) (-269.053) [-269.024] * (-270.664) (-268.787) [-266.360] (-266.400) -- 0:00:15
754000 -- (-270.838) (-266.993) [-267.670] (-271.655) * [-271.201] (-270.182) (-267.351) (-266.367) -- 0:00:15
754500 -- (-270.442) (-265.878) (-268.415) [-268.941] * [-266.542] (-266.213) (-267.912) (-268.971) -- 0:00:15
755000 -- (-266.572) (-268.957) [-268.914] (-269.621) * [-266.760] (-271.241) (-270.187) (-268.593) -- 0:00:15
Average standard deviation of split frequencies: 0.007522
755500 -- (-268.127) [-268.473] (-267.572) (-268.629) * [-268.631] (-267.191) (-271.448) (-272.098) -- 0:00:15
756000 -- (-275.592) (-266.514) (-267.483) [-272.989] * (-271.083) [-272.927] (-267.755) (-269.157) -- 0:00:15
756500 -- (-270.053) (-269.419) [-266.279] (-274.077) * (-268.681) (-272.147) (-266.698) [-266.511] -- 0:00:15
757000 -- (-265.725) (-267.968) [-268.075] (-268.309) * [-269.162] (-267.382) (-270.028) (-267.317) -- 0:00:15
757500 -- (-267.530) [-269.408] (-269.077) (-269.633) * (-271.022) (-272.028) (-267.526) [-267.399] -- 0:00:15
758000 -- [-265.633] (-268.745) (-267.882) (-267.765) * (-268.952) (-269.674) [-269.077] (-267.247) -- 0:00:15
758500 -- [-268.495] (-270.823) (-268.207) (-270.783) * (-268.375) (-267.397) [-271.246] (-270.409) -- 0:00:15
759000 -- (-270.030) [-266.982] (-273.069) (-270.774) * (-269.385) [-266.200] (-271.233) (-267.180) -- 0:00:15
759500 -- (-269.999) (-274.568) (-265.972) [-266.913] * (-271.176) (-268.850) [-267.354] (-269.535) -- 0:00:15
760000 -- [-267.212] (-268.292) (-268.094) (-267.796) * [-267.778] (-269.729) (-269.559) (-267.089) -- 0:00:15
Average standard deviation of split frequencies: 0.006662
760500 -- [-266.626] (-267.473) (-267.850) (-272.871) * (-271.950) [-267.029] (-269.801) (-267.424) -- 0:00:15
761000 -- (-268.791) [-270.702] (-269.195) (-270.955) * (-271.520) (-266.875) (-268.133) [-268.838] -- 0:00:15
761500 -- [-265.486] (-271.682) (-268.293) (-269.183) * [-266.917] (-269.065) (-266.909) (-268.945) -- 0:00:15
762000 -- (-266.644) [-269.753] (-267.399) (-269.614) * (-268.677) (-268.246) (-272.173) [-269.707] -- 0:00:15
762500 -- [-266.297] (-268.992) (-268.973) (-267.283) * [-266.965] (-273.564) (-267.490) (-273.230) -- 0:00:15
763000 -- (-266.723) (-269.748) [-269.872] (-267.974) * (-269.669) (-270.805) (-267.224) [-267.936] -- 0:00:15
763500 -- [-267.452] (-267.649) (-269.676) (-274.782) * (-269.273) [-268.696] (-273.152) (-269.878) -- 0:00:15
764000 -- (-269.530) [-267.661] (-271.108) (-268.215) * (-268.620) [-269.720] (-277.856) (-267.581) -- 0:00:15
764500 -- (-268.825) [-265.930] (-268.260) (-274.448) * [-270.852] (-270.415) (-273.931) (-269.183) -- 0:00:15
765000 -- [-269.624] (-267.056) (-277.023) (-269.328) * (-269.250) (-273.517) (-270.048) [-267.621] -- 0:00:15
Average standard deviation of split frequencies: 0.006385
765500 -- (-267.331) [-265.638] (-276.342) (-269.987) * [-269.071] (-270.540) (-267.058) (-267.954) -- 0:00:15
766000 -- (-268.574) (-265.685) (-272.182) [-269.164] * [-268.360] (-270.517) (-266.356) (-272.842) -- 0:00:14
766500 -- (-269.182) (-267.970) (-269.988) [-268.576] * (-266.750) (-268.614) [-271.369] (-267.850) -- 0:00:14
767000 -- (-268.548) (-266.241) [-267.109] (-268.409) * [-266.981] (-271.674) (-268.192) (-267.208) -- 0:00:14
767500 -- (-267.843) (-269.306) (-270.479) [-267.734] * [-269.446] (-267.446) (-267.687) (-269.551) -- 0:00:14
768000 -- (-269.241) (-270.176) (-268.022) [-270.300] * (-268.082) (-270.459) (-267.103) [-267.440] -- 0:00:14
768500 -- (-268.358) [-269.007] (-269.968) (-270.100) * (-267.531) [-269.706] (-269.619) (-268.008) -- 0:00:14
769000 -- [-268.270] (-267.276) (-269.279) (-268.872) * (-271.364) (-267.232) (-268.784) [-274.094] -- 0:00:14
769500 -- (-267.716) (-269.864) (-268.064) [-268.979] * (-270.017) (-270.112) [-269.522] (-271.303) -- 0:00:14
770000 -- (-267.615) (-267.989) (-273.045) [-270.299] * (-271.230) (-270.008) [-270.296] (-269.100) -- 0:00:14
Average standard deviation of split frequencies: 0.006549
770500 -- (-269.779) (-268.189) [-270.326] (-267.326) * (-273.623) [-267.109] (-270.301) (-270.718) -- 0:00:14
771000 -- [-268.692] (-270.278) (-269.638) (-270.909) * (-271.183) [-267.621] (-269.943) (-267.758) -- 0:00:14
771500 -- (-266.865) (-267.167) (-268.352) [-270.113] * (-271.644) [-267.835] (-273.149) (-270.346) -- 0:00:14
772000 -- (-265.570) (-267.813) (-270.682) [-269.684] * (-269.123) [-269.205] (-268.576) (-270.168) -- 0:00:14
772500 -- (-266.819) [-266.512] (-269.341) (-266.800) * (-267.200) [-266.371] (-267.638) (-268.627) -- 0:00:14
773000 -- [-268.184] (-267.750) (-268.571) (-268.134) * (-267.509) (-270.974) (-269.206) [-269.168] -- 0:00:14
773500 -- (-272.152) (-267.804) [-267.558] (-267.243) * (-269.716) (-265.868) (-271.385) [-268.050] -- 0:00:14
774000 -- (-268.358) [-265.489] (-267.812) (-270.112) * [-269.546] (-266.380) (-266.773) (-270.805) -- 0:00:14
774500 -- (-272.218) (-266.191) [-269.354] (-271.754) * [-267.177] (-267.142) (-269.759) (-273.360) -- 0:00:14
775000 -- (-268.538) (-268.459) (-269.231) [-269.894] * (-271.178) (-267.690) (-270.197) [-270.993] -- 0:00:14
Average standard deviation of split frequencies: 0.006611
775500 -- [-268.795] (-267.949) (-270.854) (-268.497) * [-268.110] (-269.304) (-267.588) (-271.109) -- 0:00:14
776000 -- [-269.070] (-267.401) (-270.624) (-269.652) * (-266.611) (-269.004) [-270.373] (-270.362) -- 0:00:14
776500 -- (-268.672) (-268.625) [-270.689] (-269.048) * (-267.255) (-266.960) [-266.320] (-269.444) -- 0:00:14
777000 -- (-270.646) (-269.402) (-268.393) [-267.918] * (-274.511) (-270.616) [-271.053] (-267.190) -- 0:00:14
777500 -- (-266.938) [-268.649] (-272.284) (-270.344) * (-268.257) (-277.515) (-267.738) [-268.720] -- 0:00:14
778000 -- (-268.406) [-269.095] (-269.195) (-271.263) * (-267.944) [-268.521] (-266.764) (-267.901) -- 0:00:14
778500 -- (-268.245) (-268.428) (-267.538) [-266.923] * [-268.954] (-270.793) (-270.305) (-270.070) -- 0:00:14
779000 -- (-266.456) (-266.299) (-268.853) [-270.260] * (-272.392) (-270.782) [-270.023] (-268.725) -- 0:00:14
779500 -- (-268.113) (-267.400) [-271.494] (-273.208) * (-268.331) [-269.462] (-267.844) (-269.101) -- 0:00:14
780000 -- (-273.469) [-269.330] (-271.142) (-272.069) * [-267.927] (-271.030) (-271.136) (-273.132) -- 0:00:14
Average standard deviation of split frequencies: 0.006378
780500 -- (-270.852) (-268.406) [-266.373] (-272.510) * (-268.368) (-269.676) [-269.259] (-269.168) -- 0:00:14
781000 -- (-266.127) (-266.612) (-269.146) [-267.672] * (-268.230) (-271.796) (-267.935) [-267.286] -- 0:00:14
781500 -- (-266.692) (-267.243) [-268.334] (-269.681) * (-270.219) (-267.272) (-268.256) [-268.971] -- 0:00:13
782000 -- (-270.456) (-269.720) (-273.408) [-270.963] * (-271.010) (-270.406) [-267.201] (-268.497) -- 0:00:13
782500 -- (-266.513) (-270.237) (-267.048) [-268.487] * (-268.198) [-272.324] (-268.808) (-268.189) -- 0:00:13
783000 -- (-274.368) (-267.740) [-269.486] (-270.098) * (-268.839) [-267.249] (-270.157) (-271.575) -- 0:00:13
783500 -- [-268.594] (-269.485) (-270.708) (-270.042) * (-268.880) [-268.179] (-270.150) (-271.666) -- 0:00:13
784000 -- (-267.131) [-268.343] (-269.376) (-269.538) * (-268.658) (-268.118) [-269.869] (-269.402) -- 0:00:13
784500 -- (-269.135) (-268.513) (-273.061) [-268.972] * (-270.305) (-267.004) (-268.536) [-270.627] -- 0:00:13
785000 -- (-268.923) (-270.582) (-269.320) [-266.431] * (-269.671) [-270.559] (-272.072) (-267.749) -- 0:00:13
Average standard deviation of split frequencies: 0.006703
785500 -- [-270.798] (-272.797) (-270.790) (-267.933) * [-268.777] (-274.800) (-269.443) (-270.654) -- 0:00:13
786000 -- (-268.265) (-271.509) (-268.128) [-268.961] * (-268.198) [-267.745] (-267.176) (-268.053) -- 0:00:13
786500 -- (-268.751) [-268.263] (-270.846) (-268.725) * [-270.724] (-268.774) (-269.839) (-267.626) -- 0:00:13
787000 -- [-268.831] (-269.081) (-269.157) (-273.641) * (-268.413) (-270.884) [-267.890] (-268.648) -- 0:00:13
787500 -- [-268.940] (-269.084) (-269.068) (-269.790) * (-269.507) (-268.744) (-269.281) [-266.514] -- 0:00:13
788000 -- [-267.380] (-269.669) (-269.723) (-268.958) * [-267.440] (-267.208) (-268.471) (-266.846) -- 0:00:13
788500 -- (-268.627) (-268.363) (-267.842) [-268.175] * (-269.135) (-273.063) [-266.753] (-268.525) -- 0:00:13
789000 -- (-267.419) (-268.371) [-267.614] (-268.340) * (-267.692) [-268.879] (-271.356) (-267.430) -- 0:00:13
789500 -- (-266.778) [-269.787] (-267.640) (-269.295) * (-266.505) (-269.271) [-267.756] (-268.421) -- 0:00:13
790000 -- (-266.948) (-271.938) (-266.699) [-267.830] * [-267.481] (-266.889) (-268.333) (-267.738) -- 0:00:13
Average standard deviation of split frequencies: 0.006633
790500 -- (-272.294) [-270.314] (-273.755) (-270.741) * [-266.634] (-269.180) (-268.316) (-270.677) -- 0:00:13
791000 -- (-266.873) [-268.420] (-272.915) (-268.950) * (-272.267) (-267.171) [-267.033] (-267.352) -- 0:00:13
791500 -- (-267.965) [-272.210] (-272.720) (-271.345) * (-271.279) (-270.293) (-271.435) [-267.404] -- 0:00:13
792000 -- (-268.774) (-268.903) (-269.279) [-266.677] * [-267.212] (-269.547) (-268.987) (-274.087) -- 0:00:13
792500 -- [-269.461] (-270.592) (-272.431) (-268.185) * (-266.750) [-267.962] (-267.765) (-268.832) -- 0:00:13
793000 -- (-267.234) [-271.010] (-268.545) (-267.732) * (-271.663) (-269.105) (-266.623) [-272.009] -- 0:00:13
793500 -- [-268.439] (-269.416) (-272.362) (-269.673) * (-267.718) (-272.443) (-266.036) [-268.763] -- 0:00:13
794000 -- (-268.125) [-271.824] (-268.742) (-267.085) * (-268.045) (-266.852) [-267.029] (-268.096) -- 0:00:13
794500 -- (-269.004) [-267.841] (-275.182) (-268.898) * (-266.462) [-269.850] (-267.538) (-270.866) -- 0:00:13
795000 -- (-269.412) (-266.603) [-267.071] (-269.941) * (-266.949) (-267.141) [-270.368] (-270.922) -- 0:00:13
Average standard deviation of split frequencies: 0.006773
795500 -- (-271.108) [-269.326] (-266.461) (-270.843) * (-269.461) (-267.924) [-268.420] (-271.096) -- 0:00:13
796000 -- (-273.689) (-268.619) [-266.239] (-271.065) * (-267.337) (-269.620) [-268.231] (-272.632) -- 0:00:13
796500 -- (-269.663) [-268.644] (-267.355) (-265.920) * (-269.627) [-269.447] (-267.310) (-267.400) -- 0:00:13
797000 -- (-269.934) [-268.928] (-268.667) (-266.284) * [-267.954] (-269.705) (-269.614) (-269.573) -- 0:00:12
797500 -- (-268.762) [-270.816] (-269.571) (-266.406) * (-266.716) [-271.844] (-266.454) (-268.163) -- 0:00:12
798000 -- (-268.774) (-272.489) [-268.770] (-268.561) * (-268.775) (-270.805) [-267.799] (-269.785) -- 0:00:12
798500 -- [-274.459] (-270.567) (-272.447) (-266.229) * (-267.471) (-269.582) [-268.182] (-269.243) -- 0:00:12
799000 -- [-270.376] (-273.694) (-266.887) (-269.746) * [-268.698] (-270.140) (-270.671) (-270.681) -- 0:00:12
799500 -- [-268.846] (-271.568) (-268.164) (-271.557) * (-269.995) (-267.470) [-267.643] (-267.459) -- 0:00:12
800000 -- (-266.947) (-272.070) (-266.913) [-269.428] * (-267.310) (-271.188) (-270.975) [-268.982] -- 0:00:12
Average standard deviation of split frequencies: 0.007176
800500 -- (-266.379) (-267.822) (-266.991) [-270.213] * (-267.920) (-272.840) [-272.897] (-268.841) -- 0:00:12
801000 -- (-267.521) (-267.891) (-267.063) [-275.886] * (-269.329) [-269.651] (-269.350) (-269.496) -- 0:00:12
801500 -- (-269.193) (-269.019) (-266.037) [-270.393] * [-269.621] (-268.965) (-266.115) (-271.387) -- 0:00:12
802000 -- (-273.299) (-269.506) (-269.645) [-267.671] * [-266.581] (-270.459) (-269.440) (-270.672) -- 0:00:12
802500 -- [-270.996] (-269.403) (-266.927) (-268.767) * (-267.621) [-270.919] (-268.887) (-266.908) -- 0:00:12
803000 -- (-266.986) (-271.682) (-271.035) [-268.074] * (-270.919) [-268.394] (-270.987) (-267.591) -- 0:00:12
803500 -- (-274.144) (-267.512) (-269.560) [-270.293] * [-267.509] (-272.179) (-269.107) (-270.627) -- 0:00:12
804000 -- (-270.639) (-269.394) (-268.311) [-268.630] * (-270.346) (-268.003) (-269.881) [-268.196] -- 0:00:12
804500 -- (-268.714) (-270.417) [-267.274] (-268.849) * (-269.691) (-270.325) (-270.239) [-269.436] -- 0:00:12
805000 -- (-268.990) (-269.891) (-270.230) [-267.931] * (-269.920) [-269.425] (-268.003) (-270.659) -- 0:00:12
Average standard deviation of split frequencies: 0.006909
805500 -- (-268.022) (-269.557) [-270.373] (-270.220) * (-268.285) [-265.929] (-269.004) (-267.266) -- 0:00:12
806000 -- (-268.129) (-267.120) (-267.937) [-268.983] * (-268.277) (-268.492) [-270.741] (-268.504) -- 0:00:12
806500 -- (-271.890) [-270.153] (-265.869) (-267.140) * (-266.980) (-268.813) [-270.565] (-269.526) -- 0:00:12
807000 -- (-267.312) (-271.073) [-265.861] (-268.057) * (-272.495) [-267.430] (-270.743) (-267.359) -- 0:00:12
807500 -- [-273.748] (-270.186) (-267.994) (-270.255) * (-272.852) [-268.316] (-269.152) (-268.630) -- 0:00:12
808000 -- [-269.343] (-272.082) (-273.345) (-267.796) * (-269.299) [-269.434] (-270.117) (-269.597) -- 0:00:12
808500 -- [-266.678] (-274.024) (-269.836) (-269.493) * [-268.604] (-265.889) (-268.876) (-270.671) -- 0:00:12
809000 -- (-269.189) (-268.737) (-269.860) [-266.658] * [-266.171] (-267.009) (-266.783) (-270.003) -- 0:00:12
809500 -- [-268.316] (-266.871) (-266.833) (-274.599) * [-268.522] (-270.928) (-265.729) (-269.207) -- 0:00:12
810000 -- (-267.396) [-268.652] (-270.284) (-272.985) * [-272.701] (-271.970) (-270.625) (-271.216) -- 0:00:12
Average standard deviation of split frequencies: 0.006942
810500 -- (-268.324) (-267.098) [-270.264] (-268.451) * (-269.164) [-267.388] (-269.002) (-269.604) -- 0:00:12
811000 -- (-266.945) (-268.693) [-268.812] (-273.862) * (-269.267) (-267.192) (-266.354) [-267.824] -- 0:00:12
811500 -- (-268.072) [-270.136] (-269.922) (-271.389) * (-268.753) (-271.705) (-269.384) [-265.931] -- 0:00:12
812000 -- [-267.845] (-266.501) (-269.520) (-268.390) * (-268.591) (-268.332) [-268.517] (-268.982) -- 0:00:12
812500 -- (-269.549) (-267.871) (-269.644) [-272.521] * (-266.300) (-268.058) [-269.669] (-270.750) -- 0:00:12
813000 -- (-272.085) (-269.050) (-266.965) [-266.631] * (-266.085) [-268.778] (-270.762) (-270.479) -- 0:00:11
813500 -- [-269.267] (-269.934) (-269.428) (-268.195) * [-268.057] (-266.815) (-268.129) (-269.009) -- 0:00:11
814000 -- (-272.987) (-268.894) [-270.406] (-270.784) * (-269.931) (-268.821) (-269.648) [-265.170] -- 0:00:11
814500 -- (-271.867) (-269.366) [-268.363] (-268.055) * [-270.104] (-268.527) (-266.961) (-268.129) -- 0:00:11
815000 -- (-272.669) (-268.939) [-268.585] (-269.049) * (-270.499) (-267.513) [-265.537] (-267.404) -- 0:00:11
Average standard deviation of split frequencies: 0.007077
815500 -- (-269.687) (-272.526) (-269.046) [-272.754] * (-268.115) (-269.062) (-268.258) [-268.081] -- 0:00:11
816000 -- (-269.217) [-272.890] (-270.610) (-268.359) * (-266.412) [-267.554] (-266.350) (-268.879) -- 0:00:11
816500 -- (-272.642) (-266.457) (-266.127) [-268.565] * [-267.962] (-270.788) (-274.454) (-267.228) -- 0:00:11
817000 -- (-270.356) (-268.046) (-267.623) [-270.791] * (-268.952) [-267.060] (-270.283) (-269.686) -- 0:00:11
817500 -- (-269.740) (-267.800) [-265.599] (-266.699) * (-268.812) [-267.028] (-269.270) (-271.463) -- 0:00:11
818000 -- (-268.183) (-271.600) (-266.717) [-268.419] * (-269.856) [-266.606] (-270.804) (-268.732) -- 0:00:11
818500 -- [-268.815] (-268.170) (-268.976) (-269.590) * (-267.476) (-267.773) [-268.479] (-271.234) -- 0:00:11
819000 -- (-268.952) (-267.115) [-269.475] (-269.825) * (-271.786) (-268.007) (-267.465) [-265.959] -- 0:00:11
819500 -- [-269.560] (-268.380) (-268.713) (-265.160) * (-271.343) (-269.877) (-266.776) [-266.769] -- 0:00:11
820000 -- (-267.713) (-267.111) (-267.853) [-273.082] * (-266.012) [-267.060] (-267.842) (-273.006) -- 0:00:11
Average standard deviation of split frequencies: 0.007467
820500 -- [-268.248] (-269.258) (-269.926) (-268.075) * (-268.411) (-269.394) (-266.818) [-267.001] -- 0:00:11
821000 -- [-272.484] (-269.750) (-268.152) (-269.531) * (-269.535) [-268.230] (-266.278) (-266.968) -- 0:00:11
821500 -- [-266.916] (-271.131) (-267.947) (-269.674) * (-268.701) (-267.015) (-267.868) [-266.871] -- 0:00:11
822000 -- [-266.776] (-270.583) (-266.918) (-268.623) * (-272.254) (-270.035) [-267.019] (-267.232) -- 0:00:11
822500 -- (-267.927) (-268.270) [-268.195] (-270.391) * (-271.639) [-264.858] (-271.506) (-269.202) -- 0:00:11
823000 -- (-276.586) (-268.295) (-269.255) [-267.731] * (-270.025) [-267.584] (-270.511) (-265.477) -- 0:00:11
823500 -- (-274.359) [-267.159] (-266.925) (-266.587) * (-268.030) (-269.544) (-270.863) [-265.365] -- 0:00:11
824000 -- (-267.646) [-271.800] (-269.313) (-268.573) * [-271.545] (-267.727) (-269.671) (-268.853) -- 0:00:11
824500 -- (-272.075) [-271.669] (-274.336) (-271.428) * [-265.756] (-269.744) (-269.651) (-270.466) -- 0:00:11
825000 -- (-270.342) (-268.986) [-268.316] (-269.812) * [-267.170] (-271.201) (-269.284) (-267.783) -- 0:00:11
Average standard deviation of split frequencies: 0.007170
825500 -- (-266.596) (-267.965) [-266.981] (-266.585) * (-268.129) [-268.733] (-269.154) (-269.702) -- 0:00:11
826000 -- (-267.932) (-266.858) [-267.466] (-268.537) * (-269.515) (-268.880) [-268.695] (-267.345) -- 0:00:11
826500 -- [-270.766] (-269.554) (-269.056) (-271.546) * (-270.427) [-269.148] (-267.746) (-271.749) -- 0:00:11
827000 -- (-269.013) (-268.334) (-268.552) [-269.988] * (-265.040) (-268.703) (-272.337) [-269.775] -- 0:00:11
827500 -- (-268.538) (-267.660) [-266.867] (-267.937) * (-270.384) (-268.886) [-266.328] (-271.661) -- 0:00:11
828000 -- (-270.000) (-267.227) [-269.296] (-266.319) * (-267.598) [-268.391] (-272.296) (-270.253) -- 0:00:11
828500 -- (-272.454) (-268.423) (-273.157) [-267.709] * (-267.604) (-269.597) (-269.400) [-267.367] -- 0:00:10
829000 -- [-267.669] (-270.915) (-270.069) (-266.390) * (-267.586) (-268.702) (-269.439) [-265.762] -- 0:00:10
829500 -- (-269.656) (-266.719) [-268.235] (-266.673) * (-269.046) (-268.446) (-269.817) [-267.289] -- 0:00:10
830000 -- (-268.440) (-270.979) (-267.655) [-268.017] * (-268.865) (-268.573) (-269.492) [-266.289] -- 0:00:10
Average standard deviation of split frequencies: 0.007413
830500 -- [-266.888] (-272.550) (-266.565) (-274.770) * (-268.250) (-272.367) [-271.148] (-269.804) -- 0:00:10
831000 -- [-265.329] (-275.599) (-270.620) (-271.566) * (-267.043) [-268.279] (-268.896) (-269.740) -- 0:00:10
831500 -- [-268.042] (-269.981) (-271.294) (-272.239) * (-268.753) [-266.393] (-270.675) (-266.588) -- 0:00:10
832000 -- [-268.024] (-271.118) (-269.687) (-267.210) * (-270.054) (-265.769) [-269.002] (-266.751) -- 0:00:10
832500 -- (-267.166) (-266.685) (-266.203) [-267.009] * (-267.836) [-269.440] (-266.352) (-267.660) -- 0:00:10
833000 -- (-270.405) [-271.283] (-271.513) (-271.351) * (-270.032) (-269.013) (-267.535) [-267.800] -- 0:00:10
833500 -- [-267.064] (-269.460) (-270.852) (-267.654) * (-267.604) [-268.694] (-269.799) (-267.007) -- 0:00:10
834000 -- (-272.619) [-267.945] (-268.255) (-268.587) * (-273.407) (-267.790) (-269.177) [-270.065] -- 0:00:10
834500 -- (-269.673) (-269.536) [-270.951] (-267.866) * (-268.752) (-267.512) [-270.033] (-272.697) -- 0:00:10
835000 -- (-269.957) (-273.715) (-268.971) [-271.053] * (-265.411) [-267.708] (-270.675) (-274.248) -- 0:00:10
Average standard deviation of split frequencies: 0.007154
835500 -- (-270.303) (-267.727) [-269.234] (-272.414) * (-269.378) (-268.556) [-266.857] (-268.196) -- 0:00:10
836000 -- (-270.507) (-267.988) [-267.428] (-269.834) * (-266.221) (-270.610) [-266.103] (-268.645) -- 0:00:10
836500 -- [-269.711] (-268.851) (-267.540) (-267.870) * (-267.767) (-267.091) (-266.139) [-270.315] -- 0:00:10
837000 -- (-270.700) (-268.435) [-270.630] (-267.770) * [-266.802] (-266.915) (-271.658) (-268.590) -- 0:00:10
837500 -- (-266.631) (-267.808) [-268.017] (-275.890) * (-267.190) (-267.802) [-269.400] (-270.327) -- 0:00:10
838000 -- (-269.441) [-266.342] (-267.557) (-274.953) * (-273.918) [-267.587] (-267.804) (-267.768) -- 0:00:10
838500 -- (-267.459) [-267.649] (-270.552) (-269.691) * (-269.093) (-266.285) (-268.283) [-267.614] -- 0:00:10
839000 -- (-271.222) (-266.383) [-268.185] (-268.466) * [-268.086] (-270.823) (-270.300) (-269.433) -- 0:00:10
839500 -- (-269.887) (-269.004) [-267.307] (-268.179) * [-269.780] (-271.343) (-265.923) (-271.392) -- 0:00:10
840000 -- (-269.887) (-270.600) [-266.037] (-270.231) * (-271.512) (-273.112) [-266.308] (-268.554) -- 0:00:10
Average standard deviation of split frequencies: 0.006953
840500 -- (-267.858) (-268.310) (-269.243) [-268.506] * (-271.556) [-266.967] (-269.104) (-266.554) -- 0:00:10
841000 -- (-269.297) (-282.572) [-267.145] (-269.098) * (-266.791) (-268.304) [-268.495] (-266.290) -- 0:00:10
841500 -- [-269.523] (-269.130) (-269.665) (-266.439) * (-267.426) (-266.632) [-269.319] (-272.940) -- 0:00:10
842000 -- (-272.186) (-269.487) (-266.358) [-267.975] * (-275.026) (-267.818) (-268.387) [-266.962] -- 0:00:10
842500 -- (-273.130) (-268.638) [-271.231] (-271.354) * [-270.721] (-268.788) (-268.068) (-270.589) -- 0:00:10
843000 -- (-269.386) (-267.336) (-269.171) [-266.878] * [-269.050] (-269.677) (-269.166) (-269.072) -- 0:00:10
843500 -- (-269.087) [-271.419] (-270.226) (-269.488) * [-268.595] (-269.640) (-267.165) (-272.422) -- 0:00:10
844000 -- (-267.522) [-272.764] (-268.640) (-267.646) * (-267.839) [-271.499] (-269.148) (-270.911) -- 0:00:09
844500 -- (-267.437) (-272.551) [-266.383] (-271.525) * (-266.859) (-268.552) [-266.478] (-267.459) -- 0:00:09
845000 -- (-270.220) [-268.321] (-267.022) (-269.904) * (-268.251) (-268.621) (-268.099) [-269.752] -- 0:00:09
Average standard deviation of split frequencies: 0.006930
845500 -- [-271.257] (-267.120) (-265.153) (-272.045) * [-266.633] (-269.778) (-267.131) (-273.226) -- 0:00:09
846000 -- (-267.279) (-270.240) [-271.086] (-269.604) * [-267.135] (-270.519) (-268.762) (-271.770) -- 0:00:09
846500 -- [-267.064] (-265.774) (-269.859) (-269.079) * [-266.413] (-273.422) (-271.654) (-275.787) -- 0:00:09
847000 -- [-268.082] (-268.446) (-270.244) (-268.955) * (-265.128) (-272.007) [-268.391] (-269.044) -- 0:00:09
847500 -- (-266.101) [-271.040] (-271.175) (-268.190) * (-269.401) (-268.840) [-267.228] (-273.218) -- 0:00:09
848000 -- [-266.220] (-269.446) (-272.058) (-268.256) * (-267.270) (-271.740) (-268.838) [-268.819] -- 0:00:09
848500 -- [-266.789] (-267.312) (-269.054) (-268.173) * (-269.031) (-267.713) (-269.686) [-269.859] -- 0:00:09
849000 -- (-267.074) (-265.194) [-267.905] (-270.283) * (-268.265) (-268.655) (-267.106) [-268.991] -- 0:00:09
849500 -- [-269.155] (-270.467) (-268.739) (-269.724) * (-268.359) (-269.800) (-269.428) [-269.859] -- 0:00:09
850000 -- (-268.926) [-268.732] (-269.859) (-269.208) * (-270.277) [-268.399] (-270.640) (-268.392) -- 0:00:09
Average standard deviation of split frequencies: 0.007056
850500 -- (-269.214) [-267.124] (-267.861) (-268.793) * (-270.136) (-266.707) [-268.018] (-271.110) -- 0:00:09
851000 -- [-273.712] (-271.211) (-268.422) (-267.587) * [-266.102] (-273.058) (-266.905) (-273.884) -- 0:00:09
851500 -- [-267.656] (-272.544) (-269.549) (-267.928) * (-267.319) (-273.220) [-267.764] (-270.043) -- 0:00:09
852000 -- (-267.952) (-270.430) (-267.441) [-268.132] * (-267.731) (-272.173) [-270.142] (-270.804) -- 0:00:09
852500 -- (-269.522) (-270.397) (-265.374) [-267.028] * (-268.267) (-271.221) (-271.784) [-267.576] -- 0:00:09
853000 -- (-268.039) [-267.132] (-267.917) (-267.800) * (-270.947) (-270.888) [-269.445] (-273.556) -- 0:00:09
853500 -- (-270.644) (-267.434) [-267.547] (-268.724) * (-270.265) (-268.372) (-267.673) [-275.566] -- 0:00:09
854000 -- (-270.957) (-268.588) [-271.692] (-268.487) * (-269.519) (-269.139) [-268.838] (-274.484) -- 0:00:09
854500 -- (-272.266) (-268.697) [-271.723] (-268.665) * [-267.355] (-269.797) (-268.615) (-266.950) -- 0:00:09
855000 -- [-267.114] (-268.748) (-266.772) (-272.386) * [-267.179] (-270.242) (-266.528) (-271.940) -- 0:00:09
Average standard deviation of split frequencies: 0.007306
855500 -- [-270.082] (-270.829) (-269.737) (-269.210) * (-266.430) (-270.856) [-266.820] (-268.945) -- 0:00:09
856000 -- (-268.623) (-272.393) (-267.720) [-269.942] * [-267.396] (-269.851) (-269.744) (-268.042) -- 0:00:09
856500 -- (-270.176) [-269.026] (-270.129) (-268.410) * (-273.764) [-265.414] (-269.342) (-276.006) -- 0:00:09
857000 -- [-267.786] (-266.827) (-267.944) (-268.182) * (-272.846) (-267.676) [-271.879] (-272.674) -- 0:00:09
857500 -- [-267.301] (-266.987) (-267.764) (-271.682) * (-272.606) (-268.171) [-267.835] (-268.765) -- 0:00:09
858000 -- (-267.610) (-267.623) [-267.116] (-270.503) * [-268.329] (-268.958) (-271.675) (-269.161) -- 0:00:09
858500 -- (-269.326) [-272.033] (-270.481) (-276.115) * (-269.142) [-267.155] (-271.869) (-268.292) -- 0:00:09
859000 -- [-269.353] (-266.316) (-271.743) (-268.933) * (-268.839) (-271.957) [-268.002] (-269.228) -- 0:00:09
859500 -- (-269.317) [-269.514] (-266.789) (-266.501) * (-268.919) (-271.116) (-270.820) [-268.143] -- 0:00:08
860000 -- [-268.285] (-270.320) (-267.940) (-268.131) * [-266.548] (-267.865) (-270.197) (-268.721) -- 0:00:08
Average standard deviation of split frequencies: 0.007486
860500 -- (-267.147) (-268.705) [-272.020] (-269.569) * (-273.958) (-268.919) [-269.499] (-271.716) -- 0:00:08
861000 -- (-268.649) (-269.593) (-266.454) [-269.115] * [-267.865] (-267.646) (-274.962) (-269.061) -- 0:00:08
861500 -- (-271.670) (-267.144) (-269.134) [-269.292] * (-267.951) [-267.344] (-272.093) (-268.652) -- 0:00:08
862000 -- (-270.708) [-270.603] (-268.850) (-267.911) * (-268.849) (-272.206) [-273.432] (-269.837) -- 0:00:08
862500 -- (-270.615) (-268.433) [-267.610] (-268.659) * [-265.447] (-266.921) (-272.631) (-268.242) -- 0:00:08
863000 -- (-268.881) (-266.590) [-268.868] (-266.819) * (-267.833) [-268.578] (-269.897) (-266.876) -- 0:00:08
863500 -- (-267.241) (-270.100) (-269.742) [-268.857] * (-270.772) [-269.168] (-274.186) (-270.175) -- 0:00:08
864000 -- (-268.684) (-271.108) [-268.570] (-268.593) * (-271.040) (-266.282) [-267.357] (-270.185) -- 0:00:08
864500 -- [-267.940] (-267.817) (-266.655) (-271.507) * (-270.957) (-268.052) (-268.004) [-272.773] -- 0:00:08
865000 -- (-268.751) (-274.308) [-265.646] (-269.479) * [-265.223] (-267.042) (-268.166) (-270.253) -- 0:00:08
Average standard deviation of split frequencies: 0.007621
865500 -- (-269.327) (-267.926) [-268.375] (-267.311) * (-269.260) [-267.429] (-270.649) (-269.096) -- 0:00:08
866000 -- [-266.425] (-266.508) (-269.223) (-266.140) * (-268.216) (-268.755) [-266.639] (-272.380) -- 0:00:08
866500 -- (-268.106) (-266.662) (-272.277) [-270.099] * [-268.324] (-268.952) (-269.423) (-269.471) -- 0:00:08
867000 -- (-267.490) (-270.008) [-271.093] (-268.522) * (-271.476) [-268.333] (-274.019) (-270.336) -- 0:00:08
867500 -- [-268.572] (-265.993) (-267.805) (-266.392) * [-268.415] (-271.543) (-269.902) (-265.974) -- 0:00:08
868000 -- (-268.142) (-267.654) (-266.948) [-269.753] * (-267.239) [-271.225] (-270.420) (-271.158) -- 0:00:08
868500 -- [-266.977] (-265.883) (-268.434) (-269.445) * [-267.700] (-268.464) (-268.070) (-267.481) -- 0:00:08
869000 -- (-272.771) (-270.131) (-268.099) [-268.130] * (-269.589) (-269.622) (-268.542) [-270.748] -- 0:00:08
869500 -- (-267.665) (-269.074) [-268.054] (-267.575) * (-274.417) [-268.313] (-271.428) (-271.420) -- 0:00:08
870000 -- (-271.905) [-269.883] (-267.765) (-272.907) * (-269.214) (-266.525) (-270.204) [-268.859] -- 0:00:08
Average standard deviation of split frequencies: 0.007580
870500 -- [-269.355] (-269.577) (-270.957) (-267.804) * (-274.237) (-268.350) [-268.226] (-268.868) -- 0:00:08
871000 -- [-270.469] (-271.324) (-268.438) (-270.228) * [-268.622] (-267.061) (-269.616) (-271.936) -- 0:00:08
871500 -- [-267.049] (-267.371) (-268.256) (-270.245) * (-269.528) (-269.786) (-269.243) [-270.209] -- 0:00:08
872000 -- (-271.938) (-270.702) (-267.255) [-268.723] * [-268.571] (-266.750) (-272.523) (-266.119) -- 0:00:08
872500 -- [-267.556] (-268.502) (-268.249) (-269.104) * (-267.042) (-269.612) (-271.614) [-273.062] -- 0:00:08
873000 -- [-268.322] (-267.981) (-268.773) (-272.145) * (-267.936) (-270.895) (-266.439) [-267.722] -- 0:00:08
873500 -- (-267.579) (-269.977) [-266.356] (-272.765) * (-269.467) (-268.045) [-272.196] (-269.297) -- 0:00:08
874000 -- (-268.315) [-269.130] (-271.552) (-271.283) * (-268.570) [-267.560] (-268.839) (-267.489) -- 0:00:08
874500 -- [-267.024] (-271.455) (-267.247) (-268.252) * (-269.446) (-271.894) [-269.062] (-267.946) -- 0:00:08
875000 -- [-267.452] (-268.479) (-268.263) (-267.499) * (-270.929) [-267.166] (-271.454) (-270.597) -- 0:00:08
Average standard deviation of split frequencies: 0.007390
875500 -- (-267.322) (-271.810) (-266.155) [-268.454] * (-266.931) (-268.882) [-267.618] (-267.610) -- 0:00:07
876000 -- (-266.641) (-270.271) [-266.856] (-268.670) * [-266.913] (-267.423) (-269.524) (-270.235) -- 0:00:07
876500 -- (-267.763) (-269.477) [-266.785] (-269.496) * (-267.861) (-272.457) (-276.636) [-268.841] -- 0:00:07
877000 -- (-269.620) [-269.678] (-266.556) (-269.230) * [-265.881] (-271.887) (-269.419) (-268.924) -- 0:00:07
877500 -- (-269.030) (-268.664) [-265.901] (-272.818) * [-268.137] (-271.761) (-270.043) (-268.514) -- 0:00:07
878000 -- (-269.766) (-267.805) (-267.804) [-270.085] * (-267.185) (-267.619) [-270.811] (-267.467) -- 0:00:07
878500 -- (-268.576) [-269.766] (-267.969) (-267.283) * [-266.017] (-270.028) (-270.647) (-266.957) -- 0:00:07
879000 -- [-267.009] (-268.607) (-269.544) (-267.305) * (-266.826) (-270.522) [-268.011] (-274.864) -- 0:00:07
879500 -- (-275.738) (-266.798) [-270.382] (-269.702) * [-267.231] (-269.097) (-271.102) (-271.047) -- 0:00:07
880000 -- [-269.530] (-271.172) (-271.015) (-267.589) * (-267.588) [-268.307] (-273.473) (-268.419) -- 0:00:07
Average standard deviation of split frequencies: 0.007173
880500 -- (-268.017) (-271.299) (-268.082) [-268.208] * [-265.176] (-272.066) (-268.830) (-267.197) -- 0:00:07
881000 -- (-266.554) (-266.354) (-266.099) [-268.842] * (-269.301) [-267.328] (-274.401) (-270.244) -- 0:00:07
881500 -- (-267.971) (-269.838) (-270.540) [-269.174] * (-273.458) (-269.480) [-271.636] (-268.157) -- 0:00:07
882000 -- (-268.857) [-267.755] (-271.603) (-266.472) * (-269.284) (-269.797) (-267.679) [-269.187] -- 0:00:07
882500 -- (-266.701) [-266.459] (-269.160) (-268.767) * [-272.829] (-273.642) (-269.193) (-268.657) -- 0:00:07
883000 -- [-266.272] (-267.395) (-266.261) (-267.258) * (-268.743) [-270.218] (-271.471) (-267.353) -- 0:00:07
883500 -- (-268.483) (-265.909) [-268.541] (-267.886) * (-268.701) (-268.206) [-270.333] (-266.733) -- 0:00:07
884000 -- (-268.501) (-268.548) (-267.685) [-267.002] * (-266.905) [-270.397] (-275.226) (-272.953) -- 0:00:07
884500 -- (-269.368) (-270.167) [-266.134] (-267.117) * [-268.530] (-268.761) (-266.962) (-267.589) -- 0:00:07
885000 -- (-267.417) [-271.183] (-266.117) (-268.903) * (-270.155) (-268.388) [-276.952] (-269.196) -- 0:00:07
Average standard deviation of split frequencies: 0.007482
885500 -- (-267.601) [-267.665] (-267.519) (-269.768) * (-269.304) [-270.625] (-271.448) (-268.985) -- 0:00:07
886000 -- (-268.490) (-273.673) [-270.610] (-270.932) * [-271.565] (-267.707) (-270.073) (-271.765) -- 0:00:07
886500 -- [-266.845] (-274.402) (-267.204) (-266.249) * (-270.070) [-269.196] (-267.712) (-271.016) -- 0:00:07
887000 -- (-268.254) (-272.077) [-267.654] (-265.949) * (-273.545) [-271.435] (-268.673) (-271.379) -- 0:00:07
887500 -- (-267.944) (-268.664) (-266.629) [-270.401] * [-268.183] (-269.901) (-274.631) (-269.419) -- 0:00:07
888000 -- [-270.770] (-271.784) (-266.018) (-267.220) * (-268.650) (-271.520) [-270.920] (-269.431) -- 0:00:07
888500 -- (-268.063) (-269.344) [-268.118] (-266.898) * [-267.020] (-266.305) (-266.193) (-269.908) -- 0:00:07
889000 -- (-270.334) (-268.010) (-266.491) [-266.517] * (-266.036) (-268.923) (-268.606) [-265.400] -- 0:00:07
889500 -- (-273.058) [-267.064] (-267.403) (-267.128) * (-268.556) (-267.490) [-268.800] (-272.351) -- 0:00:07
890000 -- (-267.926) (-271.278) [-270.642] (-267.248) * (-268.121) (-267.355) [-271.215] (-267.725) -- 0:00:07
Average standard deviation of split frequencies: 0.007244
890500 -- [-267.487] (-275.856) (-270.812) (-269.228) * (-268.303) (-267.978) (-267.469) [-266.950] -- 0:00:07
891000 -- (-266.750) [-269.595] (-269.189) (-269.753) * (-268.527) (-270.221) [-267.855] (-267.124) -- 0:00:06
891500 -- (-266.501) (-266.240) (-267.050) [-269.107] * (-266.985) [-268.566] (-271.405) (-266.248) -- 0:00:06
892000 -- (-268.700) (-269.790) [-269.737] (-272.092) * [-267.398] (-269.668) (-267.019) (-267.770) -- 0:00:06
892500 -- (-267.324) [-268.053] (-269.129) (-268.419) * (-270.219) (-269.506) (-270.057) [-266.172] -- 0:00:06
893000 -- (-266.681) (-269.570) (-268.850) [-267.253] * (-267.480) (-268.096) [-267.636] (-266.615) -- 0:00:06
893500 -- (-269.271) (-268.281) (-269.050) [-270.143] * (-266.443) (-265.919) [-267.727] (-270.378) -- 0:00:06
894000 -- (-269.504) (-269.484) (-271.044) [-271.156] * (-266.085) [-269.596] (-270.211) (-269.343) -- 0:00:06
894500 -- (-271.884) (-268.704) [-269.051] (-267.639) * (-266.917) [-268.959] (-272.440) (-267.328) -- 0:00:06
895000 -- [-268.899] (-269.246) (-267.381) (-268.041) * (-266.395) (-268.894) (-270.677) [-267.622] -- 0:00:06
Average standard deviation of split frequencies: 0.007366
895500 -- (-269.173) (-269.156) (-267.646) [-269.344] * [-268.983] (-267.943) (-268.596) (-267.602) -- 0:00:06
896000 -- (-270.247) (-267.332) (-271.456) [-268.128] * [-268.864] (-268.454) (-269.342) (-271.334) -- 0:00:06
896500 -- (-269.091) (-271.335) [-266.964] (-270.145) * (-268.488) (-270.152) [-269.009] (-272.275) -- 0:00:06
897000 -- [-268.907] (-268.582) (-268.707) (-269.992) * (-268.940) (-269.115) (-267.785) [-269.638] -- 0:00:06
897500 -- (-269.976) [-268.375] (-267.719) (-275.951) * (-266.922) (-267.528) [-268.264] (-268.033) -- 0:00:06
898000 -- (-269.438) (-269.665) [-271.707] (-271.488) * (-266.530) [-267.131] (-269.165) (-269.189) -- 0:00:06
898500 -- (-277.308) [-267.942] (-267.551) (-269.909) * [-267.972] (-267.810) (-268.799) (-268.131) -- 0:00:06
899000 -- [-268.036] (-267.570) (-267.819) (-270.798) * (-269.917) [-271.224] (-274.356) (-268.491) -- 0:00:06
899500 -- (-268.830) [-269.977] (-270.454) (-271.751) * (-268.208) (-269.167) (-270.343) [-268.751] -- 0:00:06
900000 -- (-275.861) (-268.345) (-268.846) [-268.682] * (-267.682) (-269.488) (-270.892) [-270.503] -- 0:00:06
Average standard deviation of split frequencies: 0.007720
900500 -- (-269.024) [-268.577] (-269.361) (-269.770) * (-267.152) [-272.995] (-268.543) (-268.396) -- 0:00:06
901000 -- (-268.900) (-268.796) [-269.855] (-270.269) * [-268.130] (-269.546) (-268.170) (-270.903) -- 0:00:06
901500 -- [-268.393] (-268.089) (-270.618) (-272.185) * (-267.393) [-269.038] (-266.977) (-271.488) -- 0:00:06
902000 -- (-274.232) [-268.368] (-270.459) (-269.394) * (-269.093) (-268.058) (-269.531) [-271.394] -- 0:00:06
902500 -- (-273.363) [-268.614] (-277.905) (-265.755) * (-269.366) [-267.808] (-269.238) (-271.721) -- 0:00:06
903000 -- (-267.038) [-270.264] (-267.158) (-266.986) * (-270.759) (-266.740) (-268.176) [-269.037] -- 0:00:06
903500 -- (-270.701) (-266.045) (-270.822) [-265.525] * [-268.171] (-267.630) (-270.682) (-269.787) -- 0:00:06
904000 -- (-270.092) [-268.833] (-269.104) (-267.736) * (-268.385) [-267.512] (-271.318) (-270.678) -- 0:00:06
904500 -- (-268.120) (-267.704) [-268.568] (-266.892) * [-266.806] (-272.273) (-270.334) (-269.195) -- 0:00:06
905000 -- (-266.978) [-275.919] (-266.442) (-267.193) * (-269.456) [-270.935] (-269.576) (-273.884) -- 0:00:06
Average standard deviation of split frequencies: 0.007317
905500 -- [-266.093] (-273.534) (-266.238) (-266.421) * (-269.503) (-272.256) [-271.174] (-267.972) -- 0:00:06
906000 -- [-267.379] (-269.823) (-266.876) (-269.398) * (-267.540) (-270.703) [-268.381] (-279.195) -- 0:00:06
906500 -- (-267.813) (-272.281) (-267.033) [-271.218] * [-268.977] (-267.328) (-269.531) (-272.925) -- 0:00:05
907000 -- (-268.413) (-271.418) (-269.729) [-268.540] * (-269.510) [-266.025] (-269.679) (-273.293) -- 0:00:05
907500 -- (-271.282) (-273.029) (-267.821) [-266.252] * [-269.314] (-266.600) (-266.721) (-273.243) -- 0:00:05
908000 -- (-268.644) (-268.517) (-266.731) [-268.906] * (-268.845) (-267.766) [-270.706] (-273.208) -- 0:00:05
908500 -- [-267.983] (-270.839) (-270.421) (-267.281) * [-269.287] (-271.094) (-269.444) (-271.919) -- 0:00:05
909000 -- (-269.231) (-270.140) (-274.164) [-268.488] * (-269.889) [-268.691] (-266.611) (-268.947) -- 0:00:05
909500 -- (-269.761) (-267.087) [-270.170] (-268.822) * (-269.388) [-267.461] (-267.465) (-271.007) -- 0:00:05
910000 -- (-271.990) [-268.767] (-270.057) (-268.992) * (-268.929) (-269.513) [-272.555] (-268.040) -- 0:00:05
Average standard deviation of split frequencies: 0.006891
910500 -- (-271.263) (-267.996) [-268.383] (-266.288) * (-271.045) (-267.760) (-270.048) [-268.143] -- 0:00:05
911000 -- (-271.708) [-267.796] (-268.927) (-266.846) * (-267.439) (-268.255) [-268.387] (-267.515) -- 0:00:05
911500 -- (-275.119) (-271.440) [-267.240] (-270.318) * (-268.836) [-271.015] (-268.850) (-266.130) -- 0:00:05
912000 -- (-271.504) (-269.792) [-267.949] (-270.692) * (-269.188) (-276.261) [-266.081] (-267.551) -- 0:00:05
912500 -- (-269.489) (-268.669) [-267.701] (-266.335) * [-267.242] (-274.647) (-272.099) (-266.222) -- 0:00:05
913000 -- (-271.404) (-270.027) (-270.891) [-267.177] * (-269.997) [-266.469] (-266.953) (-268.942) -- 0:00:05
913500 -- [-268.945] (-267.917) (-269.030) (-267.010) * (-267.197) [-267.801] (-269.236) (-269.324) -- 0:00:05
914000 -- (-277.135) (-268.119) [-267.601] (-268.117) * (-268.430) (-267.929) [-267.320] (-270.845) -- 0:00:05
914500 -- (-267.472) (-267.165) [-266.845] (-267.072) * (-267.296) (-271.605) [-270.274] (-267.403) -- 0:00:05
915000 -- (-272.068) (-272.147) (-267.117) [-271.054] * (-270.379) [-271.254] (-268.184) (-267.151) -- 0:00:05
Average standard deviation of split frequencies: 0.007076
915500 -- (-270.651) [-267.621] (-267.231) (-272.642) * (-274.208) (-273.835) [-268.349] (-270.012) -- 0:00:05
916000 -- (-270.211) [-267.640] (-267.615) (-273.749) * (-271.449) (-268.026) (-273.351) [-267.529] -- 0:00:05
916500 -- (-269.738) (-268.672) (-269.131) [-271.055] * (-266.525) (-266.281) (-274.133) [-269.180] -- 0:00:05
917000 -- (-272.860) (-269.750) (-270.066) [-270.541] * [-269.565] (-270.857) (-269.204) (-268.662) -- 0:00:05
917500 -- (-269.049) (-272.567) (-269.061) [-268.203] * (-267.772) (-266.708) (-268.042) [-273.287] -- 0:00:05
918000 -- (-269.017) [-269.149] (-271.644) (-270.064) * (-265.783) [-269.407] (-269.553) (-267.106) -- 0:00:05
918500 -- (-270.514) (-268.690) [-266.421] (-268.534) * (-268.969) [-268.957] (-269.944) (-269.524) -- 0:00:05
919000 -- (-270.644) [-268.550] (-267.885) (-267.992) * (-273.626) [-270.266] (-269.580) (-269.960) -- 0:00:05
919500 -- (-270.991) (-265.882) (-266.536) [-266.836] * [-268.881] (-268.547) (-274.602) (-265.323) -- 0:00:05
920000 -- (-269.203) (-268.500) [-266.074] (-272.051) * (-270.953) [-267.789] (-270.896) (-267.587) -- 0:00:05
Average standard deviation of split frequencies: 0.006976
920500 -- (-267.407) [-268.375] (-269.744) (-269.109) * (-267.056) (-272.023) (-267.252) [-266.366] -- 0:00:05
921000 -- [-270.111] (-269.786) (-269.389) (-269.081) * (-270.674) [-272.178] (-267.390) (-268.802) -- 0:00:05
921500 -- [-267.513] (-268.338) (-267.593) (-268.567) * (-271.141) (-273.009) (-268.133) [-270.221] -- 0:00:05
922000 -- [-267.456] (-272.798) (-266.973) (-268.157) * (-267.807) (-272.489) (-271.057) [-269.078] -- 0:00:04
922500 -- [-265.883] (-269.411) (-268.196) (-267.416) * (-273.268) (-268.108) (-267.420) [-269.054] -- 0:00:04
923000 -- [-270.565] (-269.115) (-267.754) (-272.300) * (-269.757) [-268.406] (-266.797) (-266.509) -- 0:00:04
923500 -- (-267.500) (-269.386) [-267.139] (-266.869) * [-269.972] (-272.067) (-267.567) (-267.525) -- 0:00:04
924000 -- (-267.728) (-269.995) (-273.777) [-268.627] * (-268.145) [-267.106] (-267.657) (-270.684) -- 0:00:04
924500 -- (-272.159) (-266.922) (-273.018) [-267.865] * (-271.258) (-269.770) [-272.195] (-267.359) -- 0:00:04
925000 -- (-268.643) [-266.264] (-272.770) (-269.357) * (-267.988) [-270.319] (-269.587) (-268.212) -- 0:00:04
Average standard deviation of split frequencies: 0.006809
925500 -- (-267.484) (-269.708) (-267.402) [-267.810] * (-268.735) (-268.910) (-269.409) [-268.335] -- 0:00:04
926000 -- (-268.767) (-267.933) [-267.161] (-272.000) * (-268.690) (-269.826) [-270.654] (-269.568) -- 0:00:04
926500 -- (-270.419) (-269.888) [-266.716] (-270.421) * (-268.454) (-269.953) [-269.674] (-271.596) -- 0:00:04
927000 -- (-265.952) [-267.099] (-266.873) (-268.459) * (-270.032) (-271.534) [-265.841] (-270.382) -- 0:00:04
927500 -- (-266.509) (-268.114) [-265.445] (-267.807) * (-269.437) [-268.964] (-267.193) (-267.248) -- 0:00:04
928000 -- (-267.061) (-273.194) (-266.647) [-266.763] * (-269.351) (-269.420) [-269.015] (-270.083) -- 0:00:04
928500 -- (-275.452) (-269.557) (-270.091) [-270.158] * (-273.363) [-267.310] (-271.441) (-267.129) -- 0:00:04
929000 -- [-266.309] (-272.457) (-269.854) (-270.187) * (-274.440) (-269.329) [-269.910] (-266.600) -- 0:00:04
929500 -- (-267.819) (-272.724) [-267.340] (-270.271) * (-269.068) [-265.671] (-272.888) (-269.790) -- 0:00:04
930000 -- (-267.777) [-269.008] (-274.927) (-273.141) * [-268.472] (-269.588) (-269.751) (-269.110) -- 0:00:04
Average standard deviation of split frequencies: 0.006680
930500 -- [-267.118] (-268.186) (-269.484) (-269.025) * (-268.611) (-268.626) [-265.913] (-271.760) -- 0:00:04
931000 -- (-268.855) (-267.771) (-269.593) [-270.667] * (-270.163) [-268.485] (-269.778) (-267.947) -- 0:00:04
931500 -- [-268.243] (-267.102) (-269.375) (-268.073) * [-266.514] (-270.540) (-269.241) (-268.940) -- 0:00:04
932000 -- (-267.301) (-270.143) (-270.814) [-270.636] * (-268.882) [-269.220] (-271.891) (-268.720) -- 0:00:04
932500 -- [-270.303] (-269.170) (-272.708) (-265.377) * (-269.273) [-269.299] (-271.949) (-268.322) -- 0:00:04
933000 -- [-269.892] (-269.104) (-268.805) (-268.566) * (-267.371) (-269.401) (-269.329) [-272.804] -- 0:00:04
933500 -- (-269.475) (-268.130) (-268.592) [-266.988] * [-265.729] (-267.235) (-268.657) (-273.131) -- 0:00:04
934000 -- [-268.519] (-269.933) (-267.577) (-268.676) * (-271.963) [-268.967] (-270.465) (-270.320) -- 0:00:04
934500 -- (-269.736) [-268.940] (-270.318) (-265.832) * [-270.443] (-269.747) (-270.859) (-270.499) -- 0:00:04
935000 -- [-269.536] (-273.140) (-272.025) (-268.261) * [-271.268] (-268.113) (-268.156) (-276.196) -- 0:00:04
Average standard deviation of split frequencies: 0.006925
935500 -- (-269.128) [-270.577] (-271.117) (-267.842) * [-266.400] (-268.112) (-267.874) (-269.654) -- 0:00:04
936000 -- (-268.666) (-271.628) [-268.662] (-268.376) * (-267.034) (-269.930) (-268.780) [-268.607] -- 0:00:04
936500 -- (-268.175) (-269.408) [-268.483] (-267.021) * [-268.036] (-268.623) (-269.050) (-274.292) -- 0:00:04
937000 -- [-272.319] (-268.145) (-269.338) (-269.762) * (-268.179) [-268.895] (-269.350) (-269.455) -- 0:00:04
937500 -- (-270.743) (-267.239) (-267.680) [-266.177] * [-267.301] (-267.537) (-273.831) (-267.007) -- 0:00:04
938000 -- (-270.488) [-267.069] (-267.896) (-270.295) * [-267.982] (-266.490) (-273.532) (-268.216) -- 0:00:03
938500 -- (-270.730) [-272.208] (-267.845) (-270.784) * (-266.750) [-270.533] (-275.157) (-269.808) -- 0:00:03
939000 -- (-269.194) [-268.878] (-267.785) (-268.979) * (-269.462) [-267.065] (-269.202) (-268.915) -- 0:00:03
939500 -- (-269.697) [-266.020] (-273.102) (-267.350) * (-268.824) (-265.770) (-270.572) [-267.951] -- 0:00:03
940000 -- (-269.328) (-270.566) [-268.403] (-267.745) * (-270.211) (-266.277) (-268.963) [-268.331] -- 0:00:03
Average standard deviation of split frequencies: 0.006765
940500 -- (-267.872) [-272.745] (-268.954) (-268.465) * (-269.513) [-267.217] (-268.656) (-267.856) -- 0:00:03
941000 -- (-269.873) [-270.065] (-268.941) (-268.680) * (-268.611) [-271.964] (-267.017) (-269.042) -- 0:00:03
941500 -- (-266.597) (-270.456) [-268.313] (-275.419) * [-268.000] (-267.386) (-274.554) (-270.183) -- 0:00:03
942000 -- (-268.249) [-267.788] (-272.489) (-271.591) * [-267.396] (-267.390) (-269.921) (-269.881) -- 0:00:03
942500 -- (-277.198) (-266.211) [-269.628] (-270.576) * (-268.218) (-268.737) (-272.798) [-268.144] -- 0:00:03
943000 -- (-268.774) [-265.804] (-267.974) (-269.878) * (-271.008) (-266.360) [-267.624] (-270.787) -- 0:00:03
943500 -- (-268.282) [-267.369] (-268.929) (-269.434) * (-271.057) (-266.660) [-266.816] (-272.895) -- 0:00:03
944000 -- (-270.175) [-266.918] (-270.783) (-268.276) * (-269.012) [-266.764] (-266.417) (-270.969) -- 0:00:03
944500 -- (-268.626) (-268.318) (-270.823) [-268.206] * (-268.532) (-267.598) (-272.284) [-267.930] -- 0:00:03
945000 -- (-268.178) (-271.240) [-270.497] (-274.333) * [-268.304] (-270.114) (-266.843) (-270.355) -- 0:00:03
Average standard deviation of split frequencies: 0.007163
945500 -- (-268.213) [-270.923] (-272.555) (-268.479) * (-267.541) (-269.083) (-266.073) [-267.693] -- 0:00:03
946000 -- (-269.103) (-267.147) [-266.527] (-268.418) * [-265.675] (-267.937) (-269.307) (-269.859) -- 0:00:03
946500 -- [-269.375] (-269.390) (-266.404) (-270.364) * (-270.385) (-269.796) (-267.604) [-269.699] -- 0:00:03
947000 -- (-268.508) [-269.099] (-270.341) (-267.836) * (-266.338) (-273.590) (-267.335) [-269.692] -- 0:00:03
947500 -- (-269.914) (-267.240) [-270.004] (-268.659) * (-267.479) (-269.466) (-271.168) [-268.931] -- 0:00:03
948000 -- (-270.966) [-265.730] (-272.825) (-270.524) * [-267.807] (-271.432) (-271.272) (-267.852) -- 0:00:03
948500 -- (-270.255) (-270.939) (-268.943) [-272.100] * [-269.411] (-269.138) (-267.493) (-270.298) -- 0:00:03
949000 -- [-270.145] (-271.644) (-268.199) (-271.910) * (-268.455) (-269.442) (-269.945) [-266.996] -- 0:00:03
949500 -- (-269.399) (-271.105) [-267.514] (-270.577) * (-268.903) (-270.081) [-268.582] (-267.394) -- 0:00:03
950000 -- (-266.898) (-266.967) [-267.507] (-268.267) * (-267.053) [-268.847] (-269.445) (-265.689) -- 0:00:03
Average standard deviation of split frequencies: 0.007041
950500 -- (-273.751) (-269.068) [-266.016] (-267.428) * (-268.616) (-266.959) [-270.598] (-268.724) -- 0:00:03
951000 -- [-269.398] (-266.468) (-267.637) (-268.060) * (-268.751) (-268.457) (-269.777) [-268.871] -- 0:00:03
951500 -- (-269.741) (-269.189) (-268.535) [-268.955] * (-266.590) [-269.830] (-270.981) (-269.282) -- 0:00:03
952000 -- [-272.216] (-270.680) (-268.604) (-268.497) * (-271.289) (-269.074) (-268.900) [-265.676] -- 0:00:03
952500 -- [-268.180] (-270.053) (-272.411) (-272.337) * (-269.527) (-272.347) (-269.043) [-266.812] -- 0:00:03
953000 -- (-270.543) [-269.544] (-267.470) (-270.542) * (-269.563) (-269.558) (-266.893) [-268.987] -- 0:00:03
953500 -- [-271.427] (-267.161) (-271.715) (-269.794) * (-272.013) (-268.751) [-269.363] (-266.318) -- 0:00:02
954000 -- [-268.682] (-271.678) (-267.483) (-265.849) * (-267.341) [-268.211] (-269.954) (-268.757) -- 0:00:02
954500 -- (-268.964) [-271.079] (-269.945) (-268.829) * (-268.542) (-268.516) [-269.541] (-269.402) -- 0:00:02
955000 -- (-271.381) [-268.776] (-271.211) (-268.252) * (-267.913) (-267.662) (-270.560) [-267.466] -- 0:00:02
Average standard deviation of split frequencies: 0.007232
955500 -- (-268.757) [-269.825] (-267.953) (-269.528) * [-269.978] (-269.612) (-269.798) (-271.232) -- 0:00:02
956000 -- (-271.791) [-267.757] (-270.331) (-265.994) * (-269.498) (-268.706) (-266.394) [-266.300] -- 0:00:02
956500 -- (-269.985) (-274.517) [-271.830] (-266.817) * [-269.213] (-270.508) (-271.524) (-265.827) -- 0:00:02
957000 -- (-272.630) [-268.547] (-271.859) (-269.710) * [-266.387] (-270.089) (-271.401) (-269.084) -- 0:00:02
957500 -- (-269.536) (-269.613) [-267.241] (-266.188) * [-268.107] (-269.826) (-271.070) (-268.867) -- 0:00:02
958000 -- (-268.790) (-269.977) [-268.190] (-271.853) * (-275.406) (-267.746) (-271.169) [-267.882] -- 0:00:02
958500 -- (-269.621) [-269.249] (-267.617) (-268.822) * (-276.488) (-269.060) [-270.846] (-267.009) -- 0:00:02
959000 -- (-270.063) (-267.447) (-270.248) [-267.408] * (-268.858) (-268.151) [-269.211] (-267.832) -- 0:00:02
959500 -- (-267.955) (-268.555) (-270.800) [-268.038] * (-273.435) (-268.984) [-271.978] (-270.465) -- 0:00:02
960000 -- (-268.514) [-267.581] (-270.111) (-274.469) * [-267.839] (-269.185) (-269.628) (-275.614) -- 0:00:02
Average standard deviation of split frequencies: 0.007099
960500 -- (-273.850) (-267.632) (-268.347) [-267.236] * (-267.855) (-267.535) (-268.854) [-268.310] -- 0:00:02
961000 -- (-270.864) (-274.058) (-270.153) [-269.357] * [-269.589] (-276.835) (-266.904) (-273.111) -- 0:00:02
961500 -- (-267.323) [-268.688] (-273.623) (-270.400) * [-267.282] (-266.629) (-269.040) (-273.686) -- 0:00:02
962000 -- (-267.898) (-267.965) [-267.966] (-267.586) * (-269.518) [-267.066] (-268.760) (-271.793) -- 0:00:02
962500 -- (-267.444) [-269.718] (-270.431) (-268.350) * [-266.965] (-270.169) (-270.653) (-270.214) -- 0:00:02
963000 -- [-266.828] (-267.020) (-267.661) (-272.739) * (-267.455) (-266.887) (-271.015) [-268.555] -- 0:00:02
963500 -- (-268.409) [-266.608] (-270.496) (-268.491) * (-267.879) (-268.137) [-268.242] (-269.472) -- 0:00:02
964000 -- (-270.647) [-268.725] (-268.446) (-268.047) * (-271.880) (-268.171) (-271.939) [-267.616] -- 0:00:02
964500 -- (-275.886) [-266.508] (-268.007) (-269.904) * (-268.945) [-267.019] (-269.102) (-267.803) -- 0:00:02
965000 -- (-272.150) [-272.613] (-269.933) (-268.663) * [-266.216] (-269.132) (-270.431) (-269.275) -- 0:00:02
Average standard deviation of split frequencies: 0.007320
965500 -- (-268.518) (-267.360) (-270.346) [-268.936] * (-265.964) [-270.184] (-274.205) (-267.719) -- 0:00:02
966000 -- [-268.590] (-270.170) (-271.029) (-268.491) * [-265.503] (-272.414) (-268.781) (-268.183) -- 0:00:02
966500 -- (-268.314) (-271.892) [-269.125] (-267.890) * (-268.428) (-273.170) (-270.909) [-267.423] -- 0:00:02
967000 -- (-270.730) [-268.008] (-268.943) (-272.118) * (-270.330) (-267.927) (-273.171) [-267.696] -- 0:00:02
967500 -- (-270.267) (-267.143) [-267.568] (-272.769) * (-268.749) (-267.156) [-267.831] (-267.344) -- 0:00:02
968000 -- (-270.101) [-269.017] (-267.581) (-272.755) * (-274.948) (-269.083) (-268.545) [-269.599] -- 0:00:02
968500 -- (-266.918) (-267.732) (-268.505) [-269.745] * (-270.084) [-267.912] (-269.585) (-267.467) -- 0:00:02
969000 -- (-267.146) [-268.641] (-268.624) (-268.823) * (-273.592) (-267.816) [-267.956] (-269.072) -- 0:00:01
969500 -- (-271.514) (-267.649) [-268.396] (-271.437) * (-271.128) [-267.783] (-268.405) (-270.664) -- 0:00:01
970000 -- (-269.699) [-267.494] (-267.765) (-268.628) * (-266.708) [-267.833] (-267.828) (-270.339) -- 0:00:01
Average standard deviation of split frequencies: 0.007194
970500 -- [-267.809] (-268.702) (-272.647) (-269.634) * [-268.688] (-269.424) (-268.312) (-270.484) -- 0:00:01
971000 -- (-270.528) [-268.415] (-272.167) (-270.976) * (-270.786) [-268.025] (-267.881) (-268.613) -- 0:00:01
971500 -- (-269.518) [-267.128] (-268.525) (-270.655) * (-269.248) [-269.797] (-268.327) (-268.492) -- 0:00:01
972000 -- (-268.402) (-269.165) [-269.237] (-268.554) * (-271.251) (-271.351) [-267.404] (-270.580) -- 0:00:01
972500 -- [-266.764] (-267.116) (-271.356) (-269.567) * (-268.284) (-268.962) (-270.456) [-269.407] -- 0:00:01
973000 -- (-267.671) (-269.394) [-267.166] (-271.309) * [-267.749] (-267.055) (-267.661) (-271.127) -- 0:00:01
973500 -- (-267.356) (-267.123) [-268.539] (-267.708) * [-268.425] (-267.130) (-270.212) (-271.746) -- 0:00:01
974000 -- [-268.936] (-268.901) (-267.345) (-269.882) * (-268.679) [-268.792] (-270.896) (-267.772) -- 0:00:01
974500 -- (-272.160) (-266.611) [-268.177] (-270.091) * (-268.173) (-266.750) (-270.903) [-268.833] -- 0:00:01
975000 -- [-270.071] (-268.825) (-268.034) (-268.650) * (-266.721) (-272.742) (-270.251) [-267.129] -- 0:00:01
Average standard deviation of split frequencies: 0.007426
975500 -- (-272.289) [-272.516] (-268.501) (-273.041) * (-266.762) [-267.160] (-269.351) (-269.282) -- 0:00:01
976000 -- (-274.089) (-270.798) (-268.325) [-269.009] * (-271.027) (-266.641) (-273.151) [-269.528] -- 0:00:01
976500 -- (-272.107) [-270.054] (-269.570) (-272.349) * [-269.569] (-270.117) (-270.650) (-269.213) -- 0:00:01
977000 -- (-270.543) (-268.407) (-266.959) [-269.806] * (-273.537) (-267.493) [-270.168] (-270.761) -- 0:00:01
977500 -- (-267.830) [-269.641] (-268.255) (-269.007) * (-271.764) (-269.781) (-269.060) [-270.324] -- 0:00:01
978000 -- [-269.938] (-268.794) (-268.578) (-271.458) * (-269.045) (-266.457) [-268.258] (-269.566) -- 0:00:01
978500 -- (-266.495) [-268.017] (-268.876) (-267.518) * (-267.128) (-266.008) (-267.548) [-272.235] -- 0:00:01
979000 -- (-267.695) (-267.001) [-266.469] (-269.215) * (-267.126) [-268.941] (-266.225) (-267.820) -- 0:00:01
979500 -- (-272.554) (-266.073) (-268.508) [-268.793] * (-268.987) (-268.101) (-268.314) [-268.463] -- 0:00:01
980000 -- (-267.721) (-271.698) (-266.817) [-266.244] * (-266.371) (-271.218) (-267.529) [-266.969] -- 0:00:01
Average standard deviation of split frequencies: 0.007000
980500 -- (-271.021) (-269.399) (-266.892) [-268.986] * (-268.522) [-270.318] (-269.610) (-267.599) -- 0:00:01
981000 -- [-267.900] (-272.226) (-265.128) (-276.989) * (-268.982) [-270.629] (-270.204) (-269.753) -- 0:00:01
981500 -- (-271.184) (-269.115) (-267.795) [-267.982] * (-267.990) (-268.147) [-266.762] (-268.795) -- 0:00:01
982000 -- (-268.254) (-270.669) [-268.198] (-269.239) * [-267.964] (-268.047) (-270.189) (-267.380) -- 0:00:01
982500 -- [-267.943] (-269.427) (-269.505) (-272.727) * (-271.685) (-267.484) [-265.939] (-267.042) -- 0:00:01
983000 -- (-269.099) [-267.999] (-269.862) (-268.213) * (-270.169) (-270.367) (-269.038) [-267.800] -- 0:00:01
983500 -- (-268.751) (-267.787) (-266.836) [-268.078] * (-267.427) (-269.423) [-266.799] (-268.116) -- 0:00:01
984000 -- [-267.790] (-267.623) (-269.248) (-267.733) * (-268.185) [-266.085] (-268.306) (-269.349) -- 0:00:01
984500 -- (-277.014) (-271.258) [-265.965] (-270.114) * [-269.116] (-267.570) (-268.556) (-267.298) -- 0:00:00
985000 -- (-269.662) (-270.259) (-267.445) [-268.742] * [-268.254] (-273.936) (-267.358) (-270.262) -- 0:00:00
Average standard deviation of split frequencies: 0.006992
985500 -- (-268.492) [-266.821] (-266.084) (-270.584) * (-267.880) (-268.399) [-268.349] (-267.503) -- 0:00:00
986000 -- (-270.900) (-269.355) (-270.647) [-266.332] * (-269.488) [-267.647] (-269.064) (-271.021) -- 0:00:00
986500 -- (-268.754) (-269.126) [-270.007] (-266.837) * (-270.566) [-268.269] (-269.868) (-269.466) -- 0:00:00
987000 -- (-267.583) [-267.173] (-268.749) (-269.613) * (-268.743) (-269.360) (-266.728) [-270.480] -- 0:00:00
987500 -- (-269.698) (-271.317) (-271.223) [-267.980] * (-270.777) [-267.506] (-270.406) (-270.202) -- 0:00:00
988000 -- (-270.445) (-270.275) [-267.737] (-269.310) * (-267.035) [-268.582] (-272.244) (-272.562) -- 0:00:00
988500 -- [-268.451] (-272.727) (-266.221) (-269.782) * (-268.494) [-269.748] (-268.653) (-269.154) -- 0:00:00
989000 -- (-268.519) (-268.977) (-266.960) [-271.531] * [-266.317] (-270.391) (-266.876) (-269.102) -- 0:00:00
989500 -- (-268.240) (-265.102) (-269.601) [-265.166] * [-270.323] (-267.854) (-271.931) (-272.557) -- 0:00:00
990000 -- [-268.686] (-267.706) (-267.130) (-266.554) * [-266.582] (-268.801) (-268.534) (-271.034) -- 0:00:00
Average standard deviation of split frequencies: 0.007197
990500 -- (-266.878) [-272.391] (-266.585) (-267.919) * (-269.486) (-267.415) (-268.589) [-267.934] -- 0:00:00
991000 -- (-269.351) (-270.978) [-266.021] (-268.533) * (-266.900) (-266.334) (-270.043) [-269.987] -- 0:00:00
991500 -- [-267.835] (-269.823) (-267.074) (-270.021) * (-271.810) [-265.504] (-269.183) (-270.886) -- 0:00:00
992000 -- (-269.437) (-269.745) [-267.673] (-271.780) * (-270.138) (-268.951) [-268.412] (-270.043) -- 0:00:00
992500 -- (-268.586) (-268.324) (-268.160) [-267.630] * (-270.597) (-266.958) [-268.788] (-268.527) -- 0:00:00
993000 -- (-270.697) [-265.940] (-267.730) (-270.255) * (-268.245) (-270.039) (-269.829) [-268.447] -- 0:00:00
993500 -- (-268.779) [-267.628] (-265.986) (-268.973) * (-268.681) (-269.807) (-267.102) [-267.090] -- 0:00:00
994000 -- (-270.250) (-273.455) (-268.211) [-267.880] * (-268.952) (-271.358) (-269.261) [-268.074] -- 0:00:00
994500 -- [-269.067] (-276.318) (-268.213) (-270.771) * [-268.025] (-272.264) (-274.419) (-270.724) -- 0:00:00
995000 -- (-267.364) (-269.732) [-271.195] (-269.047) * (-269.443) (-272.804) (-269.481) [-267.910] -- 0:00:00
Average standard deviation of split frequencies: 0.007129
995500 -- [-269.371] (-267.334) (-268.487) (-269.033) * [-267.476] (-267.357) (-266.867) (-269.701) -- 0:00:00
996000 -- [-267.793] (-269.915) (-267.810) (-269.130) * (-269.936) (-273.596) (-269.015) [-268.624] -- 0:00:00
996500 -- (-268.238) [-267.240] (-268.639) (-270.434) * (-269.007) [-271.809] (-273.583) (-270.181) -- 0:00:00
997000 -- (-270.779) (-267.035) (-267.892) [-268.804] * (-267.700) (-270.235) (-269.866) [-268.600] -- 0:00:00
997500 -- (-268.447) (-270.410) [-269.620] (-268.324) * (-269.527) (-271.954) [-268.970] (-267.713) -- 0:00:00
998000 -- (-270.095) [-267.961] (-270.983) (-267.782) * (-266.908) (-272.038) (-267.417) [-267.543] -- 0:00:00
998500 -- (-267.532) [-265.742] (-267.028) (-268.822) * (-269.621) [-266.450] (-267.548) (-269.082) -- 0:00:00
999000 -- (-269.842) (-268.397) (-268.424) [-270.146] * [-268.682] (-271.069) (-273.707) (-269.857) -- 0:00:00
999500 -- (-269.687) (-269.550) [-267.820] (-268.263) * (-268.365) [-268.153] (-267.079) (-269.714) -- 0:00:00
1000000 -- (-267.709) [-271.196] (-270.704) (-272.089) * (-271.494) (-271.140) (-268.944) [-267.809] -- 0:00:00
Average standard deviation of split frequencies: 0.007125
Analysis completed in 1 mins 4 seconds
Analysis used 62.04 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -264.00
Likelihood of best state for "cold" chain of run 2 was -263.99
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 69 %) Dirichlet(Revmat{all})
98.3 % ( 99 %) Slider(Revmat{all})
48.7 % ( 37 %) Dirichlet(Pi{all})
46.0 % ( 26 %) Slider(Pi{all})
68.5 % ( 43 %) Multiplier(Alpha{1,2})
78.6 % ( 46 %) Multiplier(Alpha{3})
34.3 % ( 18 %) Slider(Pinvar{all})
97.0 % ( 96 %) ExtSPR(Tau{all},V{all})
69.2 % ( 70 %) ExtTBR(Tau{all},V{all})
97.9 % ( 98 %) NNI(Tau{all},V{all})
87.7 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
94.3 % ( 95 %) Nodeslider(V{all})
30.8 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 73 %) Dirichlet(Revmat{all})
98.3 % ( 97 %) Slider(Revmat{all})
48.2 % ( 38 %) Dirichlet(Pi{all})
45.2 % ( 29 %) Slider(Pi{all})
69.3 % ( 39 %) Multiplier(Alpha{1,2})
79.3 % ( 41 %) Multiplier(Alpha{3})
33.9 % ( 22 %) Slider(Pinvar{all})
97.0 % ( 96 %) ExtSPR(Tau{all},V{all})
69.0 % ( 65 %) ExtTBR(Tau{all},V{all})
97.9 % ( 96 %) NNI(Tau{all},V{all})
87.7 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
94.2 % ( 97 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167098 0.82 0.66
3 | 166181 166577 0.83
4 | 166460 166551 167133
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167425 0.82 0.66
3 | 165869 166770 0.83
4 | 166373 166529 167034
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -267.36
| 2 |
| |
| |
| 1 1 1 |
| 1 1 2 |
| * 1 1 2 2 1 1 2 2|
|1 2 1 1 212 2 11 2 2 1 2 1 1|
| 1 1 2 2 2 2 1 12 2 2 1 112 1 * |
|22 2 2 1 2 1* 22 1 2 2 1 212 |
| 2 2*1* 1 1 1 1 2 2 2 2 1 |
| 2 21 2 2 12 1 1 |
| 2 1 2 1 2 2 22 |
| 11 1 1 2 1 2 1 1 1 2 |
| 2 1 1 |
| 2 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -269.60
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -267.59 -271.00
2 -267.54 -271.23
--------------------------------------
TOTAL -267.57 -271.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865978 0.087386 0.349083 1.448313 0.835976 1501.00 1501.00 1.000
r(A<->C){all} 0.175441 0.023784 0.000065 0.492662 0.130087 216.29 245.66 1.000
r(A<->G){all} 0.135852 0.014865 0.000103 0.388774 0.099073 379.27 397.31 1.001
r(A<->T){all} 0.171855 0.020273 0.000301 0.459509 0.132686 157.19 199.27 1.003
r(C<->G){all} 0.147297 0.017275 0.000002 0.401865 0.111176 163.68 261.52 1.000
r(C<->T){all} 0.172431 0.021288 0.000061 0.478140 0.135168 191.82 213.66 1.000
r(G<->T){all} 0.197124 0.023537 0.000018 0.501502 0.160534 161.34 189.15 1.000
pi(A){all} 0.200385 0.000834 0.144101 0.255867 0.199580 1200.80 1233.23 1.000
pi(C){all} 0.189708 0.000756 0.138031 0.244588 0.188866 1162.60 1246.38 1.000
pi(G){all} 0.253498 0.000980 0.191964 0.314351 0.252760 1192.98 1219.98 1.000
pi(T){all} 0.356409 0.001206 0.289463 0.426066 0.356088 1251.73 1313.24 1.000
alpha{1,2} 0.327877 0.129486 0.000164 0.982661 0.215498 969.40 1127.49 1.000
alpha{3} 0.390216 0.210496 0.000267 1.339994 0.224174 1260.47 1266.19 1.000
pinvar{all} 0.979701 0.000270 0.948211 0.999344 0.984181 1061.88 1081.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..****
9 -- .*.***
10 -- .*.*..
11 -- ..**..
12 -- .*..*.
13 -- ..*..*
14 -- .**.**
15 -- ..*.*.
16 -- ...**.
17 -- .***.*
18 -- .****.
19 -- ....**
20 -- .**...
21 -- .*...*
22 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.018373 0.142572 0.168554 2
8 451 0.150233 0.010835 0.142572 0.157895 2
9 446 0.148568 0.003769 0.145903 0.151233 2
10 438 0.145903 0.005653 0.141905 0.149900 2
11 435 0.144903 0.000471 0.144570 0.145237 2
12 435 0.144903 0.003298 0.142572 0.147235 2
13 430 0.143238 0.007537 0.137908 0.148568 2
14 424 0.141239 0.013191 0.131912 0.150566 2
15 423 0.140906 0.001413 0.139907 0.141905 2
16 423 0.140906 0.005182 0.137242 0.144570 2
17 422 0.140573 0.006595 0.135909 0.145237 2
18 422 0.140573 0.005653 0.136576 0.144570 2
19 420 0.139907 0.000942 0.139241 0.140573 2
20 404 0.134577 0.011306 0.126582 0.142572 2
21 399 0.132911 0.008009 0.127249 0.138574 2
22 281 0.093604 0.011777 0.085276 0.101932 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.087313 0.008509 0.000046 0.265463 0.057553 1.000 2
length{all}[2] 0.088943 0.008378 0.000057 0.267389 0.060303 1.000 2
length{all}[3] 0.085354 0.008246 0.000071 0.263062 0.057443 1.000 2
length{all}[4] 0.089717 0.008474 0.000006 0.282101 0.060656 1.000 2
length{all}[5] 0.155430 0.015260 0.000225 0.405233 0.124997 1.000 2
length{all}[6] 0.090891 0.008610 0.000058 0.276934 0.061166 1.000 2
length{all}[7] 0.087035 0.008142 0.000346 0.282127 0.059280 1.000 2
length{all}[8] 0.084568 0.006620 0.000603 0.230667 0.060847 1.002 2
length{all}[9] 0.090194 0.008889 0.000219 0.254922 0.064820 0.999 2
length{all}[10] 0.090507 0.009375 0.000040 0.285102 0.057427 1.008 2
length{all}[11] 0.088286 0.006334 0.000498 0.244946 0.064398 1.002 2
length{all}[12] 0.100980 0.009840 0.000060 0.304790 0.068317 0.998 2
length{all}[13] 0.087911 0.007230 0.000080 0.271515 0.058288 1.003 2
length{all}[14] 0.083232 0.006364 0.000565 0.234038 0.060218 1.000 2
length{all}[15] 0.084537 0.007925 0.000456 0.261460 0.059978 0.999 2
length{all}[16] 0.089836 0.007897 0.000023 0.285136 0.061754 0.998 2
length{all}[17] 0.094189 0.010638 0.000006 0.287439 0.065212 0.998 2
length{all}[18] 0.095462 0.009000 0.000805 0.294352 0.065014 0.998 2
length{all}[19] 0.092215 0.010166 0.000610 0.276287 0.062782 1.000 2
length{all}[20] 0.079957 0.006817 0.000082 0.243193 0.054710 1.005 2
length{all}[21] 0.097186 0.010615 0.000049 0.302574 0.064168 0.999 2
length{all}[22] 0.088260 0.007587 0.000112 0.237436 0.066530 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007125
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------- C1 (1)
|
|----------------------------------- C2 (2)
|
|--------------------------------- C3 (3)
+
|----------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------- C6 (6)
|----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 189
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 34 patterns at 63 / 63 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 34 patterns at 63 / 63 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
33184 bytes for conP
2992 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.065917 0.036013 0.097379 0.062601 0.013222 0.054637 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -273.357487
Iterating by ming2
Initial: fx= 273.357487
x= 0.06592 0.03601 0.09738 0.06260 0.01322 0.05464 0.30000 1.30000
1 h-m-p 0.0000 0.0006 139.3540 +++ 262.225862 m 0.0006 14 | 1/8
2 h-m-p 0.0000 0.0000 22816.5911 ++ 257.570115 m 0.0000 25 | 2/8
3 h-m-p 0.0021 0.3433 15.1018 ------------.. | 2/8
4 h-m-p 0.0000 0.0001 109.6328 ++ 256.031610 m 0.0001 57 | 3/8
5 h-m-p 0.0000 0.0000 3431.1338 ++ 255.611398 m 0.0000 68 | 4/8
6 h-m-p 0.0004 0.0095 8.1780 +++ 253.698896 m 0.0095 80 | 5/8
7 h-m-p 0.1300 0.7053 0.5438 ++ 253.443460 m 0.7053 91 | 6/8
8 h-m-p 0.9136 8.0000 0.1217 ++ 253.399296 m 8.0000 105 | 6/8
9 h-m-p 1.6000 8.0000 0.1896 +YCCC 253.360118 3 4.1496 124 | 6/8
10 h-m-p 1.6000 8.0000 0.4640 +CCC 253.332222 2 5.4730 142 | 6/8
11 h-m-p 1.6000 8.0000 0.8698 CCC 253.317699 2 1.9955 159 | 6/8
12 h-m-p 1.6000 8.0000 1.0139 +CCC 253.305016 2 6.0562 177 | 6/8
13 h-m-p 1.6000 8.0000 1.9359 CCC 253.299044 2 2.0250 192 | 6/8
14 h-m-p 1.6000 8.0000 2.3353 +C 253.293498 0 6.4000 204 | 6/8
15 h-m-p 1.6000 8.0000 4.3911 CC 253.291012 1 1.9604 217 | 6/8
16 h-m-p 1.5929 8.0000 5.4043 +YC 253.288519 1 7.0649 230 | 6/8
17 h-m-p 1.6000 8.0000 10.4055 CC 253.287523 1 1.8730 243 | 6/8
18 h-m-p 1.5583 8.0000 12.5069 ++ 253.286463 m 8.0000 254 | 6/8
19 h-m-p 1.6000 8.0000 23.7937 CC 253.286055 1 1.7412 267 | 6/8
20 h-m-p 1.4303 8.0000 28.9664 ++ 253.285596 m 8.0000 278 | 6/8
21 h-m-p 1.5013 7.5064 70.2166 CC 253.285447 1 2.0073 291 | 6/8
22 h-m-p 0.9849 4.9244 78.4109 ++ 253.285294 m 4.9244 302 | 7/8
23 h-m-p 1.6000 8.0000 0.0001 YC 253.285280 1 1.0022 314 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 +Y 253.285280 0 4.1466 327
Out..
lnL = -253.285280
328 lfun, 328 eigenQcodon, 1968 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.043849 0.017514 0.013880 0.101201 0.105185 0.070221 0.000100 0.579415 0.527696
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.112173
np = 9
lnL0 = -272.361662
Iterating by ming2
Initial: fx= 272.361662
x= 0.04385 0.01751 0.01388 0.10120 0.10519 0.07022 0.00011 0.57942 0.52770
1 h-m-p 0.0000 0.0000 144.9416 ++ 272.136483 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 286.1407 +++ 266.103076 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 89.5441 ++ 265.187490 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0002 596.8738 ++ 260.046233 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0001 1018.0562 ++ 256.738999 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 13901.8605 ++ 254.771182 m 0.0000 75 | 6/9
7 h-m-p 0.0176 0.0882 2.6387 +YYYCCCC 253.578820 6 0.0626 97 | 6/9
8 h-m-p 1.2790 6.3952 0.1157 ++ 253.504118 m 6.3952 109 | 7/9
9 h-m-p 0.1369 0.6845 0.0867 +YC 253.499005 1 0.3914 126 | 7/9
10 h-m-p 1.6000 8.0000 0.0003 Y 253.499004 0 0.9084 140 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 --N 253.499004 0 0.0250 156 | 7/9
12 h-m-p 0.0257 8.0000 0.0000 ------N 253.499004 0 0.0000 176
Out..
lnL = -253.499004
177 lfun, 531 eigenQcodon, 2124 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.011530 0.104923 0.041806 0.096984 0.027078 0.088861 0.000100 1.592521 0.410457 0.458232 1157.648108
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.083584
np = 11
lnL0 = -261.546741
Iterating by ming2
Initial: fx= 261.546741
x= 0.01153 0.10492 0.04181 0.09698 0.02708 0.08886 0.00011 1.59252 0.41046 0.45823 951.42857
1 h-m-p 0.0000 0.0000 34.5454 ++ 261.544068 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 51.1220 +++ 260.917176 m 0.0005 31 | 2/11
3 h-m-p 0.0041 0.3328 5.0790 ++++ 255.314336 m 0.3328 47 | 3/11
4 h-m-p 0.0001 0.0003 87.9412 ++ 255.109527 m 0.0003 61 | 4/11
5 h-m-p 0.0014 0.0070 16.4296 ++ 254.466326 m 0.0070 75 | 5/11
6 h-m-p 0.0017 0.0086 24.5756 ++ 253.698688 m 0.0086 89 | 6/11
7 h-m-p 0.0062 0.0957 33.8395 +YYCCYCCC 253.290305 7 0.0677 117 | 6/11
8 h-m-p 1.6000 8.0000 0.0057 C 253.290303 0 0.5014 131 | 6/11
9 h-m-p 0.0807 8.0000 0.0352 ++++ 253.289472 m 8.0000 152 | 6/11
10 h-m-p 0.2506 3.0117 1.1222 ++ 253.286432 m 3.0117 171 | 6/11
11 h-m-p 0.0000 0.0000 0.2707
h-m-p: 1.27479833e-16 6.37399164e-16 2.70734096e-01 253.286432
.. | 7/11
12 h-m-p 0.0160 8.0000 1.9383 --C 253.285967 0 0.0003 203 | 7/11
13 h-m-p 0.7770 8.0000 0.0006 ++ 253.285964 m 8.0000 217 | 7/11
14 h-m-p 0.0274 8.0000 0.1821 +++C 253.285863 0 1.9864 238 | 7/11
15 h-m-p 1.6000 8.0000 0.1154 ++ 253.285554 m 8.0000 256 | 7/11
16 h-m-p 1.6000 8.0000 0.3559 YC 253.285424 1 2.5183 275 | 7/11
17 h-m-p 1.6000 8.0000 0.4258 CC 253.285368 1 2.3788 295 | 7/11
18 h-m-p 1.6000 8.0000 0.3900 YC 253.285343 1 3.0685 314 | 7/11
19 h-m-p 1.6000 8.0000 0.4766 Y 253.285331 0 2.7034 332 | 7/11
20 h-m-p 1.6000 8.0000 0.5808 YC 253.285322 1 3.7940 351 | 7/11
21 h-m-p 1.6000 8.0000 1.2425 +Y 253.285310 0 4.3875 370 | 7/11
22 h-m-p 1.6000 8.0000 2.8346 YC 253.285298 1 3.7697 385 | 7/11
23 h-m-p 1.6000 8.0000 3.3963 C 253.285295 0 2.1558 399 | 7/11
24 h-m-p 1.6000 8.0000 3.2291 Y 253.285293 0 3.2906 413 | 7/11
25 h-m-p 1.6000 8.0000 3.1002 C 253.285292 0 1.9718 427 | 7/11
26 h-m-p 1.6000 8.0000 3.6364 +Y 253.285292 0 4.3545 442 | 7/11
27 h-m-p 1.6000 8.0000 2.3891 C 253.285292 0 1.4232 456 | 7/11
28 h-m-p 0.8498 7.8465 4.0012 +Y 253.285292 0 5.1938 471 | 7/11
29 h-m-p 0.2710 1.3549 7.8340 ++ 253.285292 m 1.3549 485 | 7/11
30 h-m-p -0.0000 -0.0000 3.4308
h-m-p: -0.00000000e+00 -0.00000000e+00 3.43077076e+00 253.285292
.. | 7/11
31 h-m-p 0.0160 8.0000 0.0005 -----------Y 253.285292 0 0.0000 521 | 7/11
32 h-m-p 0.0160 8.0000 0.0000 Y 253.285292 0 0.0160 539
Out..
lnL = -253.285292
540 lfun, 2160 eigenQcodon, 9720 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -258.227619 S = -256.788826 -2.367335
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:04
did 20 / 34 patterns 0:04
did 30 / 34 patterns 0:04
did 34 / 34 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.027418 0.060693 0.044381 0.073058 0.055478 0.051237 0.000100 1.156467 1.248641
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 14.883103
np = 9
lnL0 = -270.452086
Iterating by ming2
Initial: fx= 270.452086
x= 0.02742 0.06069 0.04438 0.07306 0.05548 0.05124 0.00011 1.15647 1.24864
1 h-m-p 0.0000 0.0000 137.8902 ++ 270.296251 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 529.3784 +YCYYYYYCCC 263.150002 10 0.0001 41 | 1/9
3 h-m-p 0.0052 0.0886 13.3912 +YYCCCCC 263.115880 6 0.0275 64 | 1/9
4 h-m-p 0.1715 0.8573 0.9464 ---------------.. | 1/9
5 h-m-p 0.0000 0.0001 172.7121 ++ 260.159064 m 0.0001 109 | 2/9
6 h-m-p 0.0000 0.0001 276.8506 ++ 256.600962 m 0.0001 121 | 3/9
7 h-m-p 0.0060 0.1976 4.2089 ------------.. | 3/9
8 h-m-p 0.0000 0.0001 108.0351 ++ 255.489231 m 0.0001 155 | 4/9
9 h-m-p 0.0000 0.0000 2690481.9634 ++ 254.455597 m 0.0000 167 | 5/9
10 h-m-p 0.0000 0.0002 66.7627 ++ 253.784628 m 0.0002 179 | 6/9
11 h-m-p 0.0142 7.1192 0.3692 ++++
QuantileBeta(0.85, 3.06024, 0.00500) = 1.000000e+00 2000 rounds
YCC 253.630961 2 2.5585 198 | 6/9
12 h-m-p 0.6042 3.0208 0.4470 YCCC 253.550986 3 1.3074 218 | 6/9
13 h-m-p 0.3669 1.8345 0.3665 +
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
+ 253.501287 m 1.8345 233
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52713, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52726, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52700, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
14 h-m-p 1.6000 8.0000 0.0547
QuantileBeta(0.85, 2.61469, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.87737, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.58827, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.59280, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.60375, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
C 253.499004 2 1.2073 251
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59333, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59307, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59320, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.59323, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59331, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
Y 253.499004 0 1.1850 265
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59335, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59309, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
N 253.499004 0 0.0001 285
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -253.499004
286 lfun, 3146 eigenQcodon, 17160 P(t)
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.59322, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.045872 0.051334 0.011190 0.081589 0.079380 0.014464 0.000100 0.900000 0.238578 1.571697 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.112825
np = 11
lnL0 = -258.463076
Iterating by ming2
Initial: fx= 258.463076
x= 0.04587 0.05133 0.01119 0.08159 0.07938 0.01446 0.00011 0.90000 0.23858 1.57170 951.42857
1 h-m-p 0.0000 0.0000 38.2010 ++ 258.459392 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 346.2220 ++ 257.512315 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0002 47.8235 ++ 257.236220 m 0.0002 44 | 3/11
4 h-m-p 0.0003 0.0021 26.4430 ++ 255.381097 m 0.0021 58 | 4/11
5 h-m-p 0.0001 0.0003 45.8701 ++ 254.966128 m 0.0003 72 | 5/11
6 h-m-p 0.0004 0.0020 22.5659 ++ 253.765896 m 0.0020 86 | 6/11
7 h-m-p 0.0010 0.0048 15.1212 CYCCC 253.636106 4 0.0018 107 | 6/11
8 h-m-p 0.1983 0.9914 0.0410 YCYCCC 253.481794 5 0.5261 130 | 6/11
9 h-m-p 1.6000 8.0000 0.0124 CCC 253.384994 2 1.6064 153 | 6/11
10 h-m-p 0.4698 2.3489 0.0146 CYCCCC 253.349646 5 0.6755 181 | 6/11
11 h-m-p 1.6000 8.0000 0.0055 ++ 253.312578 m 8.0000 200 | 6/11
12 h-m-p 1.1957 5.9785 0.0153 YCCC 253.307214 3 0.6947 224 | 6/11
13 h-m-p 1.0287 8.0000 0.0103 ++ 253.295027 m 8.0000 243 | 6/11
14 h-m-p 1.6000 8.0000 0.0254 +CC 253.290698 1 5.8740 265 | 6/11
15 h-m-p 0.2372 1.1861 0.0515 +C 253.288881 0 0.9665 285 | 6/11
16 h-m-p 0.0457 0.2286 0.0492 ++ 253.288718 m 0.2286 304 | 6/11
17 h-m-p -0.0000 -0.0000 0.1880
h-m-p: -0.00000000e+00 -0.00000000e+00 1.87976095e-01 253.288718
.. | 6/11
18 h-m-p 0.0001 0.0251 0.6560 +CC 253.288656 1 0.0003 342 | 6/11
19 h-m-p 0.0160 8.0000 0.0170 +++++ 253.287117 m 8.0000 364 | 6/11
20 h-m-p 1.0346 5.1728 0.1079 ++ 253.285315 m 5.1728 383 | 7/11
21 h-m-p 0.0627 0.3137 0.0010 YC 253.285292 1 0.1117 403 | 7/11
22 h-m-p 1.6000 8.0000 0.0000 C 253.285292 0 2.0487 421
Out..
lnL = -253.285292
422 lfun, 5064 eigenQcodon, 27852 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -257.966438 S = -256.788745 -1.981150
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 34 patterns 0:16
did 20 / 34 patterns 0:16
did 30 / 34 patterns 0:16
did 34 / 34 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=63
NC_011896_1_WP_010907462_1_9_MLBR_RS00055 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
NC_002677_1_NP_301137_1_9_ML0009 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055 MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF
***********:**************************************
NC_011896_1_WP_010907462_1_9_MLBR_RS00055 ATKCGRFVIIYLS
NC_002677_1_NP_301137_1_9_ML0009 ATKCGRFVIIYLS
NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015 ATKCGRFVIIYLS
NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885 ATKCGRFVIIYLS
NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055 ATKCGRFVIIYLS
NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055 ATKCGRFVIIYLS
*************
>NC_011896_1_WP_010907462_1_9_MLBR_RS00055 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC >NC_002677_1_NP_301137_1_9_ML0009 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC >NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC >NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC >NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055 ATGAGATTATGTGTGTTCACCGGTACCGTAGACTCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC >NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055 ATGAGATTATGTGTGTTCACCGGTACCGTAGACGCTGGTGGCGACCATTA TATGTTGGTGGTAATGTTGGTCATTATTGTTACGTCTGCCGTTACGACGG CGATATGCGACTTGCTTGGCAGTTTTTATTACCCACTTAAGCATGTTTTT GCCACGAAATGCGGACGCTTCGTAATTATTTATTTGTCC
>NC_011896_1_WP_010907462_1_9_MLBR_RS00055 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS >NC_002677_1_NP_301137_1_9_ML0009 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS >NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS >NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS >NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055 MRLCVFTGTVDSGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS >NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055 MRLCVFTGTVDAGGDHYMLVVMLVIIVTSAVTTAICDLLGSFYYPLKHVF ATKCGRFVIIYLS
#NEXUS
[ID: 0658417588]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907462_1_9_MLBR_RS00055
NC_002677_1_NP_301137_1_9_ML0009
NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015
NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885
NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055
NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907462_1_9_MLBR_RS00055,
2 NC_002677_1_NP_301137_1_9_ML0009,
3 NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015,
4 NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885,
5 NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055,
6 NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05755305,2:0.06030304,3:0.05744303,4:0.06065553,5:0.1249969,6:0.06116615);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05755305,2:0.06030304,3:0.05744303,4:0.06065553,5:0.1249969,6:0.06116615);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -267.59 -271.00
2 -267.54 -271.23
--------------------------------------
TOTAL -267.57 -271.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0009/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.865978 0.087386 0.349083 1.448313 0.835976 1501.00 1501.00 1.000
r(A<->C){all} 0.175441 0.023784 0.000065 0.492662 0.130087 216.29 245.66 1.000
r(A<->G){all} 0.135852 0.014865 0.000103 0.388774 0.099073 379.27 397.31 1.001
r(A<->T){all} 0.171855 0.020273 0.000301 0.459509 0.132686 157.19 199.27 1.003
r(C<->G){all} 0.147297 0.017275 0.000002 0.401865 0.111176 163.68 261.52 1.000
r(C<->T){all} 0.172431 0.021288 0.000061 0.478140 0.135168 191.82 213.66 1.000
r(G<->T){all} 0.197124 0.023537 0.000018 0.501502 0.160534 161.34 189.15 1.000
pi(A){all} 0.200385 0.000834 0.144101 0.255867 0.199580 1200.80 1233.23 1.000
pi(C){all} 0.189708 0.000756 0.138031 0.244588 0.188866 1162.60 1246.38 1.000
pi(G){all} 0.253498 0.000980 0.191964 0.314351 0.252760 1192.98 1219.98 1.000
pi(T){all} 0.356409 0.001206 0.289463 0.426066 0.356088 1251.73 1313.24 1.000
alpha{1,2} 0.327877 0.129486 0.000164 0.982661 0.215498 969.40 1127.49 1.000
alpha{3} 0.390216 0.210496 0.000267 1.339994 0.224174 1260.47 1266.19 1.000
pinvar{all} 0.979701 0.000270 0.948211 0.999344 0.984181 1061.88 1081.14 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0009/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 63
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 2 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 0 0 0 0 0 0 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 0 0 0 0 0 0 | ACC 2 2 2 2 2 2 | AAC 0 0 0 0 0 0 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 4 4 4 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 1 1 1 1 0 1 | Asp GAT 0 0 0 0 0 0 | Gly GGT 2 2 2 2 2 2
GTC 1 1 1 1 1 1 | GCC 2 2 2 2 2 2 | GAC 3 3 3 3 3 3 | GGC 2 2 2 2 2 2
GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907462_1_9_MLBR_RS00055
position 1: T:0.28571 C:0.09524 A:0.28571 G:0.33333
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.35979 C:0.19048 A:0.20106 G:0.24868
#2: NC_002677_1_NP_301137_1_9_ML0009
position 1: T:0.28571 C:0.09524 A:0.28571 G:0.33333
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.35979 C:0.19048 A:0.20106 G:0.24868
#3: NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015
position 1: T:0.28571 C:0.09524 A:0.28571 G:0.33333
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.35979 C:0.19048 A:0.20106 G:0.24868
#4: NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885
position 1: T:0.28571 C:0.09524 A:0.28571 G:0.33333
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.35979 C:0.19048 A:0.20106 G:0.24868
#5: NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055
position 1: T:0.30159 C:0.09524 A:0.28571 G:0.31746
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.36508 C:0.19048 A:0.20106 G:0.24339
#6: NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055
position 1: T:0.28571 C:0.09524 A:0.28571 G:0.33333
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.35979 C:0.19048 A:0.20106 G:0.24868
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 7 | Tyr Y TAT 18 | Cys C TGT 6
TTC 12 | TCC 6 | TAC 6 | TGC 12
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 0
CTC 0 | CCC 0 | CAC 0 | CGC 6
CTA 0 | CCA 6 | Gln Q CAA 0 | CGA 0
CTG 0 | CCG 0 | CAG 0 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 0 | ACC 12 | AAC 0 | AGC 0
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 6
Met M ATG 18 | ACG 24 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 5 | Asp D GAT 0 | Gly G GGT 12
GTC 6 | GCC 12 | GAC 18 | GGC 12
GTA 18 | GCA 0 | Glu E GAA 0 | GGA 6
GTG 12 | GCG 6 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.28836 C:0.09524 A:0.28571 G:0.33069
position 2: T:0.44444 C:0.20635 A:0.17460 G:0.17460
position 3: T:0.34921 C:0.26984 A:0.14286 G:0.23810
Average T:0.36067 C:0.19048 A:0.20106 G:0.24780
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -253.285280 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.015867 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.015887
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.015867, 6: 0.000004);
(NC_011896_1_WP_010907462_1_9_MLBR_RS00055: 0.000004, NC_002677_1_NP_301137_1_9_ML0009: 0.000004, NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015: 0.000004, NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885: 0.000004, NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055: 0.015867, NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 152.0 37.0 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 152.0 37.0 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 152.0 37.0 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 152.0 37.0 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.016 152.0 37.0 999.0000 0.0066 0.0000 1.0 0.0
7..6 0.000 152.0 37.0 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0066
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -253.499004 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.015920 0.000004 0.000100 0.025087 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.015940
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.015920, 6: 0.000004);
(NC_011896_1_WP_010907462_1_9_MLBR_RS00055: 0.000004, NC_002677_1_NP_301137_1_9_ML0009: 0.000004, NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015: 0.000004, NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885: 0.000004, NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055: 0.015920, NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.02509 0.97491
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.016 152.0 37.0 1.0000 0.0053 0.0053 0.8 0.2
7..6 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -253.285292 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.015867 0.000004 0.000100 0.000000 0.000001 0.000001 951.492523
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.015887
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.015867, 6: 0.000004);
(NC_011896_1_WP_010907462_1_9_MLBR_RS00055: 0.000004, NC_002677_1_NP_301137_1_9_ML0009: 0.000004, NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015: 0.000004, NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885: 0.000004, NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055: 0.015867, NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 951.49252
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 152.0 37.0 951.4911 0.0000 0.0000 0.0 0.0
7..2 0.000 152.0 37.0 951.4911 0.0000 0.0000 0.0 0.0
7..3 0.000 152.0 37.0 951.4911 0.0000 0.0000 0.0 0.0
7..4 0.000 152.0 37.0 951.4911 0.0000 0.0000 0.0 0.0
7..5 0.016 152.0 37.0 951.4911 0.0066 0.0000 1.0 0.0
7..6 0.000 152.0 37.0 951.4911 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907462_1_9_MLBR_RS00055)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.491
2 R 1.000** 951.491
3 L 1.000** 951.491
4 C 1.000** 951.491
5 V 1.000** 951.491
6 F 1.000** 951.491
7 T 1.000** 951.491
8 G 1.000** 951.491
9 T 1.000** 951.491
10 V 1.000** 951.491
11 D 1.000** 951.491
12 A 1.000** 951.493
13 G 1.000** 951.491
14 G 1.000** 951.491
15 D 1.000** 951.491
16 H 1.000** 951.491
17 Y 1.000** 951.491
18 M 1.000** 951.491
19 L 1.000** 951.491
20 V 1.000** 951.491
21 V 1.000** 951.491
22 M 1.000** 951.491
23 L 1.000** 951.491
24 V 1.000** 951.491
25 I 1.000** 951.491
26 I 1.000** 951.491
27 V 1.000** 951.491
28 T 1.000** 951.491
29 S 1.000** 951.491
30 A 1.000** 951.491
31 V 1.000** 951.491
32 T 1.000** 951.491
33 T 1.000** 951.491
34 A 1.000** 951.491
35 I 1.000** 951.491
36 C 1.000** 951.491
37 D 1.000** 951.491
38 L 1.000** 951.491
39 L 1.000** 951.491
40 G 1.000** 951.491
41 S 1.000** 951.491
42 F 1.000** 951.491
43 Y 1.000** 951.491
44 Y 1.000** 951.491
45 P 1.000** 951.491
46 L 1.000** 951.491
47 K 1.000** 951.491
48 H 1.000** 951.491
49 V 1.000** 951.491
50 F 1.000** 951.491
51 A 1.000** 951.491
52 T 1.000** 951.491
53 K 1.000** 951.491
54 C 1.000** 951.491
55 G 1.000** 951.491
56 R 1.000** 951.491
57 F 1.000** 951.491
58 V 1.000** 951.491
59 I 1.000** 951.491
60 I 1.000** 951.491
61 Y 1.000** 951.491
62 L 1.000** 951.491
63 S 1.000** 951.491
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907462_1_9_MLBR_RS00055)
Pr(w>1) post mean +- SE for w
12 A 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -253.499004 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.015920 0.000004 0.000100 2.593222 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.015940
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.015920, 6: 0.000004);
(NC_011896_1_WP_010907462_1_9_MLBR_RS00055: 0.000004, NC_002677_1_NP_301137_1_9_ML0009: 0.000004, NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015: 0.000004, NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885: 0.000004, NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055: 0.015920, NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 2.59322 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.016 152.0 37.0 1.0000 0.0053 0.0053 0.8 0.2
7..6 0.000 152.0 37.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -253.285292 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.015867 0.000004 0.000100 0.000010 0.005002 1.608651 951.430186
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.015887
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.015867, 6: 0.000004);
(NC_011896_1_WP_010907462_1_9_MLBR_RS00055: 0.000004, NC_002677_1_NP_301137_1_9_ML0009: 0.000004, NZ_LVXE01000010_1_WP_010907462_1_274_A3216_RS05015: 0.000004, NZ_LYPH01000099_1_WP_010907462_1_2877_A8144_RS13885: 0.000004, NZ_CP029543_1_WP_111480933_1_9_DIJ64_RS00055: 0.015867, NZ_AP014567_1_WP_010907462_1_9_JK2ML_RS00055: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.60865
(p1 = 0.99999) w = 951.43019
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 951.43019
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 152.0 37.0 951.4207 0.0000 0.0000 0.0 0.0
7..2 0.000 152.0 37.0 951.4207 0.0000 0.0000 0.0 0.0
7..3 0.000 152.0 37.0 951.4207 0.0000 0.0000 0.0 0.0
7..4 0.000 152.0 37.0 951.4207 0.0000 0.0000 0.0 0.0
7..5 0.016 152.0 37.0 951.4207 0.0066 0.0000 1.0 0.0
7..6 0.000 152.0 37.0 951.4207 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907462_1_9_MLBR_RS00055)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.420
2 R 1.000** 951.421
3 L 1.000** 951.420
4 C 1.000** 951.420
5 V 1.000** 951.421
6 F 1.000** 951.420
7 T 1.000** 951.421
8 G 1.000** 951.421
9 T 1.000** 951.421
10 V 1.000** 951.421
11 D 1.000** 951.421
12 A 1.000** 951.430
13 G 1.000** 951.421
14 G 1.000** 951.421
15 D 1.000** 951.421
16 H 1.000** 951.421
17 Y 1.000** 951.420
18 M 1.000** 951.420
19 L 1.000** 951.420
20 V 1.000** 951.421
21 V 1.000** 951.421
22 M 1.000** 951.420
23 L 1.000** 951.420
24 V 1.000** 951.421
25 I 1.000** 951.420
26 I 1.000** 951.420
27 V 1.000** 951.421
28 T 1.000** 951.421
29 S 1.000** 951.421
30 A 1.000** 951.421
31 V 1.000** 951.421
32 T 1.000** 951.421
33 T 1.000** 951.421
34 A 1.000** 951.421
35 I 1.000** 951.421
36 C 1.000** 951.421
37 D 1.000** 951.421
38 L 1.000** 951.420
39 L 1.000** 951.420
40 G 1.000** 951.421
41 S 1.000** 951.420
42 F 1.000** 951.420
43 Y 1.000** 951.420
44 Y 1.000** 951.421
45 P 1.000** 951.421
46 L 1.000** 951.420
47 K 1.000** 951.421
48 H 1.000** 951.421
49 V 1.000** 951.421
50 F 1.000** 951.420
51 A 1.000** 951.421
52 T 1.000** 951.421
53 K 1.000** 951.421
54 C 1.000** 951.421
55 G 1.000** 951.421
56 R 1.000** 951.421
57 F 1.000** 951.420
58 V 1.000** 951.421
59 I 1.000** 951.420
60 I 1.000** 951.420
61 Y 1.000** 951.420
62 L 1.000** 951.420
63 S 1.000** 951.421
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907462_1_9_MLBR_RS00055)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 R 0.639 4.860 +- 3.856
3 L 0.639 4.860 +- 3.856
4 C 0.639 4.860 +- 3.856
5 V 0.639 4.860 +- 3.856
6 F 0.639 4.860 +- 3.856
7 T 0.639 4.860 +- 3.856
8 G 0.639 4.860 +- 3.856
9 T 0.639 4.860 +- 3.856
10 V 0.639 4.860 +- 3.856
11 D 0.639 4.860 +- 3.856
12 A 0.923 6.858 +- 3.003
13 G 0.639 4.860 +- 3.856
14 G 0.639 4.860 +- 3.856
15 D 0.639 4.860 +- 3.856
16 H 0.639 4.860 +- 3.856
17 Y 0.639 4.860 +- 3.856
18 M 0.639 4.860 +- 3.856
19 L 0.639 4.860 +- 3.856
20 V 0.639 4.860 +- 3.856
21 V 0.639 4.860 +- 3.856
22 M 0.639 4.860 +- 3.856
23 L 0.639 4.860 +- 3.856
24 V 0.639 4.860 +- 3.856
25 I 0.639 4.860 +- 3.856
26 I 0.639 4.860 +- 3.856
27 V 0.639 4.860 +- 3.856
28 T 0.639 4.860 +- 3.856
29 S 0.639 4.860 +- 3.856
30 A 0.639 4.860 +- 3.856
31 V 0.639 4.860 +- 3.856
32 T 0.639 4.860 +- 3.856
33 T 0.639 4.860 +- 3.856
34 A 0.639 4.860 +- 3.856
35 I 0.639 4.860 +- 3.856
36 C 0.639 4.860 +- 3.856
37 D 0.639 4.860 +- 3.856
38 L 0.639 4.860 +- 3.856
39 L 0.639 4.860 +- 3.856
40 G 0.639 4.860 +- 3.856
41 S 0.639 4.860 +- 3.856
42 F 0.639 4.860 +- 3.856
43 Y 0.639 4.860 +- 3.856
44 Y 0.639 4.860 +- 3.856
45 P 0.639 4.860 +- 3.856
46 L 0.639 4.860 +- 3.856
47 K 0.639 4.860 +- 3.856
48 H 0.639 4.860 +- 3.856
49 V 0.639 4.860 +- 3.856
50 F 0.639 4.860 +- 3.856
51 A 0.639 4.860 +- 3.856
52 T 0.639 4.860 +- 3.856
53 K 0.639 4.860 +- 3.856
54 C 0.639 4.860 +- 3.856
55 G 0.639 4.860 +- 3.856
56 R 0.639 4.860 +- 3.856
57 F 0.639 4.860 +- 3.856
58 V 0.639 4.860 +- 3.856
59 I 0.639 4.860 +- 3.856
60 I 0.639 4.860 +- 3.856
61 Y 0.639 4.860 +- 3.856
62 L 0.639 4.860 +- 3.856
63 S 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:16
Model 1: NearlyNeutral -253.499004 Model 2: PositiveSelection -253.285292 Model 0: one-ratio -253.28528 Model 7: beta -253.499004 Model 8: beta&w>1 -253.285292 Model 0 vs 1 0.4274480000000267 Model 2 vs 1 0.42742400000003045 Model 8 vs 7 0.42742400000003045
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
