--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:15:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0023/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.21 -416.45
2 -413.24 -415.86
--------------------------------------
TOTAL -413.22 -416.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893329 0.092390 0.373330 1.508401 0.853901 1501.00 1501.00 1.001
r(A<->C){all} 0.157645 0.018346 0.000020 0.419746 0.121443 248.86 249.69 1.000
r(A<->G){all} 0.166438 0.020294 0.000054 0.445765 0.126959 190.40 246.87 1.000
r(A<->T){all} 0.173924 0.022501 0.000062 0.480428 0.132708 287.87 340.82 1.002
r(C<->G){all} 0.178388 0.021412 0.000017 0.464581 0.140650 227.20 271.12 1.001
r(C<->T){all} 0.172109 0.020614 0.000025 0.453904 0.134419 236.89 239.60 1.000
r(G<->T){all} 0.151496 0.016751 0.000007 0.413324 0.118181 287.31 374.16 1.003
pi(A){all} 0.275413 0.000636 0.226469 0.322940 0.274362 1278.85 1323.24 1.000
pi(C){all} 0.372611 0.000745 0.319916 0.428017 0.372241 1119.29 1310.15 1.000
pi(G){all} 0.189316 0.000489 0.148805 0.234216 0.188992 1174.50 1279.09 1.000
pi(T){all} 0.162660 0.000429 0.122092 0.203119 0.162025 1399.49 1409.84 1.000
alpha{1,2} 0.403707 0.217961 0.000245 1.323610 0.247985 1252.69 1287.69 1.001
alpha{3} 0.457759 0.237279 0.000107 1.434738 0.292657 990.61 1069.44 1.000
pinvar{all} 0.994572 0.000043 0.982670 0.999997 0.996645 1258.49 1379.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -392.818824
Model 2: PositiveSelection -392.818805
Model 0: one-ratio -392.818795
Model 7: beta -392.818848
Model 8: beta&w>1 -392.818806
Model 0 vs 1 5.7999999967250915E-5
Model 2 vs 1 3.800000001774606E-5
Model 8 vs 7 8.400000001529406E-5
>C1
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C2
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C3
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C4
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C5
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C6
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
C1 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C2 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C3 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C4 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C5 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C6 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
**************************************************
C1 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C2 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C3 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C4 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C5 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C6 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
**************************************************
C1 RGT
C2 RGT
C3 RGT
C4 RGT
C5 RGT
C6 RGT
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3090]--->[3090]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.444 Mb, Max= 30.618 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C2 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C3 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C4 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C5 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C6 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
**************************************************
C1 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C2 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C3 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C4 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C5 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C6 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
**************************************************
C1 RGT
C2 RGT
C3 RGT
C4 RGT
C5 RGT
C6 RGT
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C2 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C3 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C4 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C5 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C6 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
**************************************************
C1 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C2 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C3 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C4 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C5 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C6 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
**************************************************
C1 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C2 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C3 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C4 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C5 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C6 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
**************************************************
C1 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C2 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C3 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C4 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C5 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C6 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
**************************************************
C1 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C2 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C3 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C4 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C5 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C6 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
**************************************************
C1 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C2 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C3 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C4 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C5 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C6 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
**************************************************
C1 AGGGGGACT
C2 AGGGGGACT
C3 AGGGGGACT
C4 AGGGGGACT
C5 AGGGGGACT
C6 AGGGGGACT
*********
>C1
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C2
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C3
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C4
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C5
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C6
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C1
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C2
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C3
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C4
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C5
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C6
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 309 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788844
Setting output file names to "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 905117990
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0247188275
Seed = 1914826894
Swapseed = 1579788844
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -691.556820 -- -24.965149
Chain 2 -- -691.556714 -- -24.965149
Chain 3 -- -691.556714 -- -24.965149
Chain 4 -- -691.556782 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -691.556714 -- -24.965149
Chain 2 -- -691.556820 -- -24.965149
Chain 3 -- -691.556820 -- -24.965149
Chain 4 -- -691.556820 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-691.557] (-691.557) (-691.557) (-691.557) * [-691.557] (-691.557) (-691.557) (-691.557)
500 -- (-432.509) (-432.489) [-430.281] (-432.217) * (-440.305) [-421.013] (-429.212) (-428.275) -- 0:00:00
1000 -- (-423.683) (-427.169) [-421.725] (-418.063) * (-416.854) [-420.904] (-426.207) (-421.765) -- 0:00:00
1500 -- [-425.163] (-421.754) (-422.620) (-423.175) * (-424.901) [-419.393] (-425.625) (-427.782) -- 0:00:00
2000 -- [-420.804] (-426.088) (-419.986) (-416.495) * [-423.410] (-427.119) (-420.556) (-418.892) -- 0:00:00
2500 -- (-423.501) [-423.359] (-420.288) (-419.454) * (-422.336) (-421.677) (-422.496) [-418.007] -- 0:00:00
3000 -- (-419.831) (-426.662) [-423.818] (-419.104) * (-418.079) (-424.683) [-424.288] (-428.571) -- 0:00:00
3500 -- (-424.797) (-425.714) [-419.781] (-422.579) * (-417.779) (-425.016) [-419.117] (-418.160) -- 0:00:00
4000 -- (-423.739) (-420.610) [-421.359] (-421.562) * (-426.413) (-421.949) (-419.207) [-429.613] -- 0:00:00
4500 -- [-419.666] (-424.224) (-424.236) (-419.705) * [-420.506] (-422.881) (-423.208) (-422.577) -- 0:03:41
5000 -- (-429.189) (-423.426) (-436.876) [-426.001] * (-427.846) (-422.975) (-427.588) [-420.834] -- 0:03:19
Average standard deviation of split frequencies: 0.074826
5500 -- (-427.974) (-423.486) (-423.725) [-425.716] * (-426.303) (-424.735) (-418.445) [-427.030] -- 0:03:00
6000 -- (-425.238) (-429.452) (-427.419) [-420.926] * [-424.955] (-422.043) (-424.072) (-426.515) -- 0:02:45
6500 -- (-424.851) [-422.985] (-428.195) (-422.737) * [-428.929] (-417.383) (-423.184) (-426.945) -- 0:02:32
7000 -- [-421.516] (-422.907) (-421.950) (-430.147) * (-424.696) (-429.058) (-429.866) [-417.989] -- 0:02:21
7500 -- (-419.163) (-424.427) (-428.659) [-423.737] * [-420.849] (-424.460) (-423.881) (-422.409) -- 0:02:12
8000 -- (-422.602) (-430.808) (-424.548) [-424.581] * [-420.426] (-429.478) (-419.597) (-421.345) -- 0:02:04
8500 -- (-424.091) (-421.653) (-424.423) [-425.115] * (-425.125) [-424.130] (-421.669) (-430.673) -- 0:01:56
9000 -- [-421.606] (-422.272) (-433.027) (-422.854) * (-421.923) (-426.093) (-426.141) [-426.787] -- 0:01:50
9500 -- (-427.136) (-421.158) [-427.306] (-422.367) * (-422.589) [-422.960] (-427.498) (-432.074) -- 0:01:44
10000 -- [-420.560] (-421.485) (-420.590) (-436.453) * (-436.684) [-422.364] (-421.684) (-427.737) -- 0:01:39
Average standard deviation of split frequencies: 0.073657
10500 -- (-417.556) (-428.728) [-417.019] (-426.778) * (-429.327) (-427.242) [-428.855] (-426.163) -- 0:01:34
11000 -- (-426.963) (-421.375) (-420.270) [-418.975] * [-423.317] (-425.698) (-422.353) (-422.441) -- 0:01:29
11500 -- [-419.671] (-422.827) (-438.350) (-422.760) * (-413.517) [-421.887] (-421.319) (-427.246) -- 0:01:25
12000 -- (-431.202) [-428.224] (-427.565) (-426.760) * [-413.201] (-423.423) (-428.493) (-424.215) -- 0:01:22
12500 -- (-421.806) (-419.426) (-425.687) [-425.932] * [-412.808] (-424.036) (-421.973) (-418.677) -- 0:01:19
13000 -- (-426.683) (-423.713) [-422.952] (-426.464) * (-412.664) (-427.221) (-422.448) [-421.368] -- 0:01:15
13500 -- (-428.321) [-414.446] (-433.022) (-421.371) * (-413.733) (-422.548) [-428.229] (-424.492) -- 0:01:13
14000 -- (-434.069) (-424.168) [-421.101] (-426.434) * (-412.603) (-426.951) [-426.917] (-424.872) -- 0:01:10
14500 -- (-427.295) [-423.221] (-418.876) (-426.173) * (-413.310) [-421.329] (-427.521) (-426.090) -- 0:01:07
15000 -- [-419.443] (-418.265) (-420.655) (-422.956) * [-411.928] (-423.947) (-446.141) (-423.893) -- 0:01:05
Average standard deviation of split frequencies: 0.049105
15500 -- (-422.991) (-423.735) [-422.942] (-423.823) * (-414.398) (-422.090) (-431.711) [-422.401] -- 0:01:03
16000 -- (-420.834) (-428.302) (-421.686) [-425.532] * (-413.176) (-423.936) (-427.887) [-426.928] -- 0:01:01
16500 -- (-427.620) (-423.601) (-425.678) [-424.568] * [-413.631] (-421.653) (-416.897) (-428.677) -- 0:00:59
17000 -- [-417.266] (-429.409) (-420.358) (-439.492) * (-417.057) [-422.643] (-416.019) (-425.307) -- 0:00:57
17500 -- (-418.904) [-425.103] (-421.033) (-431.133) * (-415.126) (-421.581) (-415.323) [-429.575] -- 0:01:52
18000 -- (-422.718) [-422.509] (-433.792) (-424.191) * (-414.083) [-426.577] (-415.361) (-423.581) -- 0:01:49
18500 -- (-427.053) (-419.378) [-422.463] (-417.806) * (-414.228) [-426.012] (-413.184) (-414.746) -- 0:01:46
19000 -- (-426.420) [-426.184] (-419.509) (-413.167) * (-413.224) (-419.837) [-412.730] (-413.954) -- 0:01:43
19500 -- (-425.859) [-417.802] (-420.260) (-412.170) * (-412.923) (-417.824) [-412.235] (-412.887) -- 0:01:40
20000 -- (-433.605) [-422.028] (-424.353) (-416.032) * [-414.326] (-421.013) (-417.385) (-413.364) -- 0:01:38
Average standard deviation of split frequencies: 0.042018
20500 -- (-426.009) (-422.278) [-426.399] (-415.468) * (-415.606) (-429.854) (-414.962) [-412.492] -- 0:01:35
21000 -- (-420.271) [-416.236] (-425.242) (-418.195) * (-415.669) (-425.200) (-413.403) [-413.005] -- 0:01:33
21500 -- (-432.686) (-416.727) [-423.896] (-417.376) * (-414.709) (-439.782) (-413.213) [-413.157] -- 0:01:31
22000 -- (-427.277) [-420.369] (-420.386) (-420.247) * [-413.594] (-418.832) (-413.180) (-412.356) -- 0:01:28
22500 -- [-421.476] (-420.698) (-430.318) (-415.376) * [-414.585] (-417.814) (-415.218) (-416.980) -- 0:01:26
23000 -- (-412.407) (-423.629) [-425.302] (-419.680) * (-413.719) [-412.699] (-413.454) (-415.165) -- 0:01:24
23500 -- (-414.926) (-422.908) [-428.751] (-415.826) * (-416.161) [-415.941] (-413.313) (-413.548) -- 0:01:23
24000 -- (-420.152) [-420.163] (-434.953) (-413.979) * (-414.232) (-413.778) (-412.360) [-414.090] -- 0:01:21
24500 -- [-418.632] (-424.375) (-441.050) (-413.020) * [-413.913] (-413.505) (-414.549) (-413.796) -- 0:01:19
25000 -- (-416.277) [-422.633] (-432.786) (-412.269) * (-417.822) (-414.165) [-414.782] (-414.690) -- 0:01:18
Average standard deviation of split frequencies: 0.039888
25500 -- (-415.993) (-426.682) (-428.800) [-415.513] * (-417.577) (-412.720) (-414.405) [-412.159] -- 0:01:16
26000 -- [-414.652] (-421.586) (-421.913) (-414.890) * (-415.451) (-412.634) [-416.354] (-414.757) -- 0:01:14
26500 -- (-412.766) (-427.876) [-413.171] (-415.803) * (-413.599) [-412.399] (-413.237) (-412.529) -- 0:01:13
27000 -- [-411.975] (-425.681) (-418.904) (-413.715) * (-414.740) (-417.273) (-415.471) [-413.279] -- 0:01:12
27500 -- (-416.442) (-427.984) [-412.197] (-414.211) * (-416.759) [-412.771] (-411.824) (-414.725) -- 0:01:10
28000 -- (-412.739) (-430.138) (-412.535) [-411.910] * (-415.238) (-413.714) [-411.871] (-412.198) -- 0:01:09
28500 -- (-412.231) (-418.842) [-416.321] (-412.982) * [-413.415] (-412.787) (-411.793) (-412.483) -- 0:01:08
29000 -- (-415.083) (-420.331) (-412.362) [-417.469] * [-414.222] (-414.316) (-412.420) (-414.362) -- 0:01:06
29500 -- [-417.206] (-424.606) (-414.126) (-416.918) * (-414.425) (-415.061) (-413.113) [-412.948] -- 0:01:05
30000 -- (-415.345) (-430.006) (-413.312) [-413.331] * (-414.699) (-412.782) (-414.358) [-413.567] -- 0:01:04
Average standard deviation of split frequencies: 0.035136
30500 -- (-415.760) (-427.609) (-415.710) [-413.179] * (-418.531) [-412.952] (-415.341) (-413.184) -- 0:01:03
31000 -- (-416.744) (-421.934) (-415.177) [-413.119] * (-415.505) (-412.473) (-413.904) [-413.040] -- 0:01:02
31500 -- (-414.493) (-423.718) [-413.597] (-413.750) * (-413.367) (-412.502) (-417.209) [-412.577] -- 0:01:01
32000 -- (-415.255) [-425.418] (-413.859) (-413.018) * (-416.214) [-417.142] (-412.454) (-412.207) -- 0:01:00
32500 -- (-413.095) (-421.446) [-413.943] (-415.848) * (-416.736) (-416.823) [-413.799] (-412.560) -- 0:00:59
33000 -- (-414.106) [-425.507] (-417.494) (-412.033) * (-414.091) [-413.665] (-413.818) (-412.631) -- 0:01:27
33500 -- (-411.779) [-423.020] (-413.122) (-416.113) * (-412.194) (-412.754) [-416.034] (-411.846) -- 0:01:26
34000 -- (-412.805) (-427.278) (-413.445) [-415.222] * (-414.126) (-413.761) (-416.872) [-415.703] -- 0:01:25
34500 -- (-416.031) [-419.009] (-413.225) (-412.453) * (-416.760) (-413.259) (-416.411) [-411.738] -- 0:01:23
35000 -- (-414.139) [-425.043] (-415.625) (-415.306) * (-415.318) (-412.755) (-416.298) [-415.329] -- 0:01:22
Average standard deviation of split frequencies: 0.031281
35500 -- [-412.350] (-420.978) (-412.923) (-415.394) * (-416.636) (-413.239) (-415.663) [-415.684] -- 0:01:21
36000 -- (-413.972) (-431.508) (-414.929) [-417.665] * (-416.751) (-419.599) [-413.845] (-414.163) -- 0:01:20
36500 -- (-416.330) [-420.474] (-413.560) (-416.741) * (-414.087) (-418.566) (-414.770) [-412.565] -- 0:01:19
37000 -- [-414.142] (-421.465) (-414.681) (-414.472) * (-416.625) [-417.974] (-412.567) (-412.676) -- 0:01:18
37500 -- (-411.745) (-422.732) (-413.649) [-413.077] * (-414.387) [-413.910] (-412.780) (-413.596) -- 0:01:17
38000 -- (-416.295) (-421.201) [-413.852] (-416.592) * (-415.782) [-416.185] (-416.502) (-414.597) -- 0:01:15
38500 -- (-412.915) (-422.867) [-414.953] (-412.004) * [-416.047] (-415.427) (-414.004) (-413.215) -- 0:01:14
39000 -- (-413.484) (-420.074) [-413.768] (-417.453) * [-413.325] (-413.740) (-418.972) (-414.067) -- 0:01:13
39500 -- [-412.099] (-434.145) (-412.465) (-414.123) * (-413.330) (-413.855) (-413.401) [-417.088] -- 0:01:12
40000 -- (-412.366) (-423.646) (-414.546) [-414.953] * (-414.382) (-412.776) [-413.786] (-415.161) -- 0:01:12
Average standard deviation of split frequencies: 0.027692
40500 -- (-413.464) (-433.290) (-412.094) [-415.483] * (-413.614) (-414.853) [-413.742] (-415.558) -- 0:01:11
41000 -- (-412.242) (-425.817) [-412.895] (-414.169) * (-412.072) [-411.672] (-414.578) (-413.808) -- 0:01:10
41500 -- (-415.453) (-430.240) (-412.711) [-414.003] * (-414.214) [-412.373] (-414.651) (-413.115) -- 0:01:09
42000 -- [-413.819] (-434.875) (-413.971) (-413.217) * [-412.434] (-414.041) (-413.021) (-414.003) -- 0:01:08
42500 -- (-413.733) (-425.387) [-412.324] (-412.236) * [-412.062] (-416.165) (-412.778) (-414.520) -- 0:01:07
43000 -- (-414.325) (-424.325) [-413.758] (-413.405) * [-413.750] (-413.644) (-412.504) (-418.546) -- 0:01:06
43500 -- (-413.121) [-420.301] (-414.055) (-414.806) * [-421.670] (-415.214) (-416.700) (-418.491) -- 0:01:05
44000 -- (-412.376) (-422.887) [-414.634] (-413.680) * (-414.343) (-414.188) [-413.613] (-412.250) -- 0:01:05
44500 -- (-415.361) (-414.635) [-415.156] (-413.126) * (-413.195) (-412.819) (-413.372) [-412.580] -- 0:01:04
45000 -- (-414.230) [-416.075] (-415.786) (-415.694) * [-412.707] (-414.746) (-413.829) (-415.360) -- 0:01:03
Average standard deviation of split frequencies: 0.020008
45500 -- [-412.284] (-412.708) (-414.219) (-413.103) * (-413.655) (-414.884) (-413.681) [-414.616] -- 0:01:02
46000 -- [-413.491] (-418.676) (-414.446) (-413.309) * (-419.628) (-413.052) [-413.833] (-412.752) -- 0:01:02
46500 -- (-416.009) (-412.907) (-415.563) [-413.933] * (-415.971) [-415.440] (-414.396) (-413.646) -- 0:01:01
47000 -- (-414.418) (-412.667) (-413.422) [-413.198] * (-415.274) [-414.040] (-412.680) (-414.068) -- 0:01:00
47500 -- (-414.120) [-413.187] (-412.592) (-413.052) * [-414.811] (-412.114) (-412.176) (-421.779) -- 0:01:00
48000 -- (-412.149) [-414.455] (-416.936) (-417.492) * (-414.046) (-412.151) [-417.758] (-415.341) -- 0:00:59
48500 -- (-412.202) (-413.379) [-413.997] (-413.369) * (-414.056) [-412.259] (-413.640) (-415.699) -- 0:01:18
49000 -- [-418.168] (-413.037) (-413.147) (-412.704) * [-416.205] (-413.676) (-413.440) (-416.717) -- 0:01:17
49500 -- (-413.571) (-413.061) (-412.807) [-413.748] * (-412.996) (-417.047) [-412.953] (-414.348) -- 0:01:16
50000 -- [-414.083] (-415.938) (-413.972) (-412.224) * (-412.788) [-411.653] (-413.882) (-414.099) -- 0:01:16
Average standard deviation of split frequencies: 0.018143
50500 -- (-414.696) (-414.375) (-412.222) [-417.413] * [-412.566] (-415.115) (-414.397) (-414.572) -- 0:01:15
51000 -- (-412.848) (-415.430) (-412.745) [-411.826] * (-412.936) (-413.258) (-414.275) [-413.999] -- 0:01:14
51500 -- (-412.551) (-413.478) [-413.166] (-413.393) * (-414.307) [-415.680] (-417.128) (-412.139) -- 0:01:13
52000 -- (-412.387) [-414.404] (-416.078) (-412.494) * [-417.025] (-415.089) (-412.599) (-411.769) -- 0:01:12
52500 -- (-414.272) (-414.277) (-413.079) [-414.440] * (-413.695) [-416.428] (-413.497) (-417.039) -- 0:01:12
53000 -- (-413.074) (-414.007) [-414.864] (-413.723) * (-414.603) (-416.007) [-413.718] (-412.421) -- 0:01:11
53500 -- (-416.544) [-413.727] (-414.121) (-414.320) * [-412.690] (-415.154) (-417.104) (-414.368) -- 0:01:10
54000 -- [-417.014] (-413.527) (-415.460) (-413.335) * [-412.518] (-412.477) (-414.677) (-413.241) -- 0:01:10
54500 -- (-417.359) (-413.214) [-412.649] (-415.017) * (-411.935) (-417.151) [-414.948] (-416.751) -- 0:01:09
55000 -- (-414.313) (-414.518) (-415.993) [-414.088] * (-412.492) [-417.527] (-412.887) (-414.562) -- 0:01:08
Average standard deviation of split frequencies: 0.022596
55500 -- (-412.620) (-413.093) [-412.434] (-414.833) * (-412.781) (-414.572) (-412.533) [-413.491] -- 0:01:08
56000 -- (-411.850) (-411.592) (-414.470) [-413.464] * (-412.560) [-413.181] (-413.429) (-414.566) -- 0:01:07
56500 -- (-417.843) (-411.691) [-412.826] (-417.203) * [-413.041] (-412.962) (-414.099) (-416.378) -- 0:01:06
57000 -- [-414.447] (-414.621) (-414.262) (-414.286) * [-414.526] (-414.667) (-413.773) (-416.717) -- 0:01:06
57500 -- (-415.121) (-413.361) (-416.532) [-412.415] * (-415.142) [-413.897] (-416.533) (-415.744) -- 0:01:05
58000 -- (-414.427) [-415.046] (-412.590) (-412.393) * (-414.388) [-415.319] (-414.774) (-413.857) -- 0:01:04
58500 -- [-417.643] (-413.783) (-415.863) (-414.243) * (-413.654) (-415.776) [-414.217] (-413.789) -- 0:01:04
59000 -- [-414.538] (-415.082) (-412.670) (-413.754) * (-412.940) (-415.122) (-412.902) [-412.878] -- 0:01:03
59500 -- (-413.392) (-415.360) [-413.464] (-420.387) * (-413.632) (-413.491) (-412.740) [-412.926] -- 0:01:03
60000 -- [-413.115] (-412.900) (-414.034) (-414.341) * (-416.203) [-414.834] (-412.803) (-414.023) -- 0:01:02
Average standard deviation of split frequencies: 0.024225
60500 -- [-412.715] (-418.093) (-416.761) (-421.391) * (-415.285) (-413.166) [-413.865] (-413.776) -- 0:01:02
61000 -- [-413.597] (-417.152) (-412.906) (-412.219) * (-413.333) (-412.773) (-414.757) [-416.024] -- 0:01:01
61500 -- (-414.177) (-416.247) (-413.994) [-415.538] * [-413.378] (-417.311) (-414.175) (-412.915) -- 0:01:01
62000 -- [-413.852] (-414.989) (-414.828) (-413.958) * (-414.260) (-414.404) (-412.585) [-414.280] -- 0:01:00
62500 -- (-413.697) [-414.680] (-414.226) (-415.462) * (-412.645) [-414.319] (-413.256) (-416.202) -- 0:01:00
63000 -- (-412.729) [-415.451] (-416.939) (-413.619) * (-414.122) (-412.014) (-418.232) [-412.384] -- 0:00:59
63500 -- (-413.902) (-414.801) (-412.860) [-414.027] * (-417.171) (-416.143) [-416.058] (-412.827) -- 0:00:58
64000 -- (-416.313) [-412.384] (-415.996) (-412.719) * (-416.438) (-413.534) [-414.473] (-414.790) -- 0:01:13
64500 -- [-416.102] (-415.316) (-412.222) (-413.102) * (-413.386) (-416.926) [-415.546] (-414.593) -- 0:01:12
65000 -- (-421.102) (-414.048) [-412.869] (-415.165) * (-414.000) [-417.752] (-412.288) (-413.735) -- 0:01:11
Average standard deviation of split frequencies: 0.017856
65500 -- (-417.774) (-415.217) (-412.652) [-412.821] * [-412.462] (-418.319) (-413.936) (-412.057) -- 0:01:11
66000 -- (-411.722) (-413.012) [-415.049] (-411.880) * (-416.175) (-421.133) [-413.630] (-412.540) -- 0:01:10
66500 -- (-412.488) (-415.427) (-418.393) [-413.716] * (-415.500) [-415.005] (-414.603) (-412.824) -- 0:01:10
67000 -- (-413.719) (-412.696) [-412.566] (-414.345) * [-412.817] (-414.255) (-415.827) (-415.323) -- 0:01:09
67500 -- [-411.717] (-413.308) (-414.194) (-413.693) * (-413.716) (-412.674) [-412.670] (-416.000) -- 0:01:09
68000 -- (-413.405) (-414.005) (-412.287) [-416.217] * (-417.451) (-412.732) (-415.076) [-412.019] -- 0:01:08
68500 -- (-412.267) (-413.525) (-412.875) [-413.695] * [-413.265] (-414.544) (-412.561) (-414.367) -- 0:01:07
69000 -- [-413.496] (-416.298) (-413.096) (-415.049) * (-414.979) (-414.365) [-414.503] (-415.610) -- 0:01:07
69500 -- (-412.698) (-411.947) [-412.519] (-418.615) * [-414.565] (-413.529) (-412.049) (-414.818) -- 0:01:06
70000 -- (-414.348) (-413.643) [-412.629] (-412.673) * [-412.287] (-413.144) (-416.496) (-414.983) -- 0:01:06
Average standard deviation of split frequencies: 0.026016
70500 -- (-416.027) (-413.682) [-413.694] (-412.677) * (-415.863) (-414.869) (-413.948) [-413.286] -- 0:01:05
71000 -- (-413.720) [-412.158] (-413.174) (-414.379) * [-413.634] (-414.381) (-412.486) (-413.251) -- 0:01:05
71500 -- (-412.700) (-414.363) [-412.025] (-414.485) * (-414.267) [-414.221] (-414.055) (-413.297) -- 0:01:04
72000 -- (-413.995) [-415.586] (-411.865) (-413.418) * [-412.588] (-414.470) (-414.229) (-415.241) -- 0:01:04
72500 -- (-414.292) (-412.310) (-416.654) [-412.894] * [-412.495] (-416.185) (-418.383) (-415.822) -- 0:01:03
73000 -- (-415.297) [-411.971] (-414.043) (-415.187) * (-415.449) (-414.161) (-414.474) [-416.383] -- 0:01:03
73500 -- [-414.314] (-416.301) (-414.232) (-412.575) * [-411.718] (-414.199) (-415.859) (-414.886) -- 0:01:03
74000 -- [-414.327] (-416.053) (-415.685) (-414.654) * (-414.796) [-413.071] (-414.853) (-411.896) -- 0:01:02
74500 -- (-415.561) (-416.360) [-415.439] (-414.979) * [-413.601] (-415.155) (-422.492) (-414.214) -- 0:01:02
75000 -- [-414.757] (-416.188) (-415.274) (-414.527) * (-412.130) (-415.051) [-415.636] (-414.175) -- 0:01:01
Average standard deviation of split frequencies: 0.023505
75500 -- (-412.804) (-414.919) (-413.286) [-417.047] * (-413.201) (-413.746) [-413.598] (-411.956) -- 0:01:01
76000 -- [-414.410] (-413.288) (-412.705) (-416.161) * [-415.899] (-414.034) (-412.248) (-413.573) -- 0:01:00
76500 -- (-413.026) (-413.254) [-415.178] (-413.758) * (-412.364) (-415.322) (-421.827) [-412.792] -- 0:01:00
77000 -- (-413.057) [-413.526] (-412.482) (-413.881) * [-415.294] (-414.003) (-421.940) (-414.593) -- 0:00:59
77500 -- (-416.999) (-414.040) [-416.742] (-416.585) * [-415.685] (-414.168) (-412.998) (-413.438) -- 0:00:59
78000 -- (-414.943) (-415.223) [-414.202] (-415.847) * (-413.291) [-412.171] (-413.333) (-413.732) -- 0:00:59
78500 -- (-413.591) (-414.802) (-413.240) [-413.681] * (-413.452) [-411.944] (-412.270) (-416.062) -- 0:00:58
79000 -- (-413.700) [-416.361] (-413.638) (-413.314) * (-412.347) (-414.238) (-415.357) [-417.235] -- 0:00:58
79500 -- (-412.603) (-414.193) [-413.321] (-413.315) * (-412.543) [-414.262] (-416.670) (-416.222) -- 0:00:57
80000 -- [-413.473] (-413.997) (-412.960) (-414.000) * (-412.799) (-415.056) [-415.090] (-413.881) -- 0:00:57
Average standard deviation of split frequencies: 0.024606
80500 -- (-412.303) (-415.973) [-412.413] (-420.635) * (-413.435) (-417.050) [-412.529] (-413.217) -- 0:00:57
81000 -- (-413.671) (-413.747) (-413.552) [-418.228] * [-416.583] (-414.246) (-412.773) (-412.495) -- 0:01:08
81500 -- [-413.399] (-415.154) (-413.740) (-413.928) * [-413.963] (-414.420) (-414.794) (-413.084) -- 0:01:07
82000 -- (-414.169) [-413.510] (-413.526) (-414.297) * (-417.241) [-418.321] (-413.381) (-412.579) -- 0:01:07
82500 -- (-414.632) [-413.653] (-414.652) (-412.281) * [-413.183] (-414.984) (-413.965) (-414.930) -- 0:01:06
83000 -- [-413.095] (-415.054) (-412.727) (-412.709) * [-417.282] (-420.970) (-411.632) (-413.206) -- 0:01:06
83500 -- (-412.534) [-413.095] (-413.987) (-412.292) * (-416.122) (-414.259) [-414.065] (-412.999) -- 0:01:05
84000 -- (-417.778) (-416.585) [-414.353] (-413.976) * [-413.079] (-412.459) (-415.097) (-414.343) -- 0:01:05
84500 -- (-412.155) (-416.286) (-413.960) [-413.795] * (-413.740) (-413.618) [-412.637] (-414.509) -- 0:01:05
85000 -- (-411.758) [-415.101] (-413.827) (-413.667) * (-417.656) [-414.007] (-412.634) (-412.959) -- 0:01:04
Average standard deviation of split frequencies: 0.024118
85500 -- (-421.692) (-415.802) [-414.463] (-414.722) * (-415.383) [-413.217] (-414.694) (-412.798) -- 0:01:04
86000 -- [-413.525] (-417.748) (-413.103) (-415.210) * (-416.628) (-415.001) [-413.444] (-412.033) -- 0:01:03
86500 -- (-418.103) (-414.398) [-413.875] (-415.983) * (-415.749) [-412.125] (-412.876) (-416.941) -- 0:01:03
87000 -- (-417.799) [-416.455] (-414.662) (-415.098) * (-417.370) (-415.795) (-414.655) [-416.507] -- 0:01:02
87500 -- (-419.776) (-415.731) [-416.031] (-413.856) * (-419.830) [-416.012] (-415.197) (-412.687) -- 0:01:02
88000 -- (-413.186) (-414.299) (-412.423) [-413.657] * (-415.210) (-414.537) [-414.925] (-414.187) -- 0:01:02
88500 -- (-412.551) (-414.893) [-415.173] (-415.832) * (-415.290) (-413.482) (-413.903) [-416.668] -- 0:01:01
89000 -- (-415.911) (-412.912) [-414.405] (-413.861) * [-414.199] (-412.188) (-414.623) (-413.781) -- 0:01:01
89500 -- (-415.171) [-416.969] (-415.540) (-419.206) * [-412.548] (-418.268) (-413.391) (-414.871) -- 0:01:01
90000 -- (-414.293) (-413.844) [-412.391] (-417.967) * (-416.485) [-412.652] (-412.998) (-413.581) -- 0:01:00
Average standard deviation of split frequencies: 0.021317
90500 -- [-414.056] (-412.688) (-414.230) (-413.444) * [-413.249] (-413.170) (-413.352) (-412.991) -- 0:01:00
91000 -- (-415.156) [-413.052] (-413.627) (-413.216) * (-417.760) (-413.314) [-413.007] (-414.235) -- 0:00:59
91500 -- (-415.548) (-413.935) (-413.849) [-418.544] * (-414.094) (-412.048) [-414.086] (-413.427) -- 0:00:59
92000 -- (-417.108) (-419.449) [-413.745] (-415.511) * (-414.594) (-412.719) [-415.024] (-414.253) -- 0:00:59
92500 -- [-413.826] (-413.388) (-412.232) (-413.797) * [-411.874] (-413.369) (-418.387) (-413.808) -- 0:00:58
93000 -- (-413.339) (-412.503) (-412.138) [-412.744] * [-414.620] (-412.416) (-413.718) (-412.449) -- 0:00:58
93500 -- (-414.941) [-411.747] (-412.480) (-412.623) * (-414.976) (-412.744) (-411.976) [-416.046] -- 0:00:58
94000 -- [-412.353] (-414.429) (-412.024) (-412.468) * [-414.511] (-415.933) (-415.413) (-413.347) -- 0:00:57
94500 -- [-412.777] (-415.379) (-412.121) (-414.130) * (-413.004) [-412.784] (-416.524) (-420.854) -- 0:00:57
95000 -- [-414.986] (-416.672) (-414.017) (-416.036) * (-416.750) (-416.228) (-417.567) [-415.342] -- 0:00:57
Average standard deviation of split frequencies: 0.023777
95500 -- [-416.728] (-416.067) (-412.752) (-413.861) * (-413.407) (-412.481) (-415.073) [-415.453] -- 0:00:56
96000 -- (-413.913) (-417.891) (-412.782) [-414.259] * (-415.708) (-413.944) (-416.641) [-414.450] -- 0:00:56
96500 -- [-414.408] (-412.335) (-412.536) (-414.390) * (-417.098) (-417.314) [-411.804] (-414.023) -- 0:00:56
97000 -- (-413.301) [-412.263] (-411.788) (-412.185) * [-414.798] (-416.337) (-417.668) (-413.712) -- 0:00:55
97500 -- (-413.697) [-412.534] (-414.497) (-414.183) * [-414.538] (-412.905) (-412.801) (-418.403) -- 0:00:55
98000 -- (-413.351) (-414.030) (-417.403) [-414.809] * (-412.366) (-414.210) [-413.021] (-414.998) -- 0:01:04
98500 -- (-413.242) (-414.756) (-413.318) [-412.569] * (-414.685) (-413.369) (-412.296) [-414.580] -- 0:01:04
99000 -- [-414.942] (-418.347) (-415.193) (-415.176) * (-414.657) (-412.534) [-414.011] (-414.874) -- 0:01:03
99500 -- [-415.033] (-414.007) (-414.395) (-412.337) * (-414.338) (-412.138) [-413.475] (-416.341) -- 0:01:03
100000 -- [-414.800] (-413.737) (-416.334) (-414.664) * [-417.171] (-412.527) (-414.206) (-414.033) -- 0:01:02
Average standard deviation of split frequencies: 0.022634
100500 -- (-413.030) [-415.919] (-416.103) (-414.609) * (-411.853) (-412.082) (-420.171) [-412.960] -- 0:01:02
101000 -- (-413.664) (-415.159) (-414.093) [-413.246] * (-412.557) (-411.971) (-415.189) [-414.914] -- 0:01:02
101500 -- [-419.557] (-413.704) (-414.861) (-416.355) * (-413.586) (-411.963) (-412.231) [-414.446] -- 0:01:01
102000 -- (-417.801) [-412.025] (-415.753) (-415.372) * (-414.441) (-411.963) [-413.257] (-416.709) -- 0:01:01
102500 -- [-415.832] (-414.793) (-414.164) (-416.068) * (-417.183) [-411.998] (-412.920) (-413.966) -- 0:01:01
103000 -- (-416.413) (-413.430) (-412.324) [-412.180] * [-416.044] (-414.131) (-414.322) (-415.217) -- 0:01:00
103500 -- [-416.879] (-414.331) (-415.385) (-417.719) * [-417.074] (-414.921) (-412.818) (-415.568) -- 0:01:00
104000 -- [-411.919] (-413.358) (-413.872) (-418.225) * (-412.616) [-413.832] (-412.335) (-413.189) -- 0:01:00
104500 -- (-414.060) (-414.177) [-413.697] (-421.916) * (-416.108) [-412.105] (-413.858) (-413.175) -- 0:00:59
105000 -- (-413.199) [-413.472] (-412.036) (-416.286) * (-415.974) (-414.655) (-412.225) [-414.951] -- 0:00:59
Average standard deviation of split frequencies: 0.018456
105500 -- (-413.387) (-413.955) [-413.985] (-413.767) * (-414.414) (-415.077) (-414.122) [-412.219] -- 0:00:59
106000 -- (-416.709) (-412.113) (-415.327) [-413.839] * [-418.943] (-421.849) (-415.688) (-413.326) -- 0:00:59
106500 -- (-413.887) (-413.354) (-414.721) [-415.643] * (-417.772) [-413.783] (-415.720) (-412.580) -- 0:00:58
107000 -- [-413.727] (-415.089) (-415.885) (-423.021) * (-414.113) (-416.556) (-414.310) [-414.181] -- 0:00:58
107500 -- (-412.233) (-415.005) [-417.301] (-422.344) * (-414.063) (-412.757) [-414.708] (-414.569) -- 0:00:58
108000 -- [-417.489] (-416.201) (-417.472) (-420.117) * [-413.708] (-414.181) (-414.748) (-413.860) -- 0:00:57
108500 -- (-413.067) [-413.286] (-415.760) (-414.232) * (-415.748) [-415.887] (-415.596) (-411.938) -- 0:00:57
109000 -- (-413.301) [-416.203] (-419.043) (-413.694) * (-412.599) (-414.523) (-416.696) [-413.052] -- 0:00:57
109500 -- [-414.190] (-414.916) (-416.160) (-414.581) * (-412.784) (-412.166) [-412.229] (-415.195) -- 0:00:56
110000 -- (-415.816) [-412.262] (-416.165) (-414.365) * (-412.946) [-411.745] (-413.910) (-415.257) -- 0:00:56
Average standard deviation of split frequencies: 0.014696
110500 -- (-416.856) (-413.162) (-413.235) [-413.715] * (-415.405) (-412.753) (-415.668) [-414.997] -- 0:00:56
111000 -- (-415.700) (-413.184) (-414.204) [-413.586] * (-413.028) [-412.280] (-414.690) (-414.787) -- 0:00:56
111500 -- [-414.153] (-415.268) (-415.662) (-414.346) * (-412.518) (-413.085) [-416.833] (-417.177) -- 0:00:55
112000 -- (-412.598) [-414.813] (-415.359) (-412.182) * (-416.252) (-413.690) (-414.939) [-413.741] -- 0:00:55
112500 -- (-413.817) (-414.809) [-417.270] (-412.334) * [-419.069] (-412.372) (-415.683) (-418.031) -- 0:00:55
113000 -- (-413.480) [-412.829] (-413.712) (-413.980) * (-414.629) (-414.448) [-414.102] (-412.355) -- 0:00:54
113500 -- (-412.545) (-412.767) (-412.680) [-414.568] * (-420.018) [-420.486] (-413.558) (-414.462) -- 0:00:54
114000 -- (-418.832) [-412.354] (-416.159) (-413.406) * (-415.162) (-414.052) [-413.761] (-423.568) -- 0:00:54
114500 -- (-415.003) (-414.267) (-414.144) [-415.931] * (-414.696) [-413.713] (-416.914) (-421.880) -- 0:01:01
115000 -- (-413.696) (-412.179) (-415.212) [-415.615] * [-411.988] (-414.214) (-416.088) (-413.222) -- 0:01:01
Average standard deviation of split frequencies: 0.014330
115500 -- (-415.653) (-413.112) (-413.666) [-417.157] * (-413.068) (-412.069) [-412.703] (-414.669) -- 0:01:01
116000 -- (-413.959) [-415.145] (-412.475) (-415.229) * [-413.118] (-412.939) (-415.293) (-413.660) -- 0:01:00
116500 -- [-414.608] (-415.043) (-413.222) (-414.829) * (-413.503) (-414.289) (-416.667) [-412.334] -- 0:01:00
117000 -- [-414.275] (-416.587) (-413.985) (-414.725) * (-416.781) (-413.700) [-414.529] (-413.008) -- 0:01:00
117500 -- (-412.373) (-413.085) (-414.202) [-415.641] * [-413.417] (-416.117) (-415.016) (-419.838) -- 0:01:00
118000 -- (-412.693) (-416.526) [-414.062] (-415.232) * (-413.276) (-415.613) [-415.705] (-416.912) -- 0:00:59
118500 -- (-412.338) (-414.275) [-414.696] (-421.643) * [-412.960] (-414.716) (-413.894) (-415.700) -- 0:00:59
119000 -- [-412.334] (-414.454) (-417.205) (-416.300) * (-413.105) (-412.300) (-417.808) [-416.761] -- 0:00:59
119500 -- [-414.328] (-415.184) (-413.296) (-412.387) * [-411.959] (-416.819) (-417.527) (-416.492) -- 0:00:58
120000 -- (-416.214) (-413.133) (-413.568) [-414.064] * (-412.135) (-416.034) (-416.338) [-414.147] -- 0:00:58
Average standard deviation of split frequencies: 0.017146
120500 -- (-419.480) (-416.644) [-413.827] (-413.957) * [-412.919] (-418.353) (-415.349) (-418.326) -- 0:00:58
121000 -- (-414.564) (-413.953) [-412.903] (-412.570) * (-414.562) (-415.892) (-413.874) [-413.741] -- 0:00:58
121500 -- (-415.592) (-413.475) (-417.014) [-413.451] * (-421.376) [-415.966] (-416.324) (-415.563) -- 0:00:57
122000 -- (-414.003) (-415.572) [-412.566] (-414.721) * (-414.615) (-413.818) [-416.201] (-414.446) -- 0:00:57
122500 -- (-413.356) (-415.505) (-413.541) [-415.412] * (-414.373) (-412.889) (-416.692) [-415.630] -- 0:00:57
123000 -- [-414.463] (-415.721) (-413.863) (-417.800) * [-412.463] (-412.505) (-412.466) (-412.960) -- 0:00:57
123500 -- (-412.725) (-413.548) [-413.635] (-412.791) * (-416.994) (-413.219) [-412.403] (-413.587) -- 0:00:56
124000 -- (-414.798) [-413.110] (-413.250) (-413.703) * (-421.784) (-416.185) (-413.602) [-412.874] -- 0:00:56
124500 -- (-413.074) [-411.761] (-413.961) (-412.473) * (-416.727) (-415.702) [-412.492] (-414.887) -- 0:00:56
125000 -- (-413.458) [-412.759] (-413.124) (-413.073) * (-413.172) (-414.450) (-412.724) [-413.320] -- 0:00:56
Average standard deviation of split frequencies: 0.017210
125500 -- (-413.521) (-414.652) [-414.808] (-413.013) * (-413.665) (-415.340) [-415.361] (-415.537) -- 0:00:55
126000 -- [-413.338] (-415.158) (-412.688) (-413.273) * (-416.566) (-415.055) (-413.581) [-413.942] -- 0:00:55
126500 -- [-414.041] (-414.511) (-412.266) (-412.876) * (-419.396) (-411.829) [-413.211] (-413.981) -- 0:00:55
127000 -- (-413.562) (-413.171) [-413.707] (-413.035) * (-416.229) (-412.554) (-413.682) [-413.899] -- 0:00:54
127500 -- (-413.306) (-416.473) (-416.135) [-413.072] * [-415.128] (-413.364) (-416.027) (-415.138) -- 0:00:54
128000 -- (-415.821) (-412.926) [-415.773] (-414.888) * (-412.804) (-415.960) [-413.909] (-416.443) -- 0:00:54
128500 -- [-413.722] (-414.459) (-414.034) (-416.830) * (-414.221) [-412.990] (-416.171) (-416.204) -- 0:00:54
129000 -- [-413.474] (-414.116) (-415.506) (-415.299) * (-413.858) [-413.528] (-414.095) (-413.806) -- 0:00:54
129500 -- [-416.433] (-417.584) (-413.593) (-413.133) * (-413.447) (-415.562) [-411.895] (-413.369) -- 0:00:53
130000 -- (-417.371) (-411.759) [-413.753] (-415.307) * [-416.265] (-413.869) (-412.748) (-413.663) -- 0:00:53
Average standard deviation of split frequencies: 0.015633
130500 -- (-417.747) (-413.460) [-412.924] (-413.707) * (-417.336) (-412.891) [-414.869] (-411.953) -- 0:00:53
131000 -- (-414.582) (-412.356) [-413.725] (-413.538) * (-417.434) [-412.683] (-413.943) (-413.481) -- 0:00:53
131500 -- (-417.197) [-414.686] (-417.184) (-414.112) * (-413.297) (-413.839) (-412.560) [-413.228] -- 0:00:52
132000 -- (-414.241) (-412.104) (-414.552) [-414.685] * (-416.499) (-413.207) (-413.851) [-413.152] -- 0:00:59
132500 -- [-413.060] (-416.512) (-413.646) (-412.042) * [-414.124] (-412.796) (-417.741) (-413.153) -- 0:00:58
133000 -- [-413.398] (-415.227) (-413.510) (-418.076) * [-411.876] (-414.235) (-414.776) (-415.510) -- 0:00:58
133500 -- (-413.608) (-413.440) (-414.338) [-413.379] * [-415.890] (-415.429) (-416.374) (-414.918) -- 0:00:58
134000 -- [-413.269] (-413.192) (-415.761) (-413.559) * (-417.593) (-412.685) [-416.097] (-415.819) -- 0:00:58
134500 -- (-414.552) (-414.874) [-415.297] (-415.577) * (-413.685) [-411.885] (-412.733) (-413.503) -- 0:00:57
135000 -- (-416.721) [-413.960] (-413.785) (-412.297) * (-413.289) (-416.975) [-412.591] (-414.902) -- 0:00:57
Average standard deviation of split frequencies: 0.013457
135500 -- [-416.127] (-412.949) (-417.520) (-412.567) * [-415.013] (-416.668) (-413.541) (-414.119) -- 0:00:57
136000 -- (-414.846) (-413.526) (-419.437) [-418.897] * (-415.048) (-418.292) (-412.998) [-412.761] -- 0:00:57
136500 -- (-416.138) (-416.940) (-413.747) [-414.163] * (-414.741) (-415.245) (-412.465) [-415.395] -- 0:00:56
137000 -- (-416.674) [-412.484] (-414.145) (-412.321) * (-414.807) (-412.168) (-414.013) [-412.570] -- 0:00:56
137500 -- (-414.956) (-416.259) [-412.846] (-414.628) * (-413.755) (-414.501) [-412.860] (-415.230) -- 0:00:56
138000 -- (-413.108) (-415.031) [-412.816] (-415.831) * (-415.867) (-412.919) [-413.433] (-415.157) -- 0:00:56
138500 -- [-411.911] (-416.862) (-412.209) (-413.646) * (-417.318) (-412.134) (-420.750) [-413.393] -- 0:00:55
139000 -- (-412.774) (-416.809) [-414.305] (-416.702) * (-413.249) [-412.453] (-415.969) (-413.405) -- 0:00:55
139500 -- (-418.329) (-413.784) [-412.189] (-412.868) * [-412.739] (-411.982) (-412.390) (-413.846) -- 0:00:55
140000 -- (-414.386) [-411.768] (-413.578) (-416.202) * (-416.707) (-413.819) (-415.057) [-417.420] -- 0:00:55
Average standard deviation of split frequencies: 0.014588
140500 -- (-415.191) (-415.351) [-412.443] (-414.009) * (-412.861) (-418.130) [-414.476] (-416.368) -- 0:00:55
141000 -- (-413.532) (-414.654) [-415.697] (-414.105) * (-412.484) (-415.203) [-411.821] (-417.099) -- 0:00:54
141500 -- (-414.725) [-413.483] (-415.737) (-414.763) * (-413.530) (-416.214) [-413.083] (-415.091) -- 0:00:54
142000 -- [-413.927] (-414.902) (-421.680) (-413.247) * (-413.290) (-415.850) (-412.201) [-413.067] -- 0:00:54
142500 -- (-413.942) [-415.442] (-414.885) (-411.893) * (-413.428) (-414.360) [-412.973] (-419.686) -- 0:00:54
143000 -- (-413.930) (-413.821) (-415.873) [-413.138] * (-412.872) (-414.791) [-412.750] (-413.990) -- 0:00:53
143500 -- (-413.560) [-413.454] (-413.828) (-415.133) * (-412.791) (-416.018) [-413.922] (-412.758) -- 0:00:53
144000 -- [-413.823] (-414.276) (-412.936) (-414.679) * (-413.653) (-413.468) [-416.297] (-413.331) -- 0:00:53
144500 -- [-413.000] (-416.064) (-414.959) (-413.378) * (-416.020) (-414.064) [-414.673] (-414.463) -- 0:00:53
145000 -- (-412.168) (-414.720) (-418.352) [-412.684] * (-416.161) [-416.266] (-413.132) (-412.652) -- 0:00:53
Average standard deviation of split frequencies: 0.014625
145500 -- (-413.765) (-416.979) (-413.333) [-414.330] * [-416.832] (-412.907) (-415.555) (-415.068) -- 0:00:52
146000 -- [-412.202] (-413.657) (-412.400) (-415.698) * [-415.876] (-419.867) (-414.510) (-412.799) -- 0:00:52
146500 -- [-416.199] (-412.448) (-416.867) (-414.497) * [-413.158] (-414.029) (-412.794) (-413.732) -- 0:00:52
147000 -- (-417.985) [-415.388] (-412.054) (-417.184) * (-412.283) [-412.446] (-413.116) (-412.737) -- 0:00:52
147500 -- (-414.740) [-414.318] (-414.786) (-413.915) * (-413.223) (-413.285) [-413.305] (-414.511) -- 0:00:52
148000 -- [-413.055] (-412.225) (-415.692) (-414.764) * (-413.599) [-413.087] (-412.406) (-413.583) -- 0:00:51
148500 -- (-413.000) (-413.556) [-413.266] (-416.756) * [-412.784] (-412.457) (-413.893) (-413.282) -- 0:00:51
149000 -- (-412.688) [-414.633] (-414.401) (-412.700) * [-414.510] (-418.546) (-412.987) (-413.321) -- 0:00:57
149500 -- (-412.272) (-418.536) (-417.624) [-412.553] * (-414.594) (-420.594) [-413.511] (-412.439) -- 0:00:56
150000 -- (-412.583) (-420.925) (-414.581) [-412.758] * (-413.353) (-412.910) [-412.865] (-411.720) -- 0:00:56
Average standard deviation of split frequencies: 0.013732
150500 -- (-411.895) (-419.271) (-417.155) [-416.851] * [-414.443] (-412.257) (-415.779) (-412.483) -- 0:00:56
151000 -- [-412.420] (-420.645) (-412.759) (-416.658) * (-414.937) (-417.389) [-413.615] (-415.361) -- 0:00:56
151500 -- (-417.695) (-415.663) (-413.317) [-413.279] * [-412.905] (-413.078) (-413.233) (-412.634) -- 0:00:56
152000 -- (-413.113) (-419.392) [-415.682] (-414.970) * [-414.076] (-414.197) (-416.948) (-412.007) -- 0:00:55
152500 -- (-412.803) [-414.246] (-414.282) (-413.448) * (-416.103) [-416.337] (-415.513) (-413.255) -- 0:00:55
153000 -- [-414.520] (-413.250) (-413.097) (-413.898) * [-413.053] (-413.733) (-413.240) (-414.892) -- 0:00:55
153500 -- [-413.348] (-412.413) (-414.714) (-413.559) * [-412.514] (-414.142) (-413.147) (-413.689) -- 0:00:55
154000 -- [-414.971] (-414.720) (-415.476) (-413.658) * [-412.727] (-415.154) (-419.896) (-412.701) -- 0:00:54
154500 -- (-412.372) (-411.723) [-414.759] (-416.519) * (-413.185) [-412.420] (-412.198) (-412.985) -- 0:00:54
155000 -- (-412.745) (-411.835) [-413.781] (-413.737) * (-413.066) [-415.864] (-413.206) (-412.467) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
155500 -- (-413.017) (-413.545) [-412.352] (-413.616) * [-412.426] (-415.034) (-413.204) (-414.859) -- 0:00:54
156000 -- (-414.343) [-414.849] (-413.297) (-416.322) * (-411.995) [-415.258] (-414.521) (-413.055) -- 0:00:54
156500 -- (-415.477) (-414.404) (-414.266) [-412.416] * (-418.049) (-415.857) (-415.707) [-415.960] -- 0:00:53
157000 -- (-413.696) (-411.845) [-413.508] (-415.205) * [-412.362] (-415.088) (-414.221) (-413.190) -- 0:00:53
157500 -- (-413.437) (-416.075) [-413.079] (-415.818) * (-414.000) [-413.757] (-413.017) (-415.656) -- 0:00:53
158000 -- (-414.321) (-414.121) [-412.974] (-412.378) * (-418.858) (-412.671) [-413.078] (-413.404) -- 0:00:53
158500 -- [-413.278] (-416.387) (-415.344) (-418.653) * (-412.073) (-412.619) (-411.700) [-413.503] -- 0:00:53
159000 -- (-414.684) (-412.551) (-414.910) [-412.167] * (-413.858) (-415.955) [-413.197] (-412.231) -- 0:00:52
159500 -- (-414.139) (-412.552) [-417.390] (-412.946) * (-413.526) (-413.292) [-412.288] (-414.947) -- 0:00:52
160000 -- (-412.451) [-412.093] (-413.896) (-420.066) * [-415.485] (-414.127) (-414.574) (-414.999) -- 0:00:52
Average standard deviation of split frequencies: 0.011736
160500 -- (-414.076) (-413.887) [-412.786] (-411.953) * [-414.267] (-413.114) (-413.724) (-414.545) -- 0:00:52
161000 -- [-412.702] (-413.369) (-412.991) (-413.951) * (-415.947) (-413.145) [-415.793] (-413.655) -- 0:00:52
161500 -- (-411.974) (-413.466) (-412.626) [-413.580] * (-412.583) (-413.274) [-416.007] (-416.442) -- 0:00:51
162000 -- (-412.577) (-414.198) [-413.547] (-413.363) * (-412.307) (-416.351) [-414.736] (-416.407) -- 0:00:51
162500 -- [-415.254] (-413.827) (-416.407) (-413.842) * (-413.029) [-415.136] (-417.178) (-412.758) -- 0:00:51
163000 -- [-412.197] (-413.376) (-412.830) (-415.237) * (-417.446) (-415.066) (-413.938) [-413.651] -- 0:00:51
163500 -- (-413.973) (-413.065) (-416.271) [-415.565] * (-415.577) (-412.830) (-415.122) [-412.710] -- 0:00:51
164000 -- (-417.421) [-414.006] (-412.960) (-412.649) * [-413.944] (-412.542) (-412.031) (-412.147) -- 0:00:50
164500 -- (-413.540) (-412.499) [-415.914] (-412.178) * (-418.665) (-414.885) [-416.947] (-413.293) -- 0:00:50
165000 -- [-413.612] (-415.882) (-414.324) (-414.122) * (-416.186) (-413.709) (-414.013) [-412.356] -- 0:00:50
Average standard deviation of split frequencies: 0.013003
165500 -- (-413.001) (-417.597) [-411.975] (-413.246) * [-412.950] (-413.998) (-413.480) (-412.655) -- 0:00:50
166000 -- [-413.998] (-415.542) (-412.846) (-413.828) * (-412.985) [-419.341] (-413.574) (-414.236) -- 0:00:55
166500 -- (-415.481) (-413.114) (-414.177) [-413.965] * [-412.772] (-415.204) (-413.731) (-419.791) -- 0:00:55
167000 -- (-416.395) (-413.618) (-414.168) [-415.774] * (-414.088) (-413.733) [-412.813] (-416.938) -- 0:00:54
167500 -- (-413.358) (-411.769) (-415.248) [-413.809] * (-414.338) (-413.150) (-412.015) [-418.462] -- 0:00:54
168000 -- (-412.660) [-413.042] (-414.964) (-412.588) * [-413.648] (-418.021) (-411.953) (-412.574) -- 0:00:54
168500 -- (-416.791) (-412.613) (-412.369) [-412.453] * (-414.384) (-415.199) (-412.115) [-414.074] -- 0:00:54
169000 -- [-414.361] (-412.271) (-412.298) (-415.261) * (-416.509) [-414.500] (-413.432) (-414.919) -- 0:00:54
169500 -- [-413.237] (-413.817) (-416.706) (-416.994) * [-415.021] (-415.086) (-414.991) (-414.578) -- 0:00:53
170000 -- (-412.450) (-413.896) [-411.821] (-416.157) * (-413.320) (-412.153) (-412.395) [-413.188] -- 0:00:53
Average standard deviation of split frequencies: 0.013375
170500 -- (-412.435) (-416.693) (-411.950) [-412.603] * (-414.105) [-412.208] (-416.861) (-414.204) -- 0:00:53
171000 -- (-412.262) [-414.821] (-415.840) (-418.398) * (-414.133) [-413.083] (-414.746) (-412.776) -- 0:00:53
171500 -- (-411.971) (-413.438) (-413.144) [-415.025] * (-413.556) (-414.070) [-415.578] (-414.272) -- 0:00:53
172000 -- (-414.780) (-413.929) (-412.551) [-414.877] * [-414.721] (-412.445) (-415.239) (-414.895) -- 0:00:52
172500 -- (-413.725) (-413.491) [-413.319] (-416.327) * [-414.980] (-413.565) (-416.603) (-412.480) -- 0:00:52
173000 -- (-414.863) (-412.826) [-413.231] (-417.263) * (-414.970) (-413.983) [-412.638] (-415.801) -- 0:00:52
173500 -- (-415.001) (-414.187) [-413.265] (-413.325) * [-418.039] (-415.628) (-413.409) (-414.795) -- 0:00:52
174000 -- [-412.194] (-415.805) (-413.718) (-413.024) * (-415.013) (-413.547) (-413.999) [-413.498] -- 0:00:52
174500 -- (-413.433) (-413.862) [-413.703] (-412.872) * (-416.533) (-413.138) [-413.702] (-414.358) -- 0:00:52
175000 -- (-414.314) [-413.368] (-412.879) (-416.018) * (-413.800) (-412.150) (-414.511) [-415.236] -- 0:00:51
Average standard deviation of split frequencies: 0.010996
175500 -- (-414.593) [-412.322] (-413.647) (-415.261) * (-413.865) (-412.480) (-416.974) [-414.857] -- 0:00:51
176000 -- (-412.095) (-412.457) (-413.623) [-413.720] * (-413.961) (-417.800) (-412.366) [-413.238] -- 0:00:51
176500 -- (-412.342) (-411.991) (-412.108) [-413.231] * (-416.206) (-416.906) [-413.322] (-413.073) -- 0:00:51
177000 -- (-414.754) (-412.629) (-414.034) [-415.147] * (-413.172) [-413.223] (-412.298) (-414.231) -- 0:00:51
177500 -- (-414.036) (-417.537) (-413.124) [-413.087] * (-413.192) [-412.887] (-414.748) (-412.507) -- 0:00:50
178000 -- (-420.778) [-413.628] (-414.210) (-414.931) * (-412.340) (-413.832) (-414.189) [-413.356] -- 0:00:50
178500 -- [-417.593] (-414.318) (-416.837) (-416.724) * (-413.982) [-412.456] (-414.635) (-417.703) -- 0:00:50
179000 -- (-413.246) (-414.152) (-414.394) [-420.348] * (-414.110) (-414.982) [-413.611] (-415.205) -- 0:00:50
179500 -- [-416.021] (-412.088) (-415.535) (-415.029) * [-412.581] (-413.372) (-413.162) (-416.260) -- 0:00:50
180000 -- (-419.285) [-411.695] (-414.655) (-412.703) * (-415.376) (-413.087) [-411.946] (-417.424) -- 0:00:50
Average standard deviation of split frequencies: 0.011261
180500 -- (-416.093) [-413.245] (-414.736) (-416.210) * [-414.046] (-412.323) (-413.556) (-415.710) -- 0:00:49
181000 -- (-416.596) (-413.234) [-412.921] (-414.353) * (-413.606) (-413.188) [-414.786] (-413.575) -- 0:00:49
181500 -- (-412.221) [-413.369] (-412.998) (-416.854) * [-414.740] (-415.410) (-417.128) (-414.276) -- 0:00:49
182000 -- (-413.256) (-413.233) [-415.737] (-415.595) * [-413.422] (-417.144) (-414.402) (-413.681) -- 0:00:49
182500 -- [-412.624] (-419.658) (-413.628) (-415.782) * [-412.823] (-413.662) (-415.471) (-413.466) -- 0:00:49
183000 -- (-412.761) (-417.382) (-412.800) [-419.946] * (-414.183) (-412.420) [-412.800] (-413.672) -- 0:00:53
183500 -- [-413.752] (-413.788) (-415.139) (-415.058) * (-414.212) (-414.314) (-413.150) [-414.300] -- 0:00:53
184000 -- [-412.925] (-412.391) (-419.546) (-412.715) * (-413.800) (-417.497) (-413.034) [-415.347] -- 0:00:53
184500 -- (-413.911) (-413.862) (-420.713) [-415.191] * [-412.152] (-416.876) (-416.759) (-413.185) -- 0:00:53
185000 -- (-414.370) (-415.014) (-416.616) [-414.275] * (-413.249) (-412.449) (-418.279) [-415.433] -- 0:00:52
Average standard deviation of split frequencies: 0.011785
185500 -- [-415.101] (-418.483) (-414.207) (-413.736) * [-411.972] (-414.095) (-417.460) (-414.176) -- 0:00:52
186000 -- (-413.288) [-411.824] (-415.223) (-412.962) * (-415.338) [-412.023] (-413.785) (-414.163) -- 0:00:52
186500 -- (-414.611) (-411.519) (-414.931) [-412.521] * (-416.675) [-412.008] (-416.372) (-413.511) -- 0:00:52
187000 -- (-413.715) [-414.426] (-412.658) (-414.112) * (-412.473) (-414.532) (-412.852) [-412.720] -- 0:00:52
187500 -- [-412.374] (-413.460) (-417.236) (-414.735) * [-416.131] (-414.886) (-414.403) (-412.610) -- 0:00:52
188000 -- (-411.885) (-412.555) [-415.154] (-416.464) * (-413.520) (-416.503) [-415.473] (-415.281) -- 0:00:51
188500 -- (-413.300) (-412.236) (-415.287) [-415.888] * (-414.864) (-415.237) [-413.285] (-416.779) -- 0:00:51
189000 -- [-413.773] (-412.713) (-418.606) (-413.746) * (-419.482) (-413.672) [-415.228] (-413.614) -- 0:00:51
189500 -- (-412.514) (-412.205) (-412.533) [-412.952] * (-414.323) (-415.899) [-415.421] (-413.964) -- 0:00:51
190000 -- [-413.516] (-413.415) (-413.070) (-414.389) * (-411.987) (-414.246) (-415.074) [-412.795] -- 0:00:51
Average standard deviation of split frequencies: 0.010478
190500 -- (-414.408) [-415.766] (-413.635) (-415.430) * (-412.224) (-415.026) (-415.444) [-413.239] -- 0:00:50
191000 -- (-413.562) [-416.812] (-420.378) (-412.581) * (-412.573) (-413.780) [-416.832] (-414.816) -- 0:00:50
191500 -- (-416.457) [-413.537] (-413.214) (-411.496) * (-412.321) [-413.370] (-412.559) (-412.546) -- 0:00:50
192000 -- (-414.365) (-415.134) (-414.045) [-415.101] * [-412.837] (-413.621) (-414.136) (-414.323) -- 0:00:50
192500 -- (-413.009) (-416.600) [-416.677] (-413.395) * (-413.394) (-412.091) [-415.463] (-412.851) -- 0:00:50
193000 -- [-411.752] (-415.091) (-412.606) (-413.992) * (-415.393) [-413.529] (-420.338) (-411.764) -- 0:00:50
193500 -- (-412.613) (-413.135) (-417.113) [-414.655] * (-412.297) (-412.335) [-415.974] (-414.374) -- 0:00:50
194000 -- (-413.023) (-414.206) [-413.767] (-414.347) * [-412.171] (-419.213) (-412.476) (-415.400) -- 0:00:49
194500 -- (-412.795) (-414.986) (-413.548) [-412.500] * (-412.081) (-413.111) [-414.518] (-413.905) -- 0:00:49
195000 -- [-413.052] (-414.116) (-413.338) (-412.064) * (-413.225) [-412.081] (-418.014) (-412.839) -- 0:00:49
Average standard deviation of split frequencies: 0.010537
195500 -- (-414.504) (-414.818) (-415.794) [-411.862] * (-413.628) (-411.648) [-413.986] (-415.037) -- 0:00:49
196000 -- [-413.037] (-414.031) (-412.890) (-413.746) * [-417.064] (-413.763) (-415.551) (-414.096) -- 0:00:49
196500 -- (-413.387) (-414.307) [-412.910] (-412.629) * (-414.495) (-411.995) [-412.785] (-412.642) -- 0:00:49
197000 -- [-415.045] (-420.636) (-413.416) (-416.302) * (-415.699) [-412.560] (-412.908) (-414.513) -- 0:00:48
197500 -- (-413.231) (-416.703) (-413.503) [-415.731] * [-413.701] (-413.568) (-413.725) (-413.505) -- 0:00:48
198000 -- (-415.263) [-412.821] (-414.127) (-417.739) * (-412.790) [-413.599] (-413.341) (-415.892) -- 0:00:48
198500 -- (-416.451) (-417.265) [-412.547] (-414.064) * (-412.978) [-422.903] (-413.002) (-415.773) -- 0:00:48
199000 -- (-419.579) (-418.512) (-414.779) [-414.505] * (-413.248) (-416.649) (-412.923) [-413.172] -- 0:00:48
199500 -- (-416.413) (-415.757) [-412.365] (-416.230) * (-417.232) (-417.349) [-412.482] (-415.372) -- 0:00:48
200000 -- [-412.055] (-412.375) (-413.321) (-413.030) * (-416.877) (-415.480) [-413.800] (-415.179) -- 0:00:48
Average standard deviation of split frequencies: 0.011499
200500 -- (-412.378) [-414.754] (-417.374) (-412.294) * (-416.436) (-413.297) (-412.222) [-415.089] -- 0:00:51
201000 -- (-412.944) [-415.361] (-414.259) (-415.109) * (-412.640) (-412.192) (-413.638) [-416.404] -- 0:00:51
201500 -- (-415.800) (-413.686) (-415.578) [-416.014] * [-414.132] (-411.922) (-412.976) (-412.248) -- 0:00:51
202000 -- (-417.559) (-414.893) [-412.588] (-412.864) * [-413.163] (-416.641) (-416.950) (-417.628) -- 0:00:51
202500 -- (-414.409) [-412.885] (-414.645) (-413.000) * [-416.196] (-412.360) (-411.945) (-413.397) -- 0:00:51
203000 -- (-413.908) [-413.979] (-413.180) (-414.540) * [-413.137] (-413.935) (-412.535) (-420.052) -- 0:00:51
203500 -- (-413.163) (-420.601) (-413.242) [-413.613] * [-413.715] (-412.674) (-413.558) (-421.846) -- 0:00:50
204000 -- [-413.666] (-415.604) (-412.641) (-414.689) * (-413.238) (-414.764) (-414.570) [-412.298] -- 0:00:50
204500 -- [-412.910] (-417.762) (-412.711) (-413.355) * (-419.354) [-414.068] (-412.776) (-412.935) -- 0:00:50
205000 -- (-413.089) (-416.332) [-414.140] (-413.538) * [-416.580] (-413.776) (-414.491) (-415.421) -- 0:00:50
Average standard deviation of split frequencies: 0.011327
205500 -- (-415.290) (-413.873) (-413.143) [-413.920] * [-413.134] (-416.187) (-415.488) (-414.170) -- 0:00:50
206000 -- (-415.651) [-412.518] (-412.956) (-415.830) * (-412.017) (-414.253) (-414.226) [-415.094] -- 0:00:50
206500 -- (-412.552) [-416.354] (-415.960) (-417.116) * (-413.384) (-411.600) (-413.791) [-416.976] -- 0:00:49
207000 -- (-414.660) [-411.985] (-412.804) (-412.621) * (-412.797) (-417.655) (-412.747) [-415.892] -- 0:00:49
207500 -- (-413.722) (-415.805) (-413.079) [-416.729] * (-412.228) (-412.379) (-412.503) [-412.208] -- 0:00:49
208000 -- (-415.165) (-414.890) (-416.417) [-414.483] * [-412.755] (-413.343) (-412.542) (-414.456) -- 0:00:49
208500 -- [-413.039] (-413.432) (-413.437) (-413.123) * [-413.980] (-413.955) (-416.184) (-412.155) -- 0:00:49
209000 -- [-412.740] (-413.678) (-416.545) (-413.855) * [-414.481] (-414.701) (-415.265) (-412.582) -- 0:00:49
209500 -- (-412.980) (-413.012) [-412.249] (-411.879) * (-416.771) (-413.524) (-418.907) [-414.330] -- 0:00:49
210000 -- [-412.235] (-416.426) (-414.880) (-412.563) * (-414.815) (-413.131) (-417.445) [-413.932] -- 0:00:48
Average standard deviation of split frequencies: 0.011071
210500 -- [-413.038] (-416.428) (-415.454) (-414.859) * (-414.029) [-412.306] (-419.948) (-414.076) -- 0:00:48
211000 -- (-414.636) (-414.421) (-413.379) [-414.484] * (-412.678) [-411.909] (-414.465) (-414.534) -- 0:00:48
211500 -- (-413.858) [-412.985] (-412.592) (-412.253) * (-413.434) [-413.828] (-414.714) (-414.692) -- 0:00:48
212000 -- (-414.301) (-413.006) [-412.413] (-412.843) * (-414.986) [-413.269] (-416.376) (-414.332) -- 0:00:48
212500 -- (-412.255) (-415.824) (-413.764) [-412.926] * [-414.434] (-417.720) (-415.693) (-413.266) -- 0:00:48
213000 -- (-414.834) (-414.666) (-419.028) [-412.942] * (-414.497) (-414.415) (-417.998) [-414.178] -- 0:00:48
213500 -- (-419.604) (-417.814) [-412.932] (-416.522) * (-413.997) [-412.661] (-417.755) (-412.147) -- 0:00:47
214000 -- (-416.301) (-416.968) [-411.812] (-413.255) * (-414.510) (-415.155) [-414.813] (-415.041) -- 0:00:47
214500 -- (-415.959) [-412.692] (-412.283) (-413.045) * (-414.002) [-413.384] (-413.513) (-412.327) -- 0:00:47
215000 -- (-414.716) [-417.888] (-412.610) (-413.191) * (-413.586) [-416.362] (-412.825) (-413.074) -- 0:00:47
Average standard deviation of split frequencies: 0.010791
215500 -- (-412.652) (-413.541) (-414.484) [-412.950] * [-415.530] (-413.310) (-414.572) (-413.958) -- 0:00:47
216000 -- [-413.533] (-415.238) (-413.414) (-414.922) * (-413.737) [-411.856] (-414.607) (-413.318) -- 0:00:47
216500 -- (-412.358) (-415.639) [-412.502] (-414.318) * (-412.610) (-412.035) [-415.839] (-412.632) -- 0:00:47
217000 -- (-412.739) (-412.687) (-420.728) [-414.399] * (-412.556) (-413.159) [-411.906] (-417.118) -- 0:00:46
217500 -- (-414.495) [-413.446] (-417.036) (-412.562) * (-414.170) [-413.534] (-415.375) (-415.401) -- 0:00:50
218000 -- [-413.165] (-413.385) (-417.332) (-412.274) * (-417.643) [-411.705] (-415.741) (-413.743) -- 0:00:50
218500 -- [-412.625] (-413.705) (-416.800) (-411.577) * [-413.906] (-414.041) (-415.222) (-413.578) -- 0:00:50
219000 -- [-413.904] (-414.810) (-417.224) (-414.591) * (-413.393) (-415.124) [-414.912] (-417.177) -- 0:00:49
219500 -- (-412.221) [-413.974] (-415.392) (-412.162) * (-415.123) [-415.423] (-412.616) (-417.035) -- 0:00:49
220000 -- (-411.861) (-415.443) (-416.048) [-413.773] * (-415.902) (-412.862) (-414.156) [-412.631] -- 0:00:49
Average standard deviation of split frequencies: 0.010800
220500 -- (-412.145) (-415.028) (-414.871) [-415.371] * (-415.024) (-413.153) [-412.701] (-415.077) -- 0:00:49
221000 -- (-413.939) [-412.147] (-416.420) (-413.138) * (-412.814) (-413.701) (-417.981) [-416.361] -- 0:00:49
221500 -- (-413.114) [-412.256] (-417.168) (-413.150) * (-414.017) (-411.539) [-413.498] (-415.540) -- 0:00:49
222000 -- [-413.080] (-414.107) (-414.589) (-416.052) * (-413.869) [-414.163] (-413.150) (-413.899) -- 0:00:49
222500 -- (-414.995) [-413.147] (-417.404) (-412.610) * (-418.524) (-412.806) [-412.939] (-413.081) -- 0:00:48
223000 -- [-414.473] (-418.729) (-418.678) (-416.474) * [-413.541] (-412.389) (-414.878) (-414.064) -- 0:00:48
223500 -- (-413.351) (-413.872) [-414.514] (-416.159) * (-414.302) (-412.143) (-413.420) [-416.565] -- 0:00:48
224000 -- (-414.279) [-414.288] (-416.256) (-412.206) * (-414.345) [-413.019] (-416.146) (-413.104) -- 0:00:48
224500 -- (-419.183) (-412.731) (-418.933) [-413.007] * (-412.944) (-413.627) [-416.751] (-412.396) -- 0:00:48
225000 -- (-414.554) [-419.742] (-413.798) (-414.839) * (-418.499) [-415.299] (-413.684) (-412.373) -- 0:00:48
Average standard deviation of split frequencies: 0.012076
225500 -- (-413.289) (-418.139) [-413.491] (-414.196) * (-414.905) [-413.193] (-413.385) (-412.241) -- 0:00:48
226000 -- (-415.466) (-418.696) [-413.177] (-413.438) * [-414.280] (-413.674) (-413.308) (-413.755) -- 0:00:47
226500 -- (-412.093) [-412.570] (-414.670) (-414.868) * [-415.114] (-417.592) (-413.730) (-413.095) -- 0:00:47
227000 -- [-413.462] (-413.550) (-413.802) (-413.019) * [-415.354] (-414.097) (-414.451) (-414.348) -- 0:00:47
227500 -- [-415.753] (-414.432) (-415.518) (-412.553) * [-413.877] (-416.372) (-412.440) (-414.219) -- 0:00:47
228000 -- (-413.256) (-413.211) [-412.805] (-413.541) * [-415.075] (-414.695) (-412.395) (-416.672) -- 0:00:47
228500 -- (-414.428) (-413.949) (-412.398) [-412.461] * [-413.980] (-412.295) (-412.345) (-415.463) -- 0:00:47
229000 -- (-415.671) (-411.929) (-412.283) [-412.034] * (-417.653) (-414.191) (-413.775) [-412.223] -- 0:00:47
229500 -- (-415.458) [-413.015] (-416.613) (-412.418) * (-413.982) (-412.545) [-413.825] (-412.911) -- 0:00:47
230000 -- (-415.002) (-413.105) (-413.891) [-412.478] * [-413.838] (-415.854) (-413.054) (-413.934) -- 0:00:46
Average standard deviation of split frequencies: 0.012376
230500 -- (-414.493) [-413.258] (-414.776) (-412.864) * [-412.896] (-413.109) (-415.757) (-416.556) -- 0:00:46
231000 -- (-413.997) (-413.507) (-419.294) [-412.594] * [-412.793] (-413.911) (-413.032) (-413.950) -- 0:00:46
231500 -- (-417.114) (-413.000) (-415.173) [-412.654] * (-412.913) [-412.266] (-413.972) (-413.621) -- 0:00:46
232000 -- (-414.627) [-413.069] (-412.657) (-412.337) * (-412.567) [-411.941] (-416.255) (-412.725) -- 0:00:46
232500 -- (-413.230) (-415.751) [-412.841] (-413.453) * [-412.223] (-414.801) (-412.207) (-416.864) -- 0:00:46
233000 -- [-412.426] (-413.687) (-414.514) (-413.790) * [-415.119] (-419.178) (-412.666) (-415.449) -- 0:00:46
233500 -- (-415.669) (-414.607) (-415.816) [-412.606] * (-415.080) [-413.505] (-412.381) (-414.813) -- 0:00:45
234000 -- [-414.958] (-413.548) (-418.456) (-416.121) * (-413.110) (-412.917) (-412.511) [-414.009] -- 0:00:45
234500 -- (-414.673) (-413.296) (-419.177) [-417.814] * (-412.621) (-411.709) [-415.310] (-414.455) -- 0:00:48
235000 -- (-413.909) (-422.156) [-414.413] (-415.713) * (-411.934) (-415.037) [-413.017] (-412.239) -- 0:00:48
Average standard deviation of split frequencies: 0.011763
235500 -- [-417.794] (-416.549) (-414.799) (-411.837) * (-419.288) (-412.634) [-412.627] (-414.538) -- 0:00:48
236000 -- (-417.352) (-413.066) [-414.124] (-411.852) * (-413.836) [-416.739] (-413.993) (-412.297) -- 0:00:48
236500 -- [-414.069] (-413.629) (-412.843) (-415.390) * (-417.816) [-412.180] (-417.581) (-417.136) -- 0:00:48
237000 -- [-412.340] (-412.705) (-415.189) (-413.894) * (-413.874) [-412.714] (-412.956) (-412.988) -- 0:00:48
237500 -- (-414.240) (-413.441) (-422.080) [-412.076] * (-414.837) (-413.753) (-412.446) [-413.653] -- 0:00:48
238000 -- [-413.583] (-414.071) (-414.473) (-413.813) * (-414.295) [-413.423] (-412.114) (-416.366) -- 0:00:48
238500 -- (-415.058) [-412.118] (-416.055) (-413.148) * [-413.437] (-414.417) (-414.470) (-414.656) -- 0:00:47
239000 -- (-413.221) [-413.072] (-421.168) (-413.761) * (-416.626) [-413.794] (-416.316) (-411.774) -- 0:00:47
239500 -- (-412.508) (-413.599) (-420.543) [-414.478] * (-414.418) (-413.264) (-413.083) [-413.824] -- 0:00:47
240000 -- (-414.396) (-413.701) (-418.050) [-412.947] * (-413.741) (-414.470) (-415.105) [-412.400] -- 0:00:47
Average standard deviation of split frequencies: 0.013385
240500 -- (-415.482) (-413.755) (-412.063) [-413.167] * (-412.762) (-416.979) [-412.219] (-411.825) -- 0:00:47
241000 -- (-412.890) (-411.998) (-412.249) [-417.618] * (-418.488) (-417.285) [-415.004] (-414.007) -- 0:00:47
241500 -- (-414.682) (-412.795) (-413.705) [-415.503] * [-419.825] (-412.798) (-416.972) (-419.002) -- 0:00:47
242000 -- [-416.321] (-413.630) (-415.687) (-415.928) * (-414.177) (-413.232) (-413.864) [-418.643] -- 0:00:46
242500 -- (-418.754) [-412.111] (-412.560) (-413.897) * (-418.016) (-413.134) (-413.145) [-412.039] -- 0:00:46
243000 -- [-413.808] (-414.426) (-413.269) (-413.812) * (-415.369) [-414.798] (-414.263) (-414.490) -- 0:00:46
243500 -- (-412.682) (-414.595) (-414.631) [-413.024] * (-415.811) (-417.854) (-415.672) [-414.790] -- 0:00:46
244000 -- (-415.856) (-412.702) (-416.613) [-413.962] * (-412.471) [-413.884] (-416.128) (-416.105) -- 0:00:46
244500 -- (-411.983) (-414.666) [-411.565] (-413.793) * (-413.337) [-414.276] (-416.002) (-414.923) -- 0:00:46
245000 -- [-412.706] (-419.877) (-413.365) (-417.078) * (-411.769) (-413.303) [-411.712] (-415.028) -- 0:00:46
Average standard deviation of split frequencies: 0.013307
245500 -- (-413.477) [-414.811] (-415.234) (-412.918) * (-412.326) [-413.008] (-412.554) (-419.349) -- 0:00:46
246000 -- (-411.944) [-413.467] (-416.468) (-414.710) * (-412.221) (-415.057) (-413.623) [-413.026] -- 0:00:45
246500 -- [-412.276] (-414.686) (-417.355) (-418.087) * [-413.443] (-413.225) (-412.098) (-412.368) -- 0:00:45
247000 -- (-415.757) (-416.352) (-413.474) [-416.678] * (-415.689) (-414.906) [-413.349] (-412.778) -- 0:00:45
247500 -- (-415.715) (-413.394) [-415.905] (-415.694) * (-417.510) (-414.486) [-413.855] (-414.177) -- 0:00:45
248000 -- [-414.019] (-413.101) (-415.513) (-416.997) * (-415.706) (-412.831) [-414.064] (-412.341) -- 0:00:45
248500 -- (-414.242) (-414.122) (-413.484) [-415.260] * (-411.865) (-412.145) [-414.614] (-414.818) -- 0:00:45
249000 -- (-415.542) (-416.103) [-413.509] (-415.872) * (-417.064) (-413.869) (-412.982) [-414.250] -- 0:00:45
249500 -- (-414.598) (-415.927) [-414.100] (-418.511) * (-413.258) [-415.617] (-413.181) (-415.260) -- 0:00:45
250000 -- (-417.617) (-416.348) (-413.116) [-412.834] * (-414.995) [-414.695] (-413.418) (-414.599) -- 0:00:45
Average standard deviation of split frequencies: 0.011837
250500 -- (-414.214) (-412.619) (-415.562) [-413.111] * (-415.211) (-416.457) (-413.698) [-412.880] -- 0:00:44
251000 -- (-416.919) (-413.340) [-415.920] (-411.850) * [-413.888] (-416.572) (-411.933) (-413.000) -- 0:00:44
251500 -- (-415.007) (-414.323) (-416.269) [-415.431] * (-416.427) (-414.809) [-412.403] (-415.867) -- 0:00:47
252000 -- (-413.334) [-416.290] (-413.330) (-412.775) * (-412.860) (-412.475) [-411.850] (-413.295) -- 0:00:47
252500 -- (-417.322) (-414.756) [-414.200] (-413.873) * [-414.466] (-414.041) (-414.874) (-413.545) -- 0:00:47
253000 -- [-414.873] (-412.926) (-417.711) (-415.357) * [-419.609] (-414.662) (-413.668) (-412.581) -- 0:00:47
253500 -- (-412.830) (-414.684) (-412.499) [-414.111] * (-418.394) [-415.312] (-415.355) (-413.563) -- 0:00:47
254000 -- (-414.649) (-414.689) (-414.733) [-415.014] * [-416.955] (-415.277) (-412.507) (-415.718) -- 0:00:46
254500 -- (-414.919) (-417.788) (-413.843) [-415.476] * (-415.438) [-418.469] (-412.979) (-416.049) -- 0:00:46
255000 -- (-414.742) [-415.436] (-412.879) (-421.904) * (-417.533) [-412.864] (-413.097) (-414.441) -- 0:00:46
Average standard deviation of split frequencies: 0.014322
255500 -- (-418.365) (-413.916) [-412.252] (-413.819) * (-413.796) (-414.674) (-414.197) [-413.709] -- 0:00:46
256000 -- (-416.165) [-412.507] (-412.081) (-412.659) * (-412.678) (-411.912) (-413.584) [-415.808] -- 0:00:46
256500 -- (-414.229) (-413.980) (-413.192) [-412.886] * (-412.320) (-414.842) (-417.448) [-413.449] -- 0:00:46
257000 -- (-421.193) (-414.925) [-412.657] (-413.561) * (-414.089) [-416.260] (-415.284) (-417.597) -- 0:00:46
257500 -- [-419.080] (-413.028) (-417.324) (-415.456) * [-413.446] (-412.076) (-419.151) (-412.899) -- 0:00:46
258000 -- (-413.056) (-414.032) [-414.245] (-416.689) * (-414.577) (-413.319) (-416.418) [-413.914] -- 0:00:46
258500 -- (-413.104) (-412.505) [-418.042] (-415.834) * (-411.889) [-412.118] (-415.053) (-419.156) -- 0:00:45
259000 -- (-416.355) (-412.811) (-413.320) [-416.785] * (-416.741) [-413.907] (-414.123) (-421.392) -- 0:00:45
259500 -- (-414.828) (-413.691) [-415.082] (-415.184) * (-414.671) [-414.522] (-412.732) (-416.972) -- 0:00:45
260000 -- (-412.772) (-414.061) [-412.716] (-414.605) * [-416.255] (-412.419) (-415.264) (-413.625) -- 0:00:45
Average standard deviation of split frequencies: 0.015171
260500 -- [-416.589] (-412.076) (-414.464) (-415.538) * [-413.231] (-412.472) (-413.828) (-413.127) -- 0:00:45
261000 -- (-419.109) [-413.668] (-414.083) (-413.125) * (-412.178) [-411.929] (-413.467) (-419.864) -- 0:00:45
261500 -- (-415.821) (-414.285) (-416.978) [-416.249] * (-417.636) [-412.120] (-418.132) (-413.440) -- 0:00:45
262000 -- (-417.173) (-418.730) [-415.055] (-413.354) * (-412.988) [-414.085] (-416.723) (-415.311) -- 0:00:45
262500 -- (-417.716) (-416.273) [-414.152] (-417.009) * [-412.313] (-416.782) (-412.411) (-413.721) -- 0:00:44
263000 -- (-414.380) (-419.608) [-412.872] (-413.740) * (-414.870) [-414.264] (-413.207) (-411.857) -- 0:00:44
263500 -- (-411.875) (-414.387) [-411.918] (-416.837) * [-416.668] (-412.794) (-412.465) (-413.237) -- 0:00:44
264000 -- (-414.711) (-414.654) [-413.912] (-414.509) * (-416.158) [-413.037] (-412.172) (-413.266) -- 0:00:44
264500 -- (-416.188) (-421.764) [-411.615] (-415.595) * [-416.046] (-415.731) (-412.243) (-412.898) -- 0:00:44
265000 -- (-417.297) [-412.967] (-412.816) (-415.339) * [-418.011] (-417.034) (-412.738) (-414.546) -- 0:00:44
Average standard deviation of split frequencies: 0.013784
265500 -- [-412.662] (-419.202) (-413.280) (-414.441) * [-413.561] (-416.592) (-412.901) (-419.685) -- 0:00:44
266000 -- (-413.250) (-413.341) [-416.315] (-412.805) * (-415.585) [-413.783] (-414.453) (-415.282) -- 0:00:44
266500 -- [-413.751] (-411.893) (-413.351) (-412.793) * (-415.619) [-415.063] (-414.212) (-412.972) -- 0:00:44
267000 -- [-412.499] (-416.547) (-413.095) (-415.934) * (-415.326) (-412.557) (-414.386) [-415.602] -- 0:00:43
267500 -- (-414.324) [-414.982] (-412.204) (-414.659) * (-412.641) (-414.057) (-415.893) [-414.696] -- 0:00:43
268000 -- [-414.368] (-416.495) (-415.821) (-415.549) * (-413.000) (-412.788) [-414.559] (-416.567) -- 0:00:43
268500 -- [-411.696] (-414.335) (-413.852) (-416.287) * (-413.489) (-412.643) (-415.098) [-412.855] -- 0:00:46
269000 -- (-414.272) (-416.466) [-413.625] (-416.524) * (-411.914) (-414.201) (-414.338) [-414.145] -- 0:00:46
269500 -- (-415.284) (-413.083) (-415.394) [-414.089] * (-412.594) (-412.582) (-413.103) [-418.921] -- 0:00:46
270000 -- (-412.147) (-412.728) (-413.081) [-412.758] * [-414.129] (-413.810) (-412.042) (-413.528) -- 0:00:45
Average standard deviation of split frequencies: 0.014997
270500 -- (-413.639) (-413.303) (-414.318) [-417.760] * [-412.037] (-414.222) (-412.353) (-412.170) -- 0:00:45
271000 -- (-411.947) [-414.153] (-413.691) (-413.246) * (-412.666) (-413.803) [-414.392] (-414.861) -- 0:00:45
271500 -- (-412.165) (-414.172) [-415.949] (-412.158) * (-415.569) (-414.759) [-414.267] (-414.422) -- 0:00:45
272000 -- (-415.980) [-414.511] (-419.002) (-412.676) * [-415.407] (-413.663) (-413.034) (-413.882) -- 0:00:45
272500 -- [-415.037] (-415.034) (-416.431) (-414.408) * [-413.194] (-420.572) (-414.827) (-412.061) -- 0:00:45
273000 -- (-419.622) [-414.771] (-412.760) (-412.491) * (-414.116) (-415.392) [-412.227] (-414.552) -- 0:00:45
273500 -- (-418.877) [-415.227] (-413.029) (-416.358) * (-413.707) (-416.850) (-413.350) [-413.673] -- 0:00:45
274000 -- (-417.316) (-415.266) [-412.655] (-412.704) * (-412.460) (-414.230) (-415.266) [-412.299] -- 0:00:45
274500 -- (-415.245) (-415.381) [-412.242] (-415.917) * (-412.209) (-417.292) [-414.271] (-415.988) -- 0:00:44
275000 -- (-414.986) (-412.844) (-412.642) [-415.858] * (-412.372) [-414.516] (-413.305) (-416.472) -- 0:00:44
Average standard deviation of split frequencies: 0.014423
275500 -- (-413.430) [-414.645] (-415.323) (-416.607) * (-413.517) [-417.265] (-415.658) (-412.399) -- 0:00:44
276000 -- (-416.301) [-414.536] (-413.097) (-416.881) * (-412.858) (-414.797) (-413.114) [-415.455] -- 0:00:44
276500 -- (-413.380) (-414.359) [-415.157] (-413.390) * [-413.497] (-412.664) (-415.368) (-412.364) -- 0:00:44
277000 -- (-412.492) (-412.841) [-414.580] (-416.667) * (-412.590) [-413.258] (-411.728) (-414.665) -- 0:00:44
277500 -- [-412.854] (-416.854) (-413.779) (-412.948) * (-419.755) [-413.252] (-413.340) (-415.990) -- 0:00:44
278000 -- (-413.099) (-414.279) [-415.132] (-412.498) * (-413.446) (-417.098) [-414.116] (-416.581) -- 0:00:44
278500 -- (-415.448) [-413.280] (-416.871) (-413.524) * (-413.011) (-418.207) [-416.504] (-416.947) -- 0:00:44
279000 -- (-415.120) (-414.928) [-411.688] (-413.177) * (-411.975) (-412.151) (-415.115) [-413.776] -- 0:00:43
279500 -- (-414.618) (-413.080) (-412.535) [-415.658] * (-413.056) (-412.354) (-413.708) [-413.036] -- 0:00:43
280000 -- (-413.913) (-415.591) [-412.914] (-412.843) * (-416.454) (-413.212) [-414.345] (-412.919) -- 0:00:43
Average standard deviation of split frequencies: 0.013343
280500 -- (-414.533) [-414.813] (-413.292) (-416.546) * (-412.143) [-415.241] (-413.769) (-413.874) -- 0:00:43
281000 -- (-414.919) (-412.293) (-414.933) [-414.806] * (-414.187) [-413.849] (-412.608) (-413.377) -- 0:00:43
281500 -- (-413.839) (-411.994) [-415.263] (-413.051) * (-415.071) (-421.750) (-413.205) [-416.067] -- 0:00:43
282000 -- (-413.689) (-413.568) (-412.787) [-411.875] * (-412.776) [-415.009] (-413.408) (-414.395) -- 0:00:43
282500 -- (-414.260) (-415.209) [-416.627] (-414.474) * (-413.293) [-411.904] (-413.720) (-412.142) -- 0:00:43
283000 -- [-418.009] (-416.624) (-412.198) (-413.575) * (-415.312) (-415.558) [-415.593] (-413.744) -- 0:00:43
283500 -- (-421.214) (-412.091) (-413.036) [-415.594] * (-414.944) (-412.447) [-413.390] (-413.419) -- 0:00:42
284000 -- (-416.736) (-412.031) (-417.370) [-415.959] * (-413.828) (-413.163) [-412.348] (-414.731) -- 0:00:42
284500 -- [-412.779] (-414.666) (-414.957) (-413.082) * (-414.479) (-414.210) (-412.626) [-413.794] -- 0:00:42
285000 -- (-412.530) (-415.393) (-412.972) [-412.364] * (-412.193) (-418.351) (-414.024) [-413.064] -- 0:00:42
Average standard deviation of split frequencies: 0.013533
285500 -- (-412.021) (-417.373) (-418.938) [-412.738] * [-411.727] (-415.344) (-413.348) (-414.049) -- 0:00:45
286000 -- (-416.938) [-416.937] (-413.333) (-413.101) * (-414.655) [-415.784] (-416.129) (-413.252) -- 0:00:44
286500 -- [-412.263] (-412.335) (-415.270) (-413.929) * (-419.278) [-413.952] (-414.298) (-423.799) -- 0:00:44
287000 -- (-414.426) [-413.339] (-412.814) (-412.935) * (-418.617) [-415.854] (-415.677) (-415.516) -- 0:00:44
287500 -- (-413.423) (-413.329) (-414.877) [-413.497] * (-414.827) (-413.115) [-412.686] (-415.386) -- 0:00:44
288000 -- (-415.668) (-414.353) (-413.224) [-413.439] * [-414.089] (-414.299) (-413.876) (-415.046) -- 0:00:44
288500 -- [-411.786] (-415.927) (-413.708) (-413.463) * (-413.199) [-414.090] (-414.070) (-417.540) -- 0:00:44
289000 -- (-415.880) (-416.487) [-414.363] (-413.963) * (-414.186) (-415.720) [-412.955] (-414.197) -- 0:00:44
289500 -- [-416.646] (-413.475) (-412.817) (-412.852) * (-418.072) (-413.292) [-412.574] (-413.168) -- 0:00:44
290000 -- (-414.412) (-415.886) (-415.845) [-413.156] * (-413.940) (-412.686) [-414.092] (-412.315) -- 0:00:44
Average standard deviation of split frequencies: 0.014056
290500 -- (-412.458) [-412.480] (-413.232) (-414.782) * (-414.347) [-416.540] (-414.679) (-415.241) -- 0:00:43
291000 -- [-411.902] (-413.844) (-413.975) (-413.428) * (-415.497) (-413.344) [-412.363] (-414.348) -- 0:00:43
291500 -- (-414.824) (-413.704) (-412.415) [-413.325] * (-412.164) (-416.350) [-413.167] (-415.902) -- 0:00:43
292000 -- (-416.996) (-418.015) [-412.465] (-414.958) * (-412.625) (-419.228) [-412.048] (-412.818) -- 0:00:43
292500 -- (-418.919) [-418.788] (-413.993) (-416.562) * (-414.321) [-414.532] (-412.785) (-414.555) -- 0:00:43
293000 -- (-413.201) (-416.830) (-416.430) [-414.275] * (-413.807) [-412.669] (-412.332) (-412.129) -- 0:00:43
293500 -- (-412.696) [-414.145] (-413.113) (-413.668) * (-413.447) [-413.296] (-415.067) (-412.061) -- 0:00:43
294000 -- (-414.300) (-417.005) [-415.281] (-413.619) * (-413.828) (-413.606) (-412.884) [-416.661] -- 0:00:43
294500 -- (-413.990) (-418.239) (-412.022) [-413.892] * (-414.188) (-414.553) [-414.752] (-413.330) -- 0:00:43
295000 -- (-414.604) [-420.498] (-412.686) (-412.150) * [-411.709] (-412.788) (-413.020) (-412.765) -- 0:00:43
Average standard deviation of split frequencies: 0.014333
295500 -- [-414.558] (-414.891) (-414.619) (-414.482) * (-411.979) (-412.158) [-412.976] (-417.453) -- 0:00:42
296000 -- [-414.085] (-414.902) (-414.052) (-412.991) * (-413.122) (-415.144) (-416.121) [-413.633] -- 0:00:42
296500 -- [-417.930] (-414.038) (-414.283) (-412.508) * (-414.125) (-415.975) (-413.206) [-415.899] -- 0:00:42
297000 -- (-416.973) [-415.377] (-413.031) (-412.128) * [-413.286] (-416.680) (-413.051) (-413.639) -- 0:00:42
297500 -- [-413.269] (-414.425) (-412.519) (-413.053) * (-415.257) [-415.009] (-412.547) (-417.991) -- 0:00:42
298000 -- (-412.330) (-413.838) [-414.497] (-413.435) * (-416.449) (-414.534) [-414.653] (-417.924) -- 0:00:42
298500 -- (-414.304) [-413.651] (-412.655) (-417.147) * (-414.037) [-413.010] (-413.708) (-420.592) -- 0:00:42
299000 -- (-413.799) (-412.877) (-414.658) [-413.864] * (-414.922) [-412.793] (-412.384) (-415.354) -- 0:00:42
299500 -- (-415.485) (-413.048) (-413.226) [-413.880] * (-414.273) (-414.887) [-413.929] (-412.019) -- 0:00:42
300000 -- (-413.734) (-414.379) [-414.503] (-415.215) * [-413.003] (-415.930) (-412.848) (-413.059) -- 0:00:42
Average standard deviation of split frequencies: 0.013742
300500 -- [-415.958] (-414.957) (-413.195) (-415.049) * [-412.152] (-416.063) (-413.481) (-417.072) -- 0:00:41
301000 -- [-415.031] (-413.530) (-413.405) (-421.703) * (-412.337) (-415.908) [-415.311] (-413.121) -- 0:00:41
301500 -- (-412.296) (-413.578) (-414.808) [-414.410] * (-414.103) (-413.302) (-411.912) [-412.279] -- 0:00:41
302000 -- (-413.108) (-414.401) [-414.651] (-415.678) * (-413.118) (-416.259) [-414.500] (-414.057) -- 0:00:41
302500 -- (-414.430) (-414.002) (-415.217) [-415.496] * (-414.237) (-415.732) [-412.287] (-414.076) -- 0:00:43
303000 -- (-414.088) [-412.786] (-415.766) (-416.887) * (-413.373) (-413.112) [-412.799] (-413.459) -- 0:00:43
303500 -- (-414.216) [-414.102] (-416.290) (-414.594) * (-414.571) (-412.633) [-411.921] (-413.437) -- 0:00:43
304000 -- (-412.713) [-412.556] (-414.571) (-414.911) * (-414.899) (-412.316) (-412.343) [-413.052] -- 0:00:43
304500 -- [-415.284] (-412.682) (-413.270) (-415.374) * (-415.498) (-413.717) (-413.809) [-415.973] -- 0:00:43
305000 -- (-412.861) [-414.656] (-412.850) (-414.194) * (-414.400) (-413.068) [-412.830] (-412.694) -- 0:00:43
Average standard deviation of split frequencies: 0.014806
305500 -- (-413.932) (-413.986) (-414.123) [-413.194] * (-415.646) (-412.411) (-413.841) [-416.005] -- 0:00:43
306000 -- (-414.152) (-412.988) [-412.112] (-417.751) * (-415.671) (-413.683) (-414.043) [-414.607] -- 0:00:43
306500 -- [-412.547] (-417.261) (-412.298) (-413.399) * [-414.064] (-415.437) (-415.190) (-415.518) -- 0:00:42
307000 -- (-414.153) [-414.917] (-413.803) (-413.528) * (-417.640) (-412.698) (-415.173) [-413.588] -- 0:00:42
307500 -- (-413.241) [-414.939] (-416.420) (-411.803) * (-414.303) (-415.387) (-414.678) [-413.646] -- 0:00:42
308000 -- (-412.217) (-417.558) (-414.750) [-417.270] * (-414.065) (-411.580) [-414.661] (-414.084) -- 0:00:42
308500 -- (-416.060) (-412.339) (-419.226) [-415.509] * (-414.145) [-413.569] (-416.810) (-413.474) -- 0:00:42
309000 -- (-414.612) (-420.882) [-414.682] (-414.811) * (-412.761) (-415.801) (-416.915) [-416.666] -- 0:00:42
309500 -- (-413.389) (-414.735) [-412.406] (-412.486) * (-414.942) [-411.800] (-414.732) (-414.960) -- 0:00:42
310000 -- (-414.403) (-414.446) [-415.141] (-416.108) * (-414.950) (-414.969) (-413.579) [-415.120] -- 0:00:42
Average standard deviation of split frequencies: 0.013657
310500 -- (-415.540) (-412.694) [-415.905] (-414.816) * (-414.459) (-412.104) (-416.848) [-413.459] -- 0:00:42
311000 -- (-415.407) (-415.082) (-415.129) [-412.707] * [-414.174] (-416.658) (-416.216) (-413.953) -- 0:00:42
311500 -- (-415.775) (-413.312) [-414.017] (-414.502) * (-411.898) (-419.226) (-415.204) [-412.359] -- 0:00:41
312000 -- (-416.118) (-413.219) (-413.249) [-412.086] * (-413.804) (-416.071) (-412.943) [-412.130] -- 0:00:41
312500 -- (-413.718) (-413.733) [-415.079] (-414.812) * (-413.779) (-414.661) (-413.785) [-412.034] -- 0:00:41
313000 -- (-414.620) (-412.245) (-412.466) [-412.146] * [-417.894] (-413.813) (-412.821) (-414.975) -- 0:00:41
313500 -- (-413.599) (-413.723) [-412.800] (-412.239) * [-415.708] (-418.768) (-416.263) (-412.591) -- 0:00:41
314000 -- (-415.442) (-412.130) (-414.392) [-413.339] * [-413.189] (-413.118) (-414.546) (-415.499) -- 0:00:41
314500 -- [-414.211] (-411.928) (-420.606) (-414.005) * [-412.776] (-414.184) (-417.750) (-414.527) -- 0:00:41
315000 -- (-414.867) (-412.952) [-414.560] (-412.112) * [-415.262] (-417.795) (-413.563) (-414.160) -- 0:00:41
Average standard deviation of split frequencies: 0.013338
315500 -- [-415.833] (-414.545) (-416.116) (-416.347) * (-415.386) (-416.814) [-418.402] (-413.397) -- 0:00:41
316000 -- [-415.179] (-412.088) (-413.576) (-415.499) * (-417.911) [-412.778] (-415.681) (-413.465) -- 0:00:41
316500 -- [-412.103] (-416.212) (-412.542) (-416.058) * [-412.153] (-412.776) (-414.852) (-413.932) -- 0:00:41
317000 -- (-413.652) (-412.628) [-414.149] (-416.390) * (-413.723) [-415.040] (-415.319) (-411.969) -- 0:00:40
317500 -- [-412.738] (-416.991) (-413.330) (-416.046) * (-416.692) (-415.614) (-412.244) [-412.822] -- 0:00:40
318000 -- (-415.759) [-412.439] (-413.716) (-411.925) * (-413.799) [-411.958] (-412.130) (-414.556) -- 0:00:40
318500 -- [-411.676] (-414.465) (-416.498) (-413.007) * (-414.016) (-416.167) [-412.104] (-413.488) -- 0:00:40
319000 -- [-412.729] (-415.234) (-413.780) (-413.209) * [-411.787] (-414.328) (-415.852) (-413.543) -- 0:00:40
319500 -- (-411.775) (-412.247) [-411.773] (-413.886) * (-414.151) (-415.599) (-415.201) [-412.616] -- 0:00:42
320000 -- [-412.614] (-413.364) (-413.229) (-415.892) * (-415.212) (-413.440) [-413.833] (-412.972) -- 0:00:42
Average standard deviation of split frequencies: 0.013490
320500 -- (-415.093) [-411.950] (-414.281) (-418.023) * [-414.454] (-414.559) (-414.180) (-414.227) -- 0:00:42
321000 -- [-414.507] (-412.649) (-415.543) (-412.352) * (-412.231) [-412.984] (-412.907) (-413.720) -- 0:00:42
321500 -- (-412.471) [-415.061] (-413.497) (-414.359) * [-414.305] (-412.285) (-415.994) (-416.068) -- 0:00:42
322000 -- (-412.506) (-416.271) [-411.590] (-412.590) * [-415.701] (-411.629) (-415.976) (-413.261) -- 0:00:42
322500 -- (-412.624) (-414.548) (-412.945) [-411.880] * (-413.786) [-414.239] (-417.781) (-413.416) -- 0:00:42
323000 -- [-413.476] (-421.751) (-412.190) (-412.188) * (-412.717) (-415.616) (-415.781) [-416.361] -- 0:00:41
323500 -- (-415.383) (-412.552) (-415.272) [-413.899] * [-412.963] (-413.799) (-414.499) (-414.004) -- 0:00:41
324000 -- (-413.465) [-413.771] (-419.436) (-414.537) * (-412.834) [-414.963] (-416.983) (-420.877) -- 0:00:41
324500 -- (-413.196) [-416.897] (-414.293) (-416.753) * [-412.064] (-415.691) (-413.416) (-413.169) -- 0:00:41
325000 -- [-414.668] (-411.914) (-413.204) (-418.994) * (-414.178) [-412.800] (-413.318) (-413.707) -- 0:00:41
Average standard deviation of split frequencies: 0.013695
325500 -- [-419.407] (-414.318) (-413.419) (-413.827) * [-414.184] (-411.965) (-415.368) (-412.144) -- 0:00:41
326000 -- (-415.712) [-413.524] (-415.113) (-413.912) * (-412.791) (-413.289) [-412.919] (-415.046) -- 0:00:41
326500 -- (-413.629) [-414.730] (-414.340) (-412.496) * (-412.536) (-412.381) (-412.601) [-415.629] -- 0:00:41
327000 -- (-414.629) (-413.522) [-413.311] (-414.063) * [-414.648] (-414.998) (-414.667) (-414.762) -- 0:00:41
327500 -- (-414.369) (-418.379) (-415.251) [-415.435] * (-411.899) (-414.071) (-414.895) [-412.737] -- 0:00:41
328000 -- (-416.547) [-412.288] (-413.250) (-415.867) * [-414.810] (-416.310) (-417.246) (-414.666) -- 0:00:40
328500 -- (-415.757) (-412.924) [-416.483] (-413.836) * (-416.282) (-414.411) [-415.037] (-413.697) -- 0:00:40
329000 -- (-413.764) [-413.039] (-422.224) (-414.281) * (-417.375) (-414.881) (-412.363) [-417.235] -- 0:00:40
329500 -- (-414.744) (-413.345) (-416.303) [-414.768] * (-416.923) (-415.520) (-415.273) [-412.764] -- 0:00:40
330000 -- [-414.827] (-415.071) (-413.259) (-415.489) * (-412.891) (-413.957) (-414.223) [-412.195] -- 0:00:40
Average standard deviation of split frequencies: 0.014005
330500 -- (-415.582) (-417.427) [-412.252] (-415.892) * [-412.142] (-413.673) (-414.004) (-415.390) -- 0:00:40
331000 -- (-417.599) [-417.798] (-416.406) (-415.347) * (-416.824) (-416.333) (-414.072) [-416.176] -- 0:00:40
331500 -- [-413.345] (-414.514) (-413.309) (-418.440) * (-413.370) (-412.771) (-414.567) [-418.076] -- 0:00:40
332000 -- (-414.871) (-416.498) [-415.336] (-416.551) * (-414.746) (-423.178) [-412.431] (-413.877) -- 0:00:40
332500 -- [-414.318] (-415.749) (-414.171) (-419.044) * (-412.589) [-414.528] (-414.637) (-416.697) -- 0:00:40
333000 -- (-413.966) [-412.543] (-414.704) (-415.308) * [-413.967] (-416.797) (-416.889) (-414.268) -- 0:00:40
333500 -- (-413.631) (-415.957) [-412.585] (-412.114) * [-412.273] (-416.303) (-413.875) (-413.607) -- 0:00:39
334000 -- [-414.174] (-417.986) (-413.060) (-411.729) * (-413.123) (-414.506) (-412.346) [-413.982] -- 0:00:39
334500 -- (-416.971) [-413.443] (-413.107) (-413.431) * (-413.771) (-415.584) [-412.690] (-417.835) -- 0:00:39
335000 -- (-417.147) (-413.723) (-413.447) [-415.153] * (-414.170) (-415.786) (-412.174) [-414.104] -- 0:00:39
Average standard deviation of split frequencies: 0.015185
335500 -- (-411.986) (-415.649) [-416.618] (-413.628) * (-414.006) [-413.949] (-414.605) (-418.681) -- 0:00:39
336000 -- (-413.398) (-417.508) (-414.858) [-414.253] * (-411.974) [-414.001] (-411.919) (-413.175) -- 0:00:39
336500 -- (-418.565) (-417.937) (-413.441) [-413.876] * (-413.264) (-412.740) (-413.191) [-412.000] -- 0:00:41
337000 -- (-416.573) (-415.489) [-412.895] (-415.037) * (-413.276) (-413.454) [-413.893] (-412.003) -- 0:00:41
337500 -- [-412.304] (-417.174) (-414.691) (-413.512) * (-415.250) (-418.500) [-413.829] (-413.220) -- 0:00:41
338000 -- (-412.856) (-412.656) [-412.954] (-414.434) * (-415.564) [-412.156] (-413.952) (-412.047) -- 0:00:41
338500 -- [-413.960] (-412.790) (-411.936) (-412.824) * (-413.875) (-413.493) (-414.067) [-417.525] -- 0:00:41
339000 -- [-415.230] (-415.850) (-411.777) (-414.729) * (-412.888) [-412.359] (-412.927) (-415.775) -- 0:00:40
339500 -- (-418.489) [-415.053] (-412.413) (-413.005) * (-413.880) (-413.470) [-414.728] (-413.916) -- 0:00:40
340000 -- (-417.594) (-412.489) (-412.656) [-412.357] * [-418.917] (-413.972) (-417.483) (-412.528) -- 0:00:40
Average standard deviation of split frequencies: 0.013919
340500 -- (-413.937) (-414.581) [-412.303] (-412.749) * (-420.980) [-417.389] (-413.804) (-412.694) -- 0:00:40
341000 -- (-413.953) (-412.230) [-413.150] (-412.135) * (-414.124) [-412.275] (-414.661) (-412.899) -- 0:00:40
341500 -- (-412.959) (-412.479) [-412.132] (-413.546) * (-413.351) (-412.221) [-413.998] (-418.096) -- 0:00:40
342000 -- (-418.070) (-411.989) (-413.421) [-416.098] * (-414.483) [-413.715] (-412.858) (-414.055) -- 0:00:40
342500 -- [-415.060] (-412.686) (-414.022) (-412.855) * [-415.761] (-417.116) (-419.508) (-413.918) -- 0:00:40
343000 -- (-415.812) (-419.193) (-415.062) [-418.353] * (-413.232) (-413.898) [-415.681] (-412.282) -- 0:00:40
343500 -- (-415.823) [-416.004] (-413.237) (-418.039) * [-413.978] (-416.991) (-413.141) (-414.935) -- 0:00:40
344000 -- (-412.224) (-413.198) (-416.065) [-413.021] * [-412.660] (-413.375) (-413.333) (-414.403) -- 0:00:40
344500 -- (-412.338) [-412.907] (-419.520) (-414.304) * (-413.360) (-415.557) [-413.143] (-416.389) -- 0:00:39
345000 -- (-415.071) (-414.811) (-421.521) [-413.509] * (-415.921) (-416.994) [-414.339] (-414.557) -- 0:00:39
Average standard deviation of split frequencies: 0.013945
345500 -- [-412.311] (-419.028) (-413.275) (-417.695) * (-417.510) (-412.841) [-413.974] (-414.405) -- 0:00:39
346000 -- (-412.865) [-412.422] (-412.996) (-414.195) * (-412.161) (-413.333) [-418.121] (-414.755) -- 0:00:39
346500 -- (-412.492) [-412.117] (-414.565) (-413.056) * (-412.818) [-415.364] (-413.905) (-413.930) -- 0:00:39
347000 -- (-412.185) (-414.485) [-413.480] (-414.393) * (-412.646) (-415.666) [-411.894] (-414.478) -- 0:00:39
347500 -- (-414.688) (-412.226) (-414.092) [-412.077] * [-412.961] (-416.312) (-413.583) (-417.176) -- 0:00:39
348000 -- (-414.294) (-412.941) (-413.954) [-415.686] * (-412.858) (-415.010) (-418.748) [-412.683] -- 0:00:39
348500 -- [-415.906] (-413.699) (-419.205) (-416.612) * [-414.119] (-414.121) (-413.653) (-413.789) -- 0:00:39
349000 -- [-416.778] (-414.864) (-414.670) (-415.614) * (-416.029) (-413.586) (-414.077) [-412.902] -- 0:00:39
349500 -- (-415.695) [-413.297] (-415.864) (-414.919) * (-413.046) (-413.139) [-412.216] (-414.059) -- 0:00:39
350000 -- [-413.071] (-414.604) (-413.740) (-414.041) * (-415.613) [-412.581] (-414.793) (-413.509) -- 0:00:39
Average standard deviation of split frequencies: 0.014866
350500 -- (-413.508) (-412.651) (-414.640) [-416.084] * (-415.582) [-412.044] (-414.506) (-415.096) -- 0:00:38
351000 -- (-413.439) (-412.609) (-412.717) [-413.566] * (-413.244) (-415.064) (-413.246) [-412.802] -- 0:00:38
351500 -- [-414.772] (-414.368) (-414.196) (-418.375) * (-412.619) (-416.776) (-415.385) [-414.483] -- 0:00:38
352000 -- [-414.131] (-413.750) (-414.196) (-420.081) * (-413.576) (-415.327) (-416.302) [-412.946] -- 0:00:38
352500 -- [-414.601] (-418.379) (-414.837) (-414.715) * (-414.042) [-414.745] (-414.711) (-413.719) -- 0:00:38
353000 -- (-412.516) [-411.961] (-416.352) (-417.511) * [-412.305] (-412.927) (-413.892) (-416.273) -- 0:00:38
353500 -- [-412.560] (-415.751) (-411.650) (-412.323) * (-412.932) (-414.362) (-416.267) [-414.709] -- 0:00:38
354000 -- (-414.362) [-413.000] (-412.994) (-413.745) * (-418.133) [-412.973] (-413.687) (-417.383) -- 0:00:40
354500 -- (-412.909) (-414.419) [-413.379] (-413.762) * (-415.030) (-414.501) [-413.184] (-415.839) -- 0:00:40
355000 -- (-415.590) [-414.690] (-412.405) (-415.887) * (-413.410) (-415.211) (-413.202) [-418.324] -- 0:00:39
Average standard deviation of split frequencies: 0.013242
355500 -- (-418.087) (-414.980) [-412.762] (-412.249) * [-414.053] (-417.129) (-416.060) (-412.336) -- 0:00:39
356000 -- (-416.911) (-413.487) [-412.395] (-412.012) * (-413.496) [-414.366] (-414.604) (-415.696) -- 0:00:39
356500 -- (-414.625) (-414.601) [-411.895] (-413.268) * (-416.783) (-413.168) [-413.174] (-413.386) -- 0:00:39
357000 -- (-414.835) [-412.349] (-415.354) (-412.115) * (-414.159) (-411.765) (-413.919) [-413.531] -- 0:00:39
357500 -- (-413.864) (-414.501) [-415.019] (-413.731) * (-416.474) (-413.696) (-416.325) [-413.902] -- 0:00:39
358000 -- (-414.622) [-412.989] (-414.162) (-414.020) * (-412.489) (-412.874) (-413.380) [-413.633] -- 0:00:39
358500 -- (-414.179) (-415.286) (-414.557) [-413.181] * (-413.055) (-412.162) [-412.362] (-414.596) -- 0:00:39
359000 -- (-415.520) (-412.262) [-415.097] (-413.082) * (-413.358) (-414.931) [-415.414] (-414.825) -- 0:00:39
359500 -- (-415.376) (-414.276) [-412.214] (-413.063) * (-414.409) [-412.817] (-416.050) (-420.108) -- 0:00:39
360000 -- (-415.864) (-414.006) (-412.599) [-412.504] * (-412.623) [-412.737] (-414.015) (-417.775) -- 0:00:39
Average standard deviation of split frequencies: 0.013796
360500 -- [-412.961] (-414.353) (-411.610) (-413.034) * (-413.475) [-415.768] (-414.387) (-417.670) -- 0:00:39
361000 -- (-415.489) (-415.938) (-422.176) [-413.670] * (-419.004) [-418.123] (-412.402) (-416.604) -- 0:00:38
361500 -- (-416.113) (-414.021) (-418.481) [-412.001] * [-414.732] (-413.101) (-415.179) (-414.864) -- 0:00:38
362000 -- [-414.526] (-415.028) (-415.716) (-414.292) * (-416.002) [-412.230] (-415.681) (-414.714) -- 0:00:38
362500 -- (-414.414) [-413.662] (-414.064) (-414.584) * (-416.805) (-416.354) [-414.161] (-416.535) -- 0:00:38
363000 -- (-413.026) (-411.648) (-411.827) [-414.259] * (-412.529) (-413.958) (-417.824) [-412.175] -- 0:00:38
363500 -- [-413.497] (-411.743) (-411.877) (-415.488) * [-412.645] (-414.156) (-419.728) (-414.096) -- 0:00:38
364000 -- (-414.121) [-412.807] (-412.581) (-415.264) * (-413.614) [-415.238] (-412.341) (-416.032) -- 0:00:38
364500 -- (-413.163) (-413.405) [-416.136] (-414.440) * (-417.001) (-417.927) [-412.145] (-414.328) -- 0:00:38
365000 -- (-415.278) [-412.304] (-416.590) (-412.612) * [-415.393] (-416.769) (-413.203) (-413.986) -- 0:00:38
Average standard deviation of split frequencies: 0.013739
365500 -- (-413.936) [-416.087] (-415.205) (-411.854) * (-413.440) (-412.625) (-414.228) [-412.228] -- 0:00:38
366000 -- (-413.407) [-412.042] (-416.745) (-412.279) * (-413.853) (-413.819) [-416.682] (-413.238) -- 0:00:38
366500 -- (-413.912) (-412.973) [-416.622] (-412.385) * (-412.973) [-413.544] (-412.720) (-414.157) -- 0:00:38
367000 -- (-412.879) (-414.684) [-413.398] (-412.684) * (-413.226) (-414.423) [-415.518] (-415.468) -- 0:00:37
367500 -- (-413.195) (-412.843) (-413.184) [-412.231] * (-418.694) (-416.310) [-413.149] (-412.872) -- 0:00:37
368000 -- (-414.556) (-415.864) (-412.268) [-411.610] * [-418.176] (-415.595) (-414.027) (-412.560) -- 0:00:37
368500 -- (-412.148) [-411.756] (-413.473) (-416.370) * (-414.363) (-412.938) (-414.129) [-414.492] -- 0:00:37
369000 -- [-413.243] (-418.314) (-416.527) (-415.912) * (-414.538) [-415.072] (-415.133) (-416.901) -- 0:00:37
369500 -- (-414.017) (-417.221) (-412.825) [-414.612] * (-413.727) [-412.837] (-414.825) (-416.218) -- 0:00:37
370000 -- (-414.600) (-417.822) (-412.953) [-413.849] * [-413.510] (-413.860) (-411.885) (-416.157) -- 0:00:37
Average standard deviation of split frequencies: 0.013566
370500 -- (-419.399) (-417.512) [-414.625] (-412.363) * [-412.288] (-414.651) (-414.408) (-414.784) -- 0:00:37
371000 -- (-412.789) (-416.841) [-415.130] (-413.456) * (-412.863) (-416.052) [-413.075] (-413.214) -- 0:00:38
371500 -- (-412.833) (-413.677) (-413.722) [-415.283] * (-414.173) [-412.866] (-413.104) (-414.373) -- 0:00:38
372000 -- (-413.568) [-412.993] (-412.624) (-414.293) * (-422.383) (-414.989) (-420.868) [-413.362] -- 0:00:38
372500 -- [-413.996] (-413.196) (-418.126) (-414.602) * (-413.360) (-412.646) (-412.592) [-413.261] -- 0:00:38
373000 -- (-413.414) (-414.107) (-412.318) [-412.459] * (-413.170) (-412.775) [-415.631] (-412.953) -- 0:00:38
373500 -- (-412.600) [-413.034] (-412.653) (-412.631) * (-413.221) (-417.213) (-412.482) [-414.295] -- 0:00:38
374000 -- (-413.357) (-413.000) [-411.669] (-413.076) * (-413.799) (-412.570) (-415.577) [-414.672] -- 0:00:38
374500 -- (-413.481) [-413.336] (-412.580) (-414.156) * [-416.229] (-414.332) (-417.702) (-414.386) -- 0:00:38
375000 -- [-417.700] (-416.726) (-413.602) (-413.946) * (-413.637) (-412.863) (-414.346) [-416.117] -- 0:00:38
Average standard deviation of split frequencies: 0.014139
375500 -- (-415.441) [-412.800] (-422.956) (-413.201) * [-411.990] (-414.487) (-413.924) (-413.930) -- 0:00:38
376000 -- [-412.800] (-412.034) (-414.164) (-412.397) * [-412.951] (-414.941) (-413.068) (-413.295) -- 0:00:38
376500 -- (-413.924) (-411.946) (-412.017) [-413.226] * (-412.052) (-420.309) (-413.024) [-414.323] -- 0:00:38
377000 -- [-414.297] (-414.283) (-412.234) (-413.217) * (-413.979) [-415.140] (-412.833) (-413.492) -- 0:00:38
377500 -- (-413.897) [-412.850] (-412.931) (-412.182) * (-414.600) (-416.163) (-413.580) [-414.932] -- 0:00:37
378000 -- (-413.322) (-415.975) [-417.827] (-416.590) * (-415.889) (-415.091) (-415.074) [-413.010] -- 0:00:37
378500 -- (-414.743) [-412.396] (-413.255) (-423.831) * (-413.462) (-413.853) (-414.553) [-415.464] -- 0:00:37
379000 -- [-412.376] (-413.364) (-412.050) (-416.209) * [-414.274] (-413.429) (-415.513) (-419.439) -- 0:00:37
379500 -- (-417.031) [-413.810] (-412.877) (-411.724) * [-415.139] (-415.734) (-416.043) (-412.010) -- 0:00:37
380000 -- (-417.549) (-415.520) [-412.748] (-412.317) * (-416.798) (-414.578) [-412.947] (-415.011) -- 0:00:37
Average standard deviation of split frequencies: 0.013403
380500 -- [-411.726] (-412.787) (-413.591) (-413.528) * (-418.042) [-414.873] (-412.586) (-412.079) -- 0:00:37
381000 -- (-415.712) (-415.425) [-414.492] (-412.613) * [-413.192] (-415.298) (-412.120) (-416.832) -- 0:00:37
381500 -- [-416.183] (-416.232) (-417.245) (-412.491) * [-413.117] (-413.406) (-413.571) (-414.329) -- 0:00:37
382000 -- (-415.571) [-414.702] (-418.241) (-413.340) * (-415.810) (-413.057) (-412.166) [-414.296] -- 0:00:37
382500 -- (-417.906) [-411.803] (-412.955) (-412.689) * (-417.620) (-413.704) (-412.002) [-415.507] -- 0:00:37
383000 -- [-413.293] (-414.548) (-412.520) (-414.572) * (-415.662) (-413.521) [-412.935] (-416.130) -- 0:00:37
383500 -- (-413.435) (-416.893) [-412.897] (-412.572) * (-413.898) (-417.620) (-413.671) [-413.268] -- 0:00:36
384000 -- (-412.515) [-413.403] (-412.586) (-414.481) * (-415.751) (-412.511) [-413.705] (-413.938) -- 0:00:36
384500 -- (-416.780) (-413.362) [-414.645] (-414.321) * (-415.067) (-415.249) [-413.880] (-413.775) -- 0:00:36
385000 -- (-412.520) [-413.354] (-416.633) (-418.071) * (-413.638) (-414.229) [-413.478] (-413.569) -- 0:00:36
Average standard deviation of split frequencies: 0.013977
385500 -- [-412.026] (-413.393) (-411.996) (-419.447) * (-412.715) (-412.171) (-414.908) [-412.647] -- 0:00:36
386000 -- [-413.944] (-415.546) (-414.192) (-415.314) * (-418.702) (-412.698) (-412.977) [-413.012] -- 0:00:36
386500 -- [-415.751] (-413.178) (-412.546) (-415.886) * (-413.546) [-416.302] (-414.369) (-417.461) -- 0:00:36
387000 -- (-416.125) (-416.003) (-413.123) [-414.899] * (-414.094) [-412.648] (-419.526) (-414.223) -- 0:00:36
387500 -- (-415.432) (-414.513) (-412.040) [-412.259] * (-413.506) (-412.592) (-415.383) [-412.789] -- 0:00:36
388000 -- [-412.443] (-412.879) (-414.542) (-413.693) * (-413.711) (-418.874) (-414.378) [-412.598] -- 0:00:37
388500 -- (-412.162) (-412.799) (-413.494) [-413.818] * [-413.455] (-414.106) (-416.076) (-417.658) -- 0:00:37
389000 -- (-414.849) [-413.154] (-417.072) (-414.236) * [-414.544] (-412.867) (-412.983) (-415.098) -- 0:00:37
389500 -- (-415.342) (-414.077) [-413.439] (-414.262) * (-412.429) (-414.667) (-414.254) [-415.932] -- 0:00:37
390000 -- (-415.740) (-414.902) [-416.610] (-412.606) * (-413.470) [-412.837] (-415.270) (-417.900) -- 0:00:37
Average standard deviation of split frequencies: 0.014409
390500 -- (-413.889) (-413.363) (-415.482) [-412.300] * [-413.186] (-413.696) (-416.126) (-420.394) -- 0:00:37
391000 -- (-413.320) (-416.010) [-413.965] (-414.239) * (-412.140) [-417.111] (-413.707) (-418.000) -- 0:00:37
391500 -- [-413.535] (-414.831) (-417.373) (-413.805) * (-417.796) (-414.892) [-417.053] (-417.605) -- 0:00:37
392000 -- [-413.157] (-418.477) (-412.490) (-413.190) * (-413.376) [-412.343] (-416.553) (-414.267) -- 0:00:37
392500 -- [-412.385] (-416.136) (-413.241) (-415.094) * (-413.378) [-412.409] (-418.904) (-414.489) -- 0:00:37
393000 -- (-413.205) (-414.927) (-413.674) [-414.885] * (-413.175) [-416.499] (-414.728) (-412.300) -- 0:00:37
393500 -- [-416.915] (-413.171) (-415.200) (-412.538) * (-413.630) [-413.865] (-414.128) (-413.634) -- 0:00:36
394000 -- [-413.584] (-413.974) (-414.212) (-414.217) * (-415.800) [-417.139] (-412.860) (-413.249) -- 0:00:36
394500 -- (-413.852) [-412.292] (-414.746) (-413.890) * [-415.338] (-414.188) (-414.885) (-412.774) -- 0:00:36
395000 -- [-413.059] (-412.154) (-413.316) (-413.580) * (-414.318) [-413.683] (-413.666) (-416.169) -- 0:00:36
Average standard deviation of split frequencies: 0.014355
395500 -- (-415.307) [-415.012] (-414.377) (-413.941) * (-417.047) (-414.272) [-415.656] (-418.762) -- 0:00:36
396000 -- (-415.858) (-417.241) (-413.322) [-412.960] * [-412.179] (-414.001) (-415.701) (-416.651) -- 0:00:36
396500 -- (-417.372) (-413.450) (-411.874) [-414.724] * (-412.899) (-414.326) [-414.015] (-413.381) -- 0:00:36
397000 -- [-414.715] (-414.937) (-414.135) (-412.866) * [-413.209] (-413.753) (-412.603) (-417.713) -- 0:00:36
397500 -- (-412.912) [-413.080] (-412.632) (-413.022) * [-412.523] (-419.719) (-414.040) (-414.510) -- 0:00:36
398000 -- [-413.579] (-420.797) (-415.406) (-413.965) * (-413.759) (-422.085) (-417.359) [-415.056] -- 0:00:36
398500 -- (-412.717) (-417.311) [-413.579] (-413.930) * (-416.012) [-416.439] (-416.739) (-413.650) -- 0:00:36
399000 -- (-413.704) (-415.554) (-419.040) [-413.054] * (-413.661) (-414.322) [-416.019] (-416.637) -- 0:00:36
399500 -- (-413.069) (-414.441) [-413.711] (-414.998) * (-417.172) (-415.854) (-416.062) [-414.105] -- 0:00:36
400000 -- [-413.370] (-413.387) (-413.079) (-412.714) * (-416.011) [-416.127] (-412.309) (-413.545) -- 0:00:36
Average standard deviation of split frequencies: 0.014045
400500 -- [-411.798] (-413.700) (-415.764) (-414.500) * (-416.168) [-413.650] (-418.349) (-416.986) -- 0:00:35
401000 -- (-415.801) (-414.939) [-413.451] (-414.564) * [-412.876] (-414.610) (-415.591) (-414.609) -- 0:00:35
401500 -- (-413.436) (-413.895) (-412.988) [-413.503] * [-412.193] (-412.104) (-413.838) (-412.712) -- 0:00:35
402000 -- (-412.910) [-416.111] (-413.268) (-412.812) * (-411.842) (-412.105) [-414.815] (-413.332) -- 0:00:35
402500 -- (-414.403) (-415.124) [-411.881] (-415.595) * [-412.981] (-416.832) (-414.133) (-413.098) -- 0:00:35
403000 -- [-414.827] (-414.141) (-411.971) (-413.656) * [-412.500] (-417.121) (-414.421) (-412.742) -- 0:00:35
403500 -- (-413.399) (-413.603) (-412.289) [-412.141] * (-413.884) [-413.047] (-412.170) (-412.793) -- 0:00:35
404000 -- (-413.981) (-414.550) [-417.612] (-414.691) * [-414.490] (-414.170) (-412.945) (-415.561) -- 0:00:35
404500 -- (-413.252) [-412.943] (-416.658) (-415.826) * (-415.831) (-415.648) (-415.484) [-412.795] -- 0:00:35
405000 -- [-416.449] (-416.522) (-413.229) (-414.114) * (-412.660) (-412.624) [-412.982] (-415.318) -- 0:00:35
Average standard deviation of split frequencies: 0.013660
405500 -- (-417.377) [-416.158] (-414.745) (-419.734) * (-413.687) (-413.176) [-414.246] (-412.220) -- 0:00:36
406000 -- (-413.190) (-420.862) [-414.202] (-414.260) * (-415.058) [-413.218] (-411.982) (-412.559) -- 0:00:36
406500 -- [-414.395] (-413.914) (-415.732) (-413.386) * (-412.996) (-413.160) [-412.075] (-415.307) -- 0:00:36
407000 -- [-415.658] (-414.259) (-412.996) (-415.566) * (-420.029) (-413.705) (-415.258) [-413.514] -- 0:00:36
407500 -- (-413.209) [-412.998] (-416.348) (-414.859) * (-419.967) (-415.529) [-415.350] (-416.307) -- 0:00:36
408000 -- [-413.106] (-412.922) (-413.193) (-417.635) * (-412.176) (-413.927) (-414.116) [-415.146] -- 0:00:36
408500 -- (-415.120) [-412.893] (-415.526) (-420.544) * (-412.713) (-416.389) [-414.278] (-414.968) -- 0:00:36
409000 -- [-414.355] (-412.485) (-416.699) (-415.600) * (-413.461) [-413.589] (-413.756) (-413.286) -- 0:00:36
409500 -- (-414.657) (-413.755) [-413.744] (-412.856) * (-413.359) (-413.402) [-414.086] (-416.469) -- 0:00:36
410000 -- (-413.065) (-415.286) [-414.777] (-417.819) * (-415.758) (-416.549) [-414.638] (-416.187) -- 0:00:35
Average standard deviation of split frequencies: 0.012770
410500 -- (-414.240) [-417.082] (-413.525) (-416.809) * (-414.079) (-420.323) [-415.204] (-413.923) -- 0:00:35
411000 -- [-414.870] (-413.109) (-412.297) (-416.546) * (-414.182) (-422.835) (-414.791) [-412.804] -- 0:00:35
411500 -- (-413.674) (-413.549) (-412.880) [-412.725] * (-416.584) [-414.387] (-412.751) (-417.591) -- 0:00:35
412000 -- (-411.902) (-413.362) [-416.694] (-416.756) * (-412.534) [-414.362] (-418.925) (-415.649) -- 0:00:35
412500 -- (-414.522) [-415.589] (-415.562) (-418.311) * (-412.440) (-412.580) [-415.388] (-414.787) -- 0:00:35
413000 -- (-412.716) [-412.357] (-412.431) (-412.909) * [-412.200] (-412.422) (-413.043) (-413.963) -- 0:00:35
413500 -- [-416.511] (-412.922) (-412.197) (-413.225) * [-413.212] (-412.360) (-416.499) (-414.979) -- 0:00:35
414000 -- (-414.145) [-414.675] (-413.278) (-414.568) * (-413.461) (-413.094) [-415.115] (-415.141) -- 0:00:35
414500 -- (-412.045) [-413.487] (-411.940) (-412.610) * (-413.083) (-412.939) (-417.078) [-412.095] -- 0:00:35
415000 -- (-412.425) (-416.405) (-412.279) [-414.268] * (-413.080) [-412.834] (-413.393) (-415.074) -- 0:00:35
Average standard deviation of split frequencies: 0.012819
415500 -- (-412.629) (-416.650) (-411.961) [-412.165] * (-413.589) (-416.173) (-413.876) [-416.912] -- 0:00:35
416000 -- (-413.777) (-417.224) (-412.843) [-412.261] * (-417.082) (-417.479) (-412.138) [-413.434] -- 0:00:35
416500 -- (-414.297) (-415.587) (-415.345) [-412.725] * [-415.046] (-415.307) (-415.359) (-422.178) -- 0:00:35
417000 -- (-412.468) (-416.337) (-413.657) [-415.716] * (-414.148) (-413.686) [-414.206] (-421.479) -- 0:00:34
417500 -- (-411.844) (-421.178) (-413.401) [-413.292] * [-413.880] (-413.385) (-412.115) (-416.235) -- 0:00:34
418000 -- (-413.024) (-417.295) [-414.165] (-415.251) * [-414.161] (-412.575) (-412.145) (-414.639) -- 0:00:34
418500 -- [-414.646] (-412.515) (-413.433) (-417.798) * (-422.220) (-415.237) (-412.296) [-414.519] -- 0:00:34
419000 -- (-412.740) (-414.611) (-414.387) [-416.158] * (-422.059) (-413.172) [-414.936] (-414.018) -- 0:00:34
419500 -- (-413.060) (-413.542) [-414.669] (-413.875) * (-414.149) (-413.129) [-415.245] (-412.316) -- 0:00:34
420000 -- (-413.111) (-414.595) (-414.542) [-413.122] * (-414.208) (-416.001) (-415.469) [-415.386] -- 0:00:34
Average standard deviation of split frequencies: 0.012524
420500 -- (-413.510) (-414.544) (-415.741) [-412.724] * [-413.876] (-414.838) (-413.258) (-416.510) -- 0:00:34
421000 -- (-414.513) (-417.091) (-414.831) [-413.419] * (-414.506) [-413.663] (-416.427) (-413.462) -- 0:00:34
421500 -- [-414.583] (-415.663) (-417.778) (-413.725) * (-414.814) (-413.410) [-414.530] (-412.949) -- 0:00:34
422000 -- (-413.480) (-415.598) (-413.098) [-412.932] * (-414.014) (-413.335) (-415.656) [-413.305] -- 0:00:35
422500 -- (-411.768) [-412.746] (-414.454) (-418.082) * (-413.131) (-414.264) (-420.223) [-414.383] -- 0:00:35
423000 -- [-412.769] (-416.668) (-416.769) (-413.015) * (-412.810) (-412.710) [-415.941] (-415.434) -- 0:00:35
423500 -- (-415.719) (-415.855) (-416.128) [-414.530] * (-412.818) (-413.663) (-418.587) [-413.123] -- 0:00:35
424000 -- (-412.211) [-413.922] (-413.405) (-414.032) * (-413.113) (-413.766) (-414.727) [-412.294] -- 0:00:35
424500 -- (-412.731) (-414.280) [-411.971] (-413.099) * (-417.443) (-413.077) (-416.387) [-413.762] -- 0:00:35
425000 -- (-413.557) [-412.292] (-412.282) (-412.732) * (-416.950) [-414.981] (-411.837) (-413.745) -- 0:00:35
Average standard deviation of split frequencies: 0.013002
425500 -- (-414.730) (-412.185) (-415.301) [-413.421] * (-417.348) (-412.559) (-412.188) [-414.181] -- 0:00:35
426000 -- [-413.640] (-415.656) (-414.621) (-412.252) * (-417.063) [-412.475] (-415.387) (-414.502) -- 0:00:35
426500 -- (-412.834) (-415.501) [-414.573] (-412.243) * (-416.398) (-413.042) (-418.165) [-413.564] -- 0:00:34
427000 -- (-416.450) (-413.574) (-413.415) [-416.332] * (-415.266) (-412.854) (-418.221) [-412.593] -- 0:00:34
427500 -- (-417.459) (-414.938) (-414.921) [-415.303] * (-414.278) (-414.358) [-415.275] (-412.468) -- 0:00:34
428000 -- (-419.856) (-414.640) [-415.616] (-413.449) * (-413.705) [-412.259] (-417.244) (-412.606) -- 0:00:34
428500 -- (-419.206) [-414.859] (-415.797) (-412.268) * [-413.272] (-412.751) (-418.501) (-414.568) -- 0:00:34
429000 -- [-414.744] (-413.498) (-412.857) (-413.366) * (-413.582) (-414.800) (-414.525) [-414.539] -- 0:00:34
429500 -- [-413.709] (-412.547) (-415.562) (-412.933) * (-415.499) (-416.500) [-412.643] (-416.962) -- 0:00:34
430000 -- (-417.775) [-417.879] (-412.823) (-414.685) * (-415.325) (-414.109) [-413.152] (-413.670) -- 0:00:34
Average standard deviation of split frequencies: 0.012177
430500 -- (-412.868) (-418.578) [-411.871] (-422.193) * (-414.008) (-412.817) (-415.724) [-414.017] -- 0:00:34
431000 -- [-412.719] (-413.081) (-412.528) (-414.762) * [-417.408] (-419.228) (-413.488) (-417.411) -- 0:00:34
431500 -- [-415.303] (-414.507) (-414.398) (-416.451) * (-412.959) [-419.771] (-416.059) (-413.658) -- 0:00:34
432000 -- (-412.851) [-414.836] (-413.337) (-413.077) * (-412.930) [-415.342] (-415.356) (-416.030) -- 0:00:34
432500 -- (-414.269) (-413.554) [-411.956] (-413.296) * (-416.966) [-412.973] (-413.292) (-416.340) -- 0:00:34
433000 -- [-412.054] (-414.182) (-412.341) (-413.418) * (-414.794) [-411.606] (-414.592) (-413.564) -- 0:00:34
433500 -- (-412.444) [-413.971] (-412.825) (-414.860) * (-416.223) (-411.982) [-414.293] (-413.265) -- 0:00:33
434000 -- (-411.947) (-411.894) (-412.772) [-415.371] * [-415.185] (-411.671) (-414.835) (-414.861) -- 0:00:33
434500 -- (-413.715) [-411.941] (-412.455) (-413.448) * (-413.644) (-413.302) [-415.459] (-412.860) -- 0:00:33
435000 -- [-413.195] (-415.241) (-416.077) (-414.589) * (-414.678) (-412.815) [-414.568] (-412.782) -- 0:00:33
Average standard deviation of split frequencies: 0.012231
435500 -- (-412.976) (-414.704) (-412.751) [-415.432] * [-412.711] (-414.257) (-412.814) (-412.454) -- 0:00:33
436000 -- (-415.641) (-415.265) (-413.261) [-414.433] * (-412.517) [-415.394] (-412.953) (-414.469) -- 0:00:33
436500 -- (-412.027) (-417.621) (-412.839) [-412.877] * (-413.216) (-414.640) (-413.347) [-416.125] -- 0:00:33
437000 -- [-413.287] (-418.706) (-415.182) (-413.733) * (-415.094) (-417.423) [-412.471] (-414.081) -- 0:00:33
437500 -- (-414.945) [-418.899] (-412.244) (-412.668) * (-415.719) (-416.755) (-414.494) [-413.746] -- 0:00:33
438000 -- [-414.744] (-411.949) (-414.592) (-412.381) * [-420.234] (-412.383) (-412.904) (-414.405) -- 0:00:33
438500 -- [-412.448] (-413.402) (-413.710) (-413.254) * (-417.229) [-413.955] (-415.753) (-413.453) -- 0:00:33
439000 -- (-423.340) (-413.900) [-412.927] (-413.012) * (-413.516) [-413.736] (-418.600) (-418.767) -- 0:00:33
439500 -- (-413.329) [-413.734] (-413.297) (-413.338) * (-414.127) (-412.912) [-412.410] (-415.616) -- 0:00:34
440000 -- (-414.341) [-417.470] (-417.299) (-414.657) * (-417.336) [-413.350] (-414.549) (-418.298) -- 0:00:34
Average standard deviation of split frequencies: 0.011099
440500 -- (-414.554) (-413.430) [-413.844] (-413.055) * [-412.858] (-413.725) (-416.078) (-417.361) -- 0:00:34
441000 -- (-413.802) (-411.830) (-413.370) [-413.812] * [-414.748] (-414.132) (-414.565) (-414.298) -- 0:00:34
441500 -- [-412.118] (-412.389) (-413.093) (-414.633) * (-413.561) (-417.416) (-420.637) [-414.255] -- 0:00:34
442000 -- [-415.027] (-415.674) (-415.148) (-414.801) * [-414.277] (-412.804) (-421.010) (-413.290) -- 0:00:34
442500 -- (-412.512) (-412.930) [-414.919] (-412.548) * [-414.129] (-412.557) (-412.236) (-413.663) -- 0:00:34
443000 -- (-415.821) (-417.818) (-414.221) [-413.577] * (-415.113) (-415.488) (-415.436) [-412.050] -- 0:00:33
443500 -- (-416.490) (-415.071) [-412.512] (-413.897) * (-414.952) (-413.408) [-412.845] (-414.644) -- 0:00:33
444000 -- (-413.248) (-415.631) (-412.533) [-416.892] * [-412.869] (-413.662) (-412.936) (-412.828) -- 0:00:33
444500 -- [-412.793] (-413.828) (-414.876) (-416.982) * (-416.656) (-413.816) [-412.475] (-411.719) -- 0:00:33
445000 -- (-413.791) (-414.674) (-413.920) [-413.025] * [-413.960] (-413.538) (-413.167) (-416.700) -- 0:00:33
Average standard deviation of split frequencies: 0.010880
445500 -- [-416.361] (-413.353) (-412.995) (-412.576) * [-414.821] (-413.329) (-412.680) (-415.257) -- 0:00:33
446000 -- (-419.458) (-413.946) [-411.736] (-412.034) * [-414.956] (-414.816) (-412.231) (-415.048) -- 0:00:33
446500 -- (-416.291) (-411.994) (-415.133) [-415.191] * (-412.120) [-413.679] (-413.010) (-418.527) -- 0:00:33
447000 -- [-413.382] (-419.315) (-412.459) (-414.397) * (-413.920) (-412.796) [-412.268] (-414.119) -- 0:00:33
447500 -- [-412.138] (-412.372) (-413.402) (-412.340) * (-413.940) (-414.549) (-414.972) [-414.438] -- 0:00:33
448000 -- (-413.565) [-413.534] (-411.871) (-413.043) * (-414.164) (-414.151) [-413.581] (-413.503) -- 0:00:33
448500 -- [-413.583] (-414.066) (-414.377) (-413.739) * (-413.547) (-416.253) (-416.170) [-412.436] -- 0:00:33
449000 -- (-416.200) [-413.594] (-413.583) (-414.561) * (-414.784) (-413.225) [-413.191] (-414.947) -- 0:00:33
449500 -- [-413.999] (-416.224) (-414.077) (-414.629) * (-416.273) [-415.522] (-413.731) (-412.095) -- 0:00:33
450000 -- (-414.685) [-414.427] (-414.369) (-411.985) * (-412.371) (-413.159) (-413.852) [-413.951] -- 0:00:33
Average standard deviation of split frequencies: 0.011075
450500 -- [-411.991] (-415.582) (-413.368) (-412.840) * (-412.512) [-415.017] (-414.724) (-415.891) -- 0:00:32
451000 -- (-415.111) (-413.451) [-414.073] (-412.701) * [-413.880] (-415.516) (-414.136) (-414.577) -- 0:00:32
451500 -- (-413.812) (-412.753) (-414.926) [-412.718] * (-416.572) (-419.699) (-412.641) [-415.698] -- 0:00:32
452000 -- (-413.694) (-414.846) [-415.684] (-417.057) * [-416.387] (-415.878) (-412.866) (-413.902) -- 0:00:32
452500 -- (-414.361) [-414.994] (-413.756) (-415.475) * [-413.287] (-416.093) (-414.795) (-412.916) -- 0:00:32
453000 -- [-415.489] (-413.441) (-414.446) (-413.815) * (-412.335) (-414.414) [-413.147] (-412.078) -- 0:00:32
453500 -- [-413.394] (-412.026) (-415.213) (-416.674) * [-415.943] (-412.850) (-412.187) (-412.995) -- 0:00:32
454000 -- (-413.342) (-412.767) [-414.328] (-412.371) * (-413.965) (-412.169) [-414.988] (-412.247) -- 0:00:32
454500 -- (-412.498) (-415.713) (-414.117) [-412.864] * (-417.878) (-413.643) (-413.078) [-413.483] -- 0:00:32
455000 -- [-414.502] (-415.724) (-413.166) (-414.369) * (-415.791) (-413.229) (-412.672) [-413.684] -- 0:00:32
Average standard deviation of split frequencies: 0.011189
455500 -- (-413.791) (-412.196) [-413.149] (-414.629) * [-413.241] (-414.925) (-415.701) (-413.393) -- 0:00:32
456000 -- (-414.577) (-413.824) (-413.148) [-414.714] * (-413.533) (-413.098) (-416.291) [-413.641] -- 0:00:32
456500 -- (-413.227) (-415.670) [-412.324] (-412.539) * (-413.709) [-416.068] (-412.525) (-412.391) -- 0:00:33
457000 -- (-414.624) (-412.578) (-419.633) [-412.824] * (-415.190) [-412.881] (-413.557) (-412.288) -- 0:00:33
457500 -- (-414.188) [-415.896] (-414.821) (-415.773) * (-414.528) (-413.630) (-413.507) [-414.997] -- 0:00:33
458000 -- (-412.361) [-414.772] (-412.161) (-420.073) * (-414.178) [-414.170] (-412.575) (-414.848) -- 0:00:33
458500 -- (-412.319) (-412.785) [-413.187] (-412.290) * (-412.828) (-413.338) [-415.247] (-416.761) -- 0:00:33
459000 -- (-416.546) (-414.510) [-412.110] (-414.040) * [-414.529] (-412.048) (-414.040) (-413.077) -- 0:00:33
459500 -- (-413.821) (-412.347) (-413.407) [-412.973] * [-414.148] (-413.566) (-413.484) (-415.881) -- 0:00:32
460000 -- (-414.512) (-413.139) (-413.294) [-412.045] * (-414.029) (-411.987) [-414.442] (-414.356) -- 0:00:32
Average standard deviation of split frequencies: 0.010489
460500 -- (-414.808) (-416.178) [-414.773] (-415.733) * [-414.276] (-414.841) (-412.966) (-413.186) -- 0:00:32
461000 -- (-413.844) (-413.303) (-416.791) [-412.668] * (-413.156) [-415.810] (-418.828) (-412.712) -- 0:00:32
461500 -- (-415.032) [-412.749] (-413.935) (-412.997) * [-414.096] (-417.798) (-415.914) (-413.844) -- 0:00:32
462000 -- (-414.403) (-415.058) [-415.123] (-415.829) * (-421.787) (-414.755) [-413.990] (-413.151) -- 0:00:32
462500 -- (-413.082) [-414.561] (-418.873) (-415.259) * (-415.670) (-419.306) [-417.457] (-412.978) -- 0:00:32
463000 -- (-412.854) (-413.536) (-415.724) [-412.515] * (-415.260) (-418.310) (-413.457) [-413.259] -- 0:00:32
463500 -- (-413.316) [-413.891] (-416.183) (-412.393) * (-412.790) (-414.710) (-413.623) [-413.010] -- 0:00:32
464000 -- (-414.584) (-415.090) [-413.446] (-415.857) * [-416.495] (-415.154) (-413.066) (-412.812) -- 0:00:32
464500 -- [-414.472] (-416.355) (-413.793) (-412.672) * (-413.242) [-413.315] (-418.092) (-418.821) -- 0:00:32
465000 -- [-416.724] (-417.624) (-413.806) (-412.065) * [-416.142] (-413.150) (-416.519) (-418.022) -- 0:00:32
Average standard deviation of split frequencies: 0.010748
465500 -- [-415.472] (-412.460) (-415.788) (-413.869) * [-412.785] (-413.657) (-414.483) (-414.126) -- 0:00:32
466000 -- (-414.348) (-417.537) (-413.392) [-414.817] * (-414.028) (-415.526) [-415.546] (-413.283) -- 0:00:32
466500 -- (-414.650) [-413.824] (-415.863) (-413.679) * [-413.178] (-415.648) (-413.552) (-413.574) -- 0:00:32
467000 -- [-414.954] (-412.867) (-420.428) (-414.808) * (-414.122) (-416.891) [-415.683] (-412.193) -- 0:00:31
467500 -- (-412.318) (-414.779) [-417.301] (-415.139) * (-414.320) (-413.697) [-414.202] (-413.334) -- 0:00:31
468000 -- (-413.437) (-417.788) (-417.596) [-415.265] * (-419.044) (-412.087) (-413.944) [-413.119] -- 0:00:31
468500 -- (-414.139) (-413.173) (-412.361) [-413.598] * (-413.868) (-413.561) [-413.574] (-418.943) -- 0:00:31
469000 -- (-412.295) (-417.695) (-414.932) [-411.950] * [-412.478] (-412.677) (-413.998) (-414.149) -- 0:00:31
469500 -- (-414.491) (-419.886) [-412.603] (-412.657) * (-414.243) [-412.613] (-412.260) (-418.164) -- 0:00:31
470000 -- (-411.944) [-413.329] (-413.270) (-412.706) * (-413.190) (-416.905) [-412.516] (-412.908) -- 0:00:31
Average standard deviation of split frequencies: 0.010391
470500 -- (-413.294) (-416.867) (-412.866) [-413.642] * (-416.719) (-414.708) [-415.869] (-412.787) -- 0:00:31
471000 -- [-412.056] (-413.764) (-415.914) (-414.598) * [-419.417] (-413.582) (-412.032) (-416.907) -- 0:00:31
471500 -- (-413.850) [-413.583] (-420.964) (-415.427) * (-414.208) (-414.409) (-412.517) [-413.232] -- 0:00:31
472000 -- (-413.444) (-416.305) (-414.468) [-415.988] * (-415.418) (-419.059) (-412.916) [-413.992] -- 0:00:31
472500 -- (-412.911) (-413.873) [-413.772] (-416.580) * (-414.126) [-412.534] (-414.055) (-412.364) -- 0:00:31
473000 -- (-412.946) (-415.664) (-414.417) [-416.654] * (-412.010) (-414.860) (-415.782) [-412.516] -- 0:00:31
473500 -- (-413.637) [-412.542] (-411.728) (-417.866) * [-416.441] (-413.793) (-414.854) (-415.778) -- 0:00:32
474000 -- (-416.104) [-413.133] (-413.737) (-417.239) * (-412.412) (-413.987) (-416.653) [-417.885] -- 0:00:32
474500 -- [-414.175] (-414.281) (-418.953) (-413.170) * [-412.700] (-414.805) (-415.348) (-419.090) -- 0:00:32
475000 -- [-411.943] (-413.296) (-413.044) (-413.167) * (-415.957) (-414.382) [-413.376] (-411.851) -- 0:00:32
Average standard deviation of split frequencies: 0.009594
475500 -- (-412.806) (-414.950) (-417.388) [-412.095] * (-412.129) (-415.134) (-412.314) [-412.226] -- 0:00:31
476000 -- (-416.678) (-418.265) [-413.137] (-414.694) * (-414.195) (-411.960) [-415.559] (-412.836) -- 0:00:31
476500 -- (-415.067) (-414.646) (-413.011) [-415.682] * [-415.913] (-412.076) (-415.663) (-413.993) -- 0:00:31
477000 -- (-414.015) [-417.622] (-412.965) (-412.966) * (-415.111) (-412.827) [-416.693] (-413.271) -- 0:00:31
477500 -- [-413.616] (-417.574) (-413.726) (-417.507) * (-417.918) (-415.269) [-412.878] (-417.053) -- 0:00:31
478000 -- (-417.849) [-412.543] (-412.143) (-415.867) * [-412.201] (-413.790) (-412.422) (-414.265) -- 0:00:31
478500 -- (-416.469) (-412.655) [-413.370] (-414.908) * (-415.597) (-412.510) (-415.902) [-414.800] -- 0:00:31
479000 -- [-412.054] (-417.424) (-412.375) (-416.254) * (-414.066) (-413.078) [-412.339] (-413.548) -- 0:00:31
479500 -- (-412.431) [-412.899] (-413.908) (-412.644) * (-412.235) (-417.109) [-412.358] (-412.992) -- 0:00:31
480000 -- (-416.809) (-412.337) (-413.871) [-412.519] * [-414.047] (-417.265) (-413.435) (-413.675) -- 0:00:31
Average standard deviation of split frequencies: 0.009980
480500 -- (-413.193) (-415.736) (-413.265) [-418.163] * [-414.196] (-414.121) (-414.214) (-414.196) -- 0:00:31
481000 -- (-413.686) (-416.051) [-412.973] (-416.074) * (-415.152) (-413.980) [-414.605] (-415.707) -- 0:00:31
481500 -- (-413.417) (-412.088) [-414.249] (-412.413) * (-412.388) (-413.435) (-414.469) [-414.934] -- 0:00:31
482000 -- (-419.341) (-412.273) [-411.607] (-415.614) * (-416.840) (-412.980) (-412.791) [-412.649] -- 0:00:31
482500 -- [-414.868] (-412.647) (-414.710) (-412.610) * (-418.762) [-413.804] (-414.154) (-413.602) -- 0:00:31
483000 -- (-414.235) (-413.632) (-413.722) [-417.023] * (-418.657) (-412.855) (-414.790) [-414.424] -- 0:00:31
483500 -- (-412.899) [-414.722] (-412.827) (-414.590) * (-417.549) (-412.317) [-413.914] (-412.413) -- 0:00:30
484000 -- (-412.249) (-416.296) [-413.482] (-412.494) * (-411.866) [-412.900] (-413.792) (-417.187) -- 0:00:30
484500 -- [-415.559] (-414.676) (-415.273) (-415.903) * (-411.919) [-413.106] (-415.540) (-414.496) -- 0:00:30
485000 -- (-414.880) [-415.555] (-418.139) (-413.026) * (-415.161) (-414.521) [-413.185] (-414.420) -- 0:00:30
Average standard deviation of split frequencies: 0.009871
485500 -- (-414.226) (-412.866) (-413.628) [-415.518] * (-415.120) (-415.389) [-413.207] (-419.984) -- 0:00:30
486000 -- (-415.070) (-413.037) (-413.731) [-413.200] * (-416.346) [-414.575] (-412.868) (-415.808) -- 0:00:30
486500 -- (-416.172) (-415.831) (-412.516) [-415.290] * (-411.858) (-414.915) [-412.346] (-413.771) -- 0:00:30
487000 -- (-415.474) (-416.075) [-412.357] (-413.748) * (-413.980) (-412.801) [-412.084] (-415.040) -- 0:00:30
487500 -- (-412.842) (-413.508) (-417.489) [-412.082] * (-413.775) [-413.997] (-414.107) (-413.753) -- 0:00:30
488000 -- [-413.440] (-411.735) (-411.998) (-414.304) * (-413.591) (-415.134) [-412.528] (-412.044) -- 0:00:30
488500 -- (-413.325) (-412.359) (-412.506) [-417.019] * (-413.197) (-414.530) [-411.706] (-412.314) -- 0:00:30
489000 -- (-415.446) (-412.630) [-416.038] (-414.235) * [-414.139] (-414.531) (-412.953) (-413.369) -- 0:00:30
489500 -- (-415.245) (-412.791) [-413.103] (-412.849) * [-412.332] (-416.768) (-412.202) (-414.514) -- 0:00:30
490000 -- (-413.630) (-414.327) [-413.108] (-412.042) * [-413.009] (-414.535) (-411.733) (-413.502) -- 0:00:30
Average standard deviation of split frequencies: 0.009968
490500 -- [-414.989] (-412.891) (-412.987) (-414.538) * (-414.844) [-414.945] (-411.967) (-412.298) -- 0:00:31
491000 -- (-418.715) (-412.440) (-414.823) [-412.567] * (-416.172) (-415.835) (-416.467) [-412.749] -- 0:00:31
491500 -- (-412.639) (-412.356) [-413.687] (-411.736) * (-414.555) (-413.312) (-414.512) [-413.790] -- 0:00:31
492000 -- [-412.561] (-417.205) (-418.131) (-414.103) * (-415.752) [-414.023] (-412.792) (-412.370) -- 0:00:30
492500 -- (-413.038) [-413.827] (-414.717) (-417.049) * (-414.016) [-413.556] (-413.181) (-414.035) -- 0:00:30
493000 -- (-415.815) (-415.851) (-413.411) [-413.036] * (-419.378) (-414.014) [-413.648] (-414.711) -- 0:00:30
493500 -- (-414.441) (-415.647) (-415.294) [-413.185] * (-416.200) (-415.689) (-413.173) [-412.504] -- 0:00:30
494000 -- [-414.062] (-412.811) (-412.284) (-414.519) * (-413.268) (-412.943) [-413.432] (-414.315) -- 0:00:30
494500 -- (-416.700) (-414.846) (-416.215) [-414.426] * (-413.599) (-413.804) [-413.140] (-414.450) -- 0:00:30
495000 -- (-412.813) (-418.785) (-415.078) [-412.112] * (-414.171) (-414.061) [-413.359] (-413.747) -- 0:00:30
Average standard deviation of split frequencies: 0.009979
495500 -- (-414.464) (-419.547) [-415.747] (-412.466) * (-417.811) [-416.263] (-412.143) (-413.272) -- 0:00:30
496000 -- [-414.492] (-414.845) (-416.540) (-414.851) * (-415.556) (-412.930) (-412.613) [-412.145] -- 0:00:30
496500 -- (-413.161) (-414.619) [-414.131] (-417.675) * (-412.608) (-412.585) (-417.203) [-413.369] -- 0:00:30
497000 -- (-416.742) (-415.269) [-412.765] (-412.154) * [-413.597] (-413.206) (-415.327) (-415.532) -- 0:00:30
497500 -- [-412.864] (-418.333) (-412.346) (-416.685) * (-412.584) [-415.595] (-415.228) (-414.380) -- 0:00:30
498000 -- (-414.847) (-416.748) [-414.483] (-413.780) * (-413.555) (-413.877) (-413.193) [-414.970] -- 0:00:30
498500 -- (-418.193) (-412.366) [-412.568] (-414.065) * [-413.459] (-414.754) (-412.617) (-413.908) -- 0:00:30
499000 -- (-413.091) (-414.659) (-412.285) [-414.068] * (-415.172) [-412.752] (-412.341) (-412.607) -- 0:00:30
499500 -- [-412.514] (-415.513) (-419.401) (-415.217) * (-412.298) (-412.604) [-412.913] (-413.215) -- 0:00:30
500000 -- (-414.038) (-413.490) [-414.702] (-412.343) * [-412.567] (-412.371) (-415.689) (-415.119) -- 0:00:30
Average standard deviation of split frequencies: 0.010357
500500 -- (-414.542) [-413.210] (-415.082) (-413.308) * (-414.424) (-419.460) (-417.192) [-413.477] -- 0:00:29
501000 -- [-414.264] (-412.727) (-412.370) (-412.629) * (-412.903) (-416.740) (-416.875) [-416.210] -- 0:00:29
501500 -- (-415.261) (-418.705) (-414.806) [-413.663] * (-414.764) [-417.024] (-414.528) (-414.903) -- 0:00:29
502000 -- [-412.356] (-414.728) (-415.430) (-415.053) * [-414.511] (-415.785) (-413.180) (-415.480) -- 0:00:29
502500 -- (-412.339) (-414.834) (-419.161) [-414.700] * [-416.306] (-416.731) (-414.595) (-412.186) -- 0:00:29
503000 -- [-412.424] (-415.693) (-413.183) (-414.483) * (-413.315) [-415.588] (-414.395) (-412.971) -- 0:00:29
503500 -- [-415.515] (-413.963) (-413.095) (-411.863) * [-415.119] (-413.866) (-414.343) (-412.439) -- 0:00:29
504000 -- (-414.010) [-413.562] (-413.529) (-413.436) * (-417.257) (-413.706) [-411.865] (-413.609) -- 0:00:29
504500 -- (-415.544) [-414.547] (-415.424) (-412.134) * (-413.195) [-416.510] (-414.125) (-413.647) -- 0:00:29
505000 -- (-419.689) (-413.587) (-412.681) [-411.819] * [-412.246] (-418.710) (-414.004) (-417.079) -- 0:00:29
Average standard deviation of split frequencies: 0.010303
505500 -- (-416.946) (-414.240) (-413.024) [-412.640] * [-413.127] (-417.409) (-413.421) (-417.214) -- 0:00:29
506000 -- (-413.176) (-414.345) (-414.873) [-414.249] * (-415.388) (-414.863) [-412.519] (-415.306) -- 0:00:29
506500 -- (-414.827) (-417.064) [-412.888] (-414.084) * (-416.642) (-416.496) [-416.548] (-412.650) -- 0:00:29
507000 -- [-415.245] (-423.636) (-412.622) (-418.163) * (-414.855) [-414.261] (-418.158) (-413.148) -- 0:00:29
507500 -- (-414.260) (-418.454) [-413.679] (-414.841) * (-417.950) [-412.440] (-412.985) (-413.528) -- 0:00:30
508000 -- (-418.627) [-414.238] (-416.017) (-414.584) * (-415.544) (-412.238) (-413.201) [-414.775] -- 0:00:30
508500 -- (-417.189) (-412.586) [-417.331] (-414.772) * (-411.921) [-412.753] (-416.063) (-413.948) -- 0:00:29
509000 -- (-414.039) [-413.989] (-415.947) (-418.457) * (-414.160) (-417.972) [-412.519] (-412.307) -- 0:00:29
509500 -- (-415.565) [-412.542] (-414.825) (-419.226) * (-414.364) (-415.084) [-413.306] (-414.336) -- 0:00:29
510000 -- (-415.328) (-413.131) [-414.015] (-412.971) * (-412.991) [-414.588] (-414.151) (-412.406) -- 0:00:29
Average standard deviation of split frequencies: 0.010371
510500 -- (-414.577) [-413.828] (-416.403) (-414.617) * (-414.714) (-416.204) [-417.822] (-415.911) -- 0:00:29
511000 -- (-413.746) [-413.354] (-414.367) (-413.960) * (-411.777) (-418.162) (-417.626) [-413.759] -- 0:00:29
511500 -- [-413.282] (-414.871) (-414.157) (-415.008) * (-415.007) [-416.395] (-413.098) (-413.143) -- 0:00:29
512000 -- [-414.089] (-412.127) (-412.678) (-414.684) * (-414.418) (-414.637) (-413.382) [-411.900] -- 0:00:29
512500 -- (-413.202) (-413.124) [-412.495] (-414.484) * (-413.488) [-413.752] (-414.525) (-412.889) -- 0:00:29
513000 -- (-413.974) (-415.251) [-413.352] (-413.595) * (-415.195) (-412.875) (-411.626) [-414.684] -- 0:00:29
513500 -- (-413.806) [-412.678] (-415.102) (-412.738) * (-412.905) [-412.726] (-411.969) (-418.805) -- 0:00:29
514000 -- [-415.032] (-412.107) (-412.523) (-413.215) * (-412.878) (-414.662) (-412.710) [-414.289] -- 0:00:29
514500 -- (-414.142) [-413.641] (-412.929) (-412.873) * (-413.798) [-414.820] (-412.709) (-413.525) -- 0:00:29
515000 -- (-413.662) [-412.447] (-413.464) (-414.630) * [-414.443] (-416.624) (-412.812) (-418.373) -- 0:00:29
Average standard deviation of split frequencies: 0.010792
515500 -- (-412.584) (-412.717) [-413.530] (-412.841) * [-413.589] (-414.684) (-415.107) (-414.337) -- 0:00:29
516000 -- (-413.826) [-411.766] (-414.240) (-419.649) * (-414.218) [-414.105] (-413.491) (-417.523) -- 0:00:29
516500 -- (-414.471) (-415.963) [-413.404] (-420.688) * (-416.034) (-413.278) [-411.683] (-420.360) -- 0:00:29
517000 -- (-412.612) (-418.229) [-413.174] (-415.765) * (-415.327) (-424.887) (-411.831) [-414.473] -- 0:00:28
517500 -- (-416.587) (-413.476) [-416.707] (-412.513) * [-412.239] (-422.639) (-412.042) (-423.259) -- 0:00:28
518000 -- (-414.033) (-413.657) (-416.088) [-415.586] * (-413.156) (-417.886) (-412.009) [-413.088] -- 0:00:28
518500 -- [-414.460] (-412.571) (-413.313) (-413.560) * [-413.008] (-414.496) (-413.577) (-414.895) -- 0:00:28
519000 -- [-414.956] (-413.994) (-412.959) (-412.580) * (-418.673) (-413.651) [-413.936] (-413.087) -- 0:00:28
519500 -- [-414.006] (-415.076) (-412.644) (-417.428) * (-413.658) (-412.992) [-413.096] (-413.797) -- 0:00:28
520000 -- (-416.154) (-413.013) [-412.958] (-416.390) * (-415.517) [-413.901] (-413.897) (-416.602) -- 0:00:28
Average standard deviation of split frequencies: 0.011600
520500 -- (-414.552) (-416.792) (-417.968) [-415.554] * (-415.514) [-413.835] (-412.088) (-414.109) -- 0:00:28
521000 -- (-414.981) (-413.217) (-415.560) [-414.417] * [-414.177] (-418.049) (-412.717) (-414.668) -- 0:00:28
521500 -- (-414.259) (-413.757) (-416.010) [-414.205] * (-415.881) (-412.455) [-414.391] (-414.292) -- 0:00:28
522000 -- (-412.880) (-413.917) [-416.349] (-414.115) * (-413.225) (-416.601) [-413.566] (-415.664) -- 0:00:28
522500 -- (-413.798) [-414.775] (-415.265) (-417.050) * [-413.518] (-414.457) (-415.699) (-413.436) -- 0:00:28
523000 -- [-414.870] (-412.932) (-414.452) (-414.980) * (-413.756) [-411.905] (-415.737) (-415.676) -- 0:00:28
523500 -- (-415.427) [-412.386] (-412.647) (-416.306) * (-414.082) [-413.091] (-412.585) (-413.024) -- 0:00:28
524000 -- (-415.932) (-412.448) (-413.144) [-414.068] * (-413.766) (-413.918) (-412.922) [-418.052] -- 0:00:28
524500 -- (-412.350) [-412.924] (-412.648) (-413.491) * [-412.950] (-413.206) (-413.425) (-422.785) -- 0:00:29
525000 -- (-414.915) (-415.413) (-415.420) [-412.874] * (-417.633) (-411.597) (-416.014) [-414.577] -- 0:00:28
Average standard deviation of split frequencies: 0.011875
525500 -- [-418.268] (-414.460) (-412.465) (-411.972) * (-413.969) (-414.594) (-418.311) [-413.756] -- 0:00:28
526000 -- [-417.038] (-412.514) (-412.637) (-413.298) * (-413.195) [-414.703] (-413.244) (-415.493) -- 0:00:28
526500 -- (-417.200) [-415.423] (-414.277) (-413.301) * (-416.271) [-414.714] (-412.731) (-415.955) -- 0:00:28
527000 -- (-415.906) [-415.343] (-414.353) (-412.829) * (-413.587) (-416.259) (-420.009) [-412.077] -- 0:00:28
527500 -- (-412.428) [-422.358] (-414.975) (-413.701) * (-417.108) (-412.829) [-413.447] (-412.236) -- 0:00:28
528000 -- [-417.322] (-417.774) (-415.216) (-414.641) * (-412.849) [-415.033] (-413.692) (-412.514) -- 0:00:28
528500 -- (-414.189) [-414.255] (-413.425) (-415.650) * (-413.389) [-411.637] (-412.541) (-413.480) -- 0:00:28
529000 -- [-413.837] (-413.404) (-415.217) (-415.406) * (-413.574) (-415.953) [-413.527] (-416.320) -- 0:00:28
529500 -- (-413.532) [-412.850] (-413.713) (-413.366) * (-414.145) (-413.744) (-413.832) [-413.490] -- 0:00:28
530000 -- (-412.753) (-414.324) [-413.836] (-413.450) * [-416.374] (-415.314) (-418.474) (-414.109) -- 0:00:28
Average standard deviation of split frequencies: 0.010993
530500 -- (-412.234) (-413.540) (-418.105) [-417.092] * (-417.944) [-414.667] (-411.792) (-412.145) -- 0:00:28
531000 -- (-415.218) (-412.000) [-414.078] (-414.561) * (-413.801) (-413.859) (-413.200) [-412.320] -- 0:00:28
531500 -- [-414.629] (-414.211) (-414.224) (-415.539) * (-412.363) (-414.521) (-412.990) [-412.205] -- 0:00:28
532000 -- (-414.772) [-412.825] (-417.488) (-421.041) * [-415.743] (-415.358) (-412.961) (-415.420) -- 0:00:28
532500 -- [-414.166] (-412.649) (-414.674) (-417.875) * (-414.241) [-413.584] (-415.667) (-417.961) -- 0:00:28
533000 -- (-411.881) (-414.694) [-413.114] (-415.746) * (-413.091) (-414.159) (-416.154) [-417.129] -- 0:00:28
533500 -- (-412.000) (-413.393) (-413.877) [-413.025] * (-413.541) [-413.012] (-412.276) (-414.709) -- 0:00:27
534000 -- (-416.909) (-419.300) [-412.792] (-416.428) * (-412.049) (-415.191) [-414.165] (-415.236) -- 0:00:27
534500 -- (-416.237) [-412.599] (-412.780) (-414.530) * (-415.169) [-415.246] (-414.192) (-415.906) -- 0:00:27
535000 -- (-413.112) (-416.215) (-412.276) [-413.204] * [-412.832] (-413.340) (-415.488) (-413.599) -- 0:00:27
Average standard deviation of split frequencies: 0.011378
535500 -- (-412.355) [-413.711] (-412.735) (-414.194) * [-413.869] (-413.595) (-414.470) (-412.828) -- 0:00:27
536000 -- (-415.899) (-412.967) (-413.151) [-412.814] * (-417.642) (-414.722) (-413.996) [-412.185] -- 0:00:27
536500 -- [-416.002] (-414.627) (-413.500) (-414.727) * (-413.357) (-413.587) (-414.199) [-413.135] -- 0:00:27
537000 -- (-416.220) (-415.474) [-415.464] (-413.042) * (-413.356) (-413.156) [-413.735] (-411.905) -- 0:00:27
537500 -- [-414.445] (-412.655) (-418.702) (-414.155) * [-414.698] (-415.137) (-418.754) (-413.776) -- 0:00:27
538000 -- [-413.037] (-412.872) (-413.389) (-412.941) * (-413.505) (-413.479) (-415.763) [-411.993] -- 0:00:27
538500 -- (-412.639) (-413.712) [-413.314] (-412.886) * (-414.723) [-414.117] (-412.015) (-414.075) -- 0:00:27
539000 -- [-415.062] (-422.404) (-414.552) (-412.141) * (-412.625) [-413.550] (-411.952) (-421.161) -- 0:00:27
539500 -- (-414.436) [-412.725] (-414.592) (-413.964) * (-413.229) (-412.851) [-411.785] (-418.651) -- 0:00:27
540000 -- (-412.220) (-415.838) [-413.332] (-415.556) * (-414.574) (-416.044) (-414.664) [-416.423] -- 0:00:27
Average standard deviation of split frequencies: 0.010953
540500 -- (-413.545) (-417.382) [-418.668] (-413.456) * (-412.916) (-412.858) (-412.690) [-412.728] -- 0:00:27
541000 -- (-415.847) [-413.610] (-417.224) (-413.200) * (-413.683) (-414.981) (-412.479) [-412.835] -- 0:00:27
541500 -- (-416.046) (-414.563) (-416.309) [-416.074] * (-414.409) (-414.130) [-413.169] (-416.383) -- 0:00:27
542000 -- [-412.096] (-412.623) (-416.054) (-415.779) * (-413.983) [-414.476] (-416.342) (-412.868) -- 0:00:27
542500 -- (-412.024) (-413.916) [-416.092] (-415.300) * (-413.968) (-416.192) (-416.172) [-416.211] -- 0:00:27
543000 -- (-412.177) (-415.242) [-415.156] (-414.767) * (-412.415) [-414.700] (-421.187) (-417.813) -- 0:00:27
543500 -- (-415.920) [-416.808] (-413.099) (-413.434) * (-414.084) [-412.731] (-415.238) (-415.337) -- 0:00:27
544000 -- [-417.254] (-418.702) (-414.765) (-413.329) * (-411.842) [-412.365] (-417.561) (-413.046) -- 0:00:27
544500 -- (-413.696) (-415.401) [-414.510] (-414.725) * (-416.008) (-413.055) (-412.424) [-412.107] -- 0:00:27
545000 -- (-415.791) (-416.588) (-411.825) [-412.218] * (-416.334) [-413.657] (-417.066) (-412.325) -- 0:00:27
Average standard deviation of split frequencies: 0.011008
545500 -- (-412.608) (-413.927) [-411.760] (-414.680) * (-413.299) [-413.763] (-416.498) (-416.286) -- 0:00:27
546000 -- (-411.727) [-413.788] (-414.116) (-417.176) * [-418.936] (-417.129) (-417.208) (-413.344) -- 0:00:27
546500 -- [-412.273] (-413.647) (-413.876) (-417.331) * [-415.071] (-416.795) (-417.606) (-414.067) -- 0:00:27
547000 -- (-414.601) (-414.284) [-415.030] (-418.755) * [-414.583] (-415.953) (-412.857) (-412.754) -- 0:00:27
547500 -- [-418.414] (-415.840) (-414.644) (-417.690) * (-415.797) [-412.565] (-414.213) (-411.809) -- 0:00:27
548000 -- (-424.273) [-415.299] (-413.577) (-417.672) * (-418.459) [-412.702] (-414.594) (-416.881) -- 0:00:27
548500 -- [-415.354] (-412.563) (-412.434) (-412.102) * (-417.603) (-414.914) (-414.061) [-415.343] -- 0:00:27
549000 -- [-413.855] (-414.837) (-414.299) (-411.873) * (-416.924) [-412.313] (-414.247) (-414.229) -- 0:00:27
549500 -- (-413.422) (-416.282) [-412.392] (-413.608) * (-416.299) [-413.936] (-413.198) (-413.405) -- 0:00:27
550000 -- [-414.552] (-414.847) (-412.002) (-413.434) * (-417.043) [-414.793] (-414.678) (-412.995) -- 0:00:27
Average standard deviation of split frequencies: 0.010487
550500 -- (-412.523) [-413.199] (-412.653) (-413.418) * (-414.034) (-415.858) [-417.010] (-412.985) -- 0:00:26
551000 -- (-411.864) (-412.377) (-413.839) [-412.001] * [-414.811] (-416.600) (-412.036) (-420.820) -- 0:00:26
551500 -- (-415.351) [-411.876] (-412.422) (-413.603) * (-412.727) (-412.204) [-412.887] (-412.730) -- 0:00:26
552000 -- (-413.035) [-413.720] (-412.282) (-412.591) * [-415.530] (-414.146) (-413.770) (-416.605) -- 0:00:26
552500 -- (-412.849) (-417.249) (-415.113) [-414.172] * (-412.605) (-412.015) [-414.674] (-413.925) -- 0:00:26
553000 -- (-412.613) (-415.381) (-417.482) [-411.838] * (-414.261) (-413.458) (-412.874) [-412.905] -- 0:00:26
553500 -- (-412.910) (-415.611) (-417.795) [-415.016] * [-412.724] (-417.860) (-413.585) (-412.122) -- 0:00:26
554000 -- (-416.819) (-413.113) [-414.923] (-412.961) * (-412.107) [-414.632] (-413.616) (-413.346) -- 0:00:26
554500 -- (-413.278) (-412.433) [-413.299] (-414.293) * (-419.128) (-414.174) (-412.487) [-417.017] -- 0:00:26
555000 -- (-417.316) [-414.136] (-412.223) (-413.985) * [-413.422] (-411.813) (-414.450) (-415.152) -- 0:00:26
Average standard deviation of split frequencies: 0.010704
555500 -- [-415.630] (-415.245) (-415.082) (-412.279) * (-416.896) (-412.729) [-413.110] (-412.883) -- 0:00:26
556000 -- (-411.806) (-414.529) (-415.629) [-413.629] * [-413.185] (-413.065) (-413.441) (-413.096) -- 0:00:26
556500 -- (-416.618) (-413.073) [-414.116] (-413.420) * (-412.764) (-411.977) (-413.199) [-412.831] -- 0:00:26
557000 -- [-414.723] (-412.601) (-416.178) (-417.196) * (-413.404) [-418.744] (-412.814) (-416.999) -- 0:00:26
557500 -- (-415.720) (-412.791) [-416.199] (-413.089) * (-413.342) (-412.195) [-415.111] (-413.428) -- 0:00:26
558000 -- [-412.933] (-412.788) (-414.869) (-413.302) * (-412.860) [-415.259] (-414.972) (-414.034) -- 0:00:26
558500 -- (-416.445) (-415.733) (-412.772) [-416.359] * (-412.921) [-419.190] (-414.182) (-415.452) -- 0:00:26
559000 -- (-416.419) (-412.938) [-413.457] (-415.679) * [-417.449] (-413.129) (-413.401) (-413.675) -- 0:00:26
559500 -- (-413.572) (-413.064) [-413.897] (-418.998) * (-415.118) (-417.666) [-415.089] (-417.916) -- 0:00:26
560000 -- (-415.570) (-414.745) (-413.744) [-417.236] * [-414.546] (-414.687) (-413.840) (-414.268) -- 0:00:26
Average standard deviation of split frequencies: 0.010878
560500 -- (-414.392) [-413.445] (-413.107) (-414.422) * (-412.152) (-414.857) [-415.882] (-417.799) -- 0:00:26
561000 -- (-413.479) (-412.343) [-419.893] (-411.975) * (-412.284) (-413.075) [-413.382] (-417.040) -- 0:00:26
561500 -- (-414.422) [-413.135] (-416.854) (-413.081) * (-412.517) (-416.107) (-413.752) [-414.164] -- 0:00:26
562000 -- [-412.888] (-415.279) (-417.982) (-412.820) * (-413.682) (-419.622) [-412.481] (-414.900) -- 0:00:26
562500 -- (-413.996) (-414.523) (-419.460) [-413.521] * (-414.700) (-412.694) [-411.847] (-412.670) -- 0:00:26
563000 -- (-413.308) (-417.408) (-414.874) [-411.961] * (-415.878) (-413.051) (-412.448) [-413.142] -- 0:00:26
563500 -- [-412.516] (-414.337) (-416.211) (-414.119) * (-419.201) (-412.168) (-414.800) [-414.915] -- 0:00:26
564000 -- (-412.270) (-415.596) (-414.886) [-414.378] * (-416.915) (-412.257) (-412.681) [-412.839] -- 0:00:26
564500 -- (-415.453) (-413.610) (-412.453) [-412.405] * (-414.207) (-413.028) [-411.898] (-413.882) -- 0:00:26
565000 -- (-413.004) (-414.392) (-415.618) [-416.143] * (-416.122) (-413.562) (-415.295) [-415.201] -- 0:00:26
Average standard deviation of split frequencies: 0.009786
565500 -- [-412.780] (-413.502) (-415.150) (-420.251) * [-415.601] (-413.675) (-415.355) (-412.600) -- 0:00:26
566000 -- (-418.750) (-414.169) (-414.504) [-414.260] * (-413.147) (-411.938) (-411.950) [-413.139] -- 0:00:26
566500 -- (-412.865) [-412.485] (-413.915) (-414.712) * [-412.783] (-414.297) (-413.809) (-413.308) -- 0:00:26
567000 -- (-412.257) [-412.877] (-413.223) (-414.640) * (-414.094) (-412.945) (-415.852) [-415.524] -- 0:00:25
567500 -- (-414.969) (-411.763) (-413.696) [-413.077] * (-416.268) [-412.616] (-417.112) (-413.362) -- 0:00:25
568000 -- [-414.569] (-413.264) (-412.752) (-413.714) * (-413.814) [-412.846] (-416.777) (-414.522) -- 0:00:25
568500 -- (-412.537) (-414.718) (-412.719) [-413.784] * (-412.578) (-415.802) [-413.352] (-414.054) -- 0:00:25
569000 -- [-412.979] (-411.978) (-413.895) (-413.990) * (-413.602) [-414.543] (-411.934) (-417.371) -- 0:00:25
569500 -- (-412.872) (-412.766) [-412.523] (-415.614) * [-413.787] (-415.285) (-413.988) (-416.718) -- 0:00:25
570000 -- (-419.766) (-414.620) (-417.456) [-415.683] * (-414.131) [-413.756] (-416.679) (-412.965) -- 0:00:25
Average standard deviation of split frequencies: 0.010171
570500 -- (-412.894) [-412.171] (-415.246) (-415.290) * (-414.678) (-413.317) (-415.145) [-412.628] -- 0:00:25
571000 -- (-412.862) (-412.028) [-417.160] (-413.687) * (-412.211) [-413.097] (-413.109) (-415.298) -- 0:00:25
571500 -- (-419.543) (-411.810) [-412.761] (-413.580) * (-413.644) [-412.234] (-413.719) (-414.305) -- 0:00:25
572000 -- (-415.442) [-412.234] (-414.380) (-412.634) * (-418.131) [-414.605] (-412.780) (-413.722) -- 0:00:25
572500 -- [-413.656] (-415.896) (-412.634) (-412.006) * [-414.405] (-414.374) (-411.979) (-414.743) -- 0:00:25
573000 -- [-412.966] (-413.376) (-413.366) (-413.656) * (-417.407) (-412.566) [-412.614] (-420.722) -- 0:00:25
573500 -- (-413.588) [-416.086] (-413.730) (-412.187) * (-414.953) (-419.188) [-414.562] (-415.634) -- 0:00:25
574000 -- (-413.108) (-414.015) (-412.907) [-415.937] * (-413.594) [-412.590] (-411.977) (-416.072) -- 0:00:25
574500 -- [-417.469] (-413.682) (-413.837) (-413.542) * [-418.117] (-412.565) (-414.725) (-413.423) -- 0:00:25
575000 -- (-412.829) (-414.075) [-412.018] (-412.866) * (-423.201) (-415.472) (-412.061) [-412.264] -- 0:00:25
Average standard deviation of split frequencies: 0.009463
575500 -- (-412.536) (-412.389) (-413.984) [-413.140] * (-415.097) (-412.880) (-412.960) [-414.373] -- 0:00:25
576000 -- (-417.841) (-412.847) (-415.857) [-413.740] * (-420.634) [-413.219] (-414.515) (-413.847) -- 0:00:25
576500 -- (-413.283) (-412.672) (-414.152) [-413.238] * (-418.509) (-420.331) (-412.986) [-412.583] -- 0:00:25
577000 -- (-412.041) [-415.413] (-413.028) (-416.819) * (-412.325) [-416.102] (-412.310) (-412.896) -- 0:00:25
577500 -- [-413.292] (-413.661) (-412.891) (-412.795) * [-414.123] (-415.504) (-416.375) (-413.719) -- 0:00:25
578000 -- (-414.577) (-414.256) [-416.138] (-412.405) * [-412.615] (-413.869) (-412.556) (-413.135) -- 0:00:25
578500 -- [-413.956] (-413.189) (-414.839) (-412.530) * [-412.219] (-413.615) (-414.476) (-413.431) -- 0:00:25
579000 -- [-413.046] (-412.666) (-414.221) (-412.894) * (-412.612) (-412.809) (-415.718) [-416.904] -- 0:00:25
579500 -- (-412.451) (-416.929) [-412.385] (-413.926) * (-412.558) [-413.007] (-413.824) (-412.993) -- 0:00:25
580000 -- (-413.584) (-416.432) [-413.083] (-416.120) * (-416.729) (-413.008) (-417.536) [-416.838] -- 0:00:25
Average standard deviation of split frequencies: 0.008879
580500 -- (-412.050) [-422.056] (-412.768) (-412.049) * (-418.482) (-417.425) (-415.433) [-412.039] -- 0:00:25
581000 -- (-412.880) [-416.462] (-412.053) (-414.864) * (-417.407) (-416.083) [-415.223] (-413.217) -- 0:00:25
581500 -- [-414.353] (-413.667) (-413.013) (-413.312) * [-416.345] (-414.478) (-414.889) (-414.116) -- 0:00:25
582000 -- (-412.662) (-413.240) (-413.523) [-412.985] * (-415.834) (-415.636) [-412.445] (-415.474) -- 0:00:25
582500 -- (-412.142) (-414.623) (-416.847) [-416.341] * (-418.199) [-412.394] (-412.127) (-414.056) -- 0:00:25
583000 -- (-415.838) (-413.656) [-414.977] (-414.655) * (-414.894) (-417.087) (-416.384) [-413.102] -- 0:00:25
583500 -- (-419.235) [-415.936] (-417.108) (-416.170) * (-415.651) (-415.468) [-414.866] (-413.062) -- 0:00:24
584000 -- (-415.988) [-414.712] (-414.588) (-412.959) * (-417.148) [-412.010] (-412.182) (-412.278) -- 0:00:24
584500 -- [-413.662] (-413.811) (-419.813) (-414.738) * (-413.287) (-412.869) [-412.274] (-413.151) -- 0:00:24
585000 -- [-416.389] (-413.384) (-412.775) (-413.910) * (-411.940) [-413.786] (-414.213) (-416.924) -- 0:00:24
Average standard deviation of split frequencies: 0.008547
585500 -- [-413.366] (-415.346) (-413.114) (-412.494) * (-413.337) (-413.082) [-414.052] (-417.966) -- 0:00:24
586000 -- (-413.809) [-414.140] (-413.795) (-411.968) * (-415.261) (-414.196) [-413.022] (-412.733) -- 0:00:24
586500 -- (-415.833) (-415.125) [-413.528] (-412.335) * (-417.042) (-413.810) [-413.330] (-411.720) -- 0:00:24
587000 -- [-412.427] (-414.892) (-413.500) (-412.052) * (-415.608) (-414.447) [-412.735] (-415.768) -- 0:00:24
587500 -- [-414.021] (-416.099) (-413.438) (-416.072) * [-415.430] (-412.553) (-413.555) (-413.255) -- 0:00:24
588000 -- (-416.765) (-416.419) (-412.779) [-416.586] * (-413.087) (-411.618) (-415.178) [-413.218] -- 0:00:24
588500 -- (-413.384) [-413.301] (-414.919) (-417.786) * (-413.419) (-411.883) (-414.144) [-413.105] -- 0:00:24
589000 -- [-413.962] (-416.764) (-412.587) (-415.924) * [-415.191] (-414.870) (-413.033) (-414.026) -- 0:00:24
589500 -- (-414.430) (-416.886) (-412.883) [-413.647] * (-417.115) [-413.376] (-412.388) (-415.305) -- 0:00:24
590000 -- (-413.473) (-415.254) [-414.800] (-415.614) * [-416.637] (-412.966) (-413.065) (-412.602) -- 0:00:24
Average standard deviation of split frequencies: 0.008131
590500 -- (-412.794) [-413.580] (-414.655) (-414.872) * [-412.721] (-413.736) (-412.186) (-416.245) -- 0:00:24
591000 -- (-414.294) (-414.923) [-413.255] (-413.758) * (-414.132) (-415.108) (-414.061) [-413.102] -- 0:00:24
591500 -- (-413.862) (-413.871) [-414.485] (-414.258) * [-412.054] (-414.060) (-414.004) (-413.642) -- 0:00:24
592000 -- [-413.896] (-413.187) (-414.156) (-411.907) * [-414.766] (-415.004) (-413.307) (-414.201) -- 0:00:24
592500 -- (-416.836) [-416.203] (-415.746) (-416.935) * [-413.316] (-417.854) (-414.863) (-412.809) -- 0:00:24
593000 -- (-412.385) (-414.010) [-414.296] (-418.359) * (-414.989) (-416.705) (-411.917) [-412.088] -- 0:00:24
593500 -- (-415.497) [-413.140] (-416.360) (-413.377) * [-414.270] (-417.602) (-416.529) (-413.624) -- 0:00:24
594000 -- [-415.619] (-414.885) (-413.384) (-418.471) * [-413.391] (-412.765) (-415.420) (-413.768) -- 0:00:24
594500 -- (-414.571) (-414.341) [-413.343] (-413.950) * [-413.150] (-413.732) (-418.797) (-414.334) -- 0:00:24
595000 -- [-417.081] (-413.368) (-417.241) (-413.995) * (-417.387) [-414.527] (-415.123) (-416.383) -- 0:00:24
Average standard deviation of split frequencies: 0.008008
595500 -- [-413.120] (-414.638) (-413.185) (-414.348) * [-415.416] (-413.870) (-413.611) (-415.869) -- 0:00:24
596000 -- (-420.139) (-417.011) (-413.436) [-416.002] * (-414.718) (-413.029) [-413.416] (-415.056) -- 0:00:24
596500 -- (-412.938) [-419.938] (-413.548) (-415.155) * (-413.353) [-412.270] (-417.037) (-414.893) -- 0:00:24
597000 -- (-411.810) [-413.020] (-415.170) (-412.731) * (-412.747) (-415.536) [-416.616] (-413.929) -- 0:00:24
597500 -- (-412.987) (-416.455) (-420.801) [-414.897] * (-411.931) (-412.751) [-416.703] (-417.212) -- 0:00:24
598000 -- (-417.591) [-414.629] (-413.967) (-412.247) * (-413.650) (-414.231) [-412.860] (-412.662) -- 0:00:24
598500 -- (-413.381) (-416.207) (-412.983) [-413.867] * [-414.803] (-419.137) (-412.941) (-412.656) -- 0:00:24
599000 -- (-414.291) (-414.433) [-414.858] (-412.723) * (-412.838) (-414.651) (-413.823) [-414.489] -- 0:00:24
599500 -- [-414.295] (-417.912) (-415.106) (-413.834) * (-413.891) (-416.941) (-416.924) [-412.898] -- 0:00:24
600000 -- (-411.768) [-418.788] (-413.351) (-418.452) * [-413.883] (-412.433) (-415.581) (-418.278) -- 0:00:24
Average standard deviation of split frequencies: 0.007652
600500 -- (-414.513) (-413.820) [-412.465] (-422.861) * (-413.978) (-416.502) [-412.402] (-417.244) -- 0:00:23
601000 -- (-413.399) (-413.035) [-412.758] (-416.318) * (-417.334) (-414.853) [-416.601] (-417.424) -- 0:00:23
601500 -- (-412.091) [-412.701] (-418.948) (-411.849) * [-412.987] (-417.911) (-413.574) (-414.447) -- 0:00:23
602000 -- (-412.533) (-414.497) (-421.814) [-416.018] * (-414.230) (-413.830) [-413.451] (-411.846) -- 0:00:23
602500 -- (-418.893) (-414.979) (-413.749) [-412.667] * [-412.177] (-416.560) (-413.793) (-418.736) -- 0:00:23
603000 -- [-412.847] (-417.918) (-412.721) (-417.020) * (-412.105) [-413.654] (-412.019) (-413.563) -- 0:00:23
603500 -- (-414.196) [-414.610] (-412.204) (-412.319) * (-411.974) [-413.586] (-413.519) (-413.713) -- 0:00:23
604000 -- [-414.620] (-417.180) (-411.893) (-413.029) * (-413.735) [-413.278] (-416.274) (-415.783) -- 0:00:23
604500 -- (-414.333) (-413.615) (-414.689) [-412.954] * [-412.047] (-412.618) (-412.846) (-416.036) -- 0:00:23
605000 -- [-412.488] (-416.251) (-414.229) (-412.903) * [-414.191] (-412.618) (-413.731) (-418.040) -- 0:00:23
Average standard deviation of split frequencies: 0.007876
605500 -- (-412.928) (-420.912) [-414.429] (-413.881) * (-412.416) [-412.640] (-412.215) (-412.470) -- 0:00:23
606000 -- (-413.575) (-414.244) [-417.633] (-417.254) * (-414.906) (-414.382) (-415.419) [-412.234] -- 0:00:23
606500 -- (-413.286) (-414.703) [-413.477] (-415.500) * [-413.736] (-413.115) (-415.359) (-415.733) -- 0:00:23
607000 -- [-413.139] (-414.837) (-415.280) (-414.874) * [-414.247] (-414.193) (-412.705) (-416.467) -- 0:00:23
607500 -- [-412.351] (-413.592) (-417.223) (-411.930) * (-420.559) (-416.024) (-413.320) [-417.904] -- 0:00:23
608000 -- [-414.192] (-412.179) (-420.694) (-413.193) * (-415.374) (-416.102) (-412.829) [-413.403] -- 0:00:23
608500 -- (-415.888) [-412.537] (-415.049) (-413.894) * [-414.370] (-414.283) (-413.187) (-416.893) -- 0:00:23
609000 -- (-413.099) (-413.165) [-412.438] (-413.678) * (-413.652) (-412.315) [-414.242] (-412.245) -- 0:00:23
609500 -- (-416.212) [-414.445] (-415.791) (-415.108) * (-414.144) [-414.139] (-414.234) (-414.513) -- 0:00:23
610000 -- (-413.056) (-414.734) (-415.645) [-413.749] * (-415.365) [-412.012] (-415.805) (-414.476) -- 0:00:23
Average standard deviation of split frequencies: 0.007864
610500 -- (-414.368) (-417.643) (-413.886) [-412.629] * (-412.749) (-415.231) [-412.691] (-414.046) -- 0:00:23
611000 -- (-413.327) (-415.300) (-413.980) [-415.646] * [-413.280] (-413.826) (-415.725) (-413.970) -- 0:00:23
611500 -- (-414.057) [-412.153] (-413.891) (-415.985) * [-416.300] (-413.514) (-412.869) (-415.659) -- 0:00:23
612000 -- (-416.684) [-412.959] (-412.970) (-414.182) * [-414.617] (-414.641) (-416.374) (-412.553) -- 0:00:23
612500 -- [-414.607] (-412.483) (-414.128) (-411.753) * (-414.128) (-417.452) [-413.944] (-416.292) -- 0:00:23
613000 -- (-413.512) [-413.893] (-414.204) (-412.135) * (-417.229) [-418.047] (-414.037) (-416.742) -- 0:00:23
613500 -- [-415.613] (-414.629) (-414.107) (-412.450) * [-414.365] (-415.135) (-413.351) (-412.124) -- 0:00:23
614000 -- (-415.138) (-412.355) (-412.954) [-412.963] * (-413.165) (-412.588) [-416.240] (-412.593) -- 0:00:23
614500 -- (-417.468) (-412.497) (-412.869) [-413.185] * [-412.576] (-417.762) (-413.170) (-415.614) -- 0:00:23
615000 -- (-414.956) (-413.011) [-414.229] (-413.462) * [-413.274] (-414.039) (-414.774) (-414.309) -- 0:00:23
Average standard deviation of split frequencies: 0.008274
615500 -- (-419.214) [-416.903] (-421.577) (-413.352) * [-412.690] (-414.048) (-414.887) (-414.164) -- 0:00:23
616000 -- [-413.092] (-417.000) (-411.614) (-413.324) * [-415.635] (-414.406) (-417.595) (-413.737) -- 0:00:23
616500 -- (-417.167) (-417.617) (-415.479) [-413.448] * (-415.215) (-413.125) [-412.148] (-418.050) -- 0:00:23
617000 -- (-413.824) (-419.326) [-412.609] (-415.503) * (-414.235) (-414.408) [-412.961] (-413.002) -- 0:00:22
617500 -- (-414.910) (-413.600) (-413.418) [-417.565] * [-416.174] (-412.418) (-417.669) (-415.368) -- 0:00:22
618000 -- (-413.586) (-412.838) [-416.862] (-413.414) * [-416.116] (-412.769) (-412.973) (-412.887) -- 0:00:22
618500 -- (-418.063) [-412.838] (-414.804) (-413.711) * (-415.517) (-414.600) [-412.042] (-414.664) -- 0:00:22
619000 -- [-413.371] (-414.172) (-412.178) (-416.876) * [-416.056] (-413.057) (-412.434) (-414.746) -- 0:00:22
619500 -- [-415.543] (-413.476) (-418.384) (-412.968) * (-415.099) [-412.966] (-416.705) (-414.869) -- 0:00:22
620000 -- (-411.719) (-412.450) (-416.555) [-413.889] * (-413.290) (-413.835) [-415.677] (-413.139) -- 0:00:22
Average standard deviation of split frequencies: 0.008212
620500 -- (-419.482) [-413.622] (-413.395) (-413.359) * (-412.335) (-417.774) [-413.431] (-411.771) -- 0:00:22
621000 -- (-422.451) [-414.231] (-415.847) (-414.160) * [-413.766] (-416.934) (-412.748) (-415.942) -- 0:00:22
621500 -- [-412.988] (-417.733) (-416.568) (-415.179) * (-412.306) (-414.553) [-413.224] (-414.095) -- 0:00:22
622000 -- (-412.560) (-417.019) (-413.273) [-418.532] * [-413.845] (-417.288) (-411.860) (-414.533) -- 0:00:22
622500 -- (-415.125) (-412.379) (-413.206) [-411.791] * (-416.875) (-415.563) (-412.815) [-414.741] -- 0:00:22
623000 -- [-413.820] (-412.620) (-416.436) (-414.572) * (-412.723) (-414.933) (-412.678) [-415.263] -- 0:00:22
623500 -- (-412.806) [-413.367] (-414.059) (-415.157) * (-412.806) [-413.061] (-413.173) (-415.110) -- 0:00:22
624000 -- (-413.773) [-415.295] (-414.858) (-412.753) * [-414.424] (-415.440) (-413.513) (-416.940) -- 0:00:22
624500 -- [-412.257] (-413.679) (-412.109) (-412.048) * (-411.982) (-414.559) [-414.839] (-415.868) -- 0:00:22
625000 -- (-415.469) (-416.153) (-412.182) [-412.711] * (-412.157) [-413.812] (-415.155) (-416.585) -- 0:00:22
Average standard deviation of split frequencies: 0.008566
625500 -- (-415.476) [-414.005] (-412.461) (-412.292) * (-417.126) (-416.097) [-415.120] (-412.615) -- 0:00:22
626000 -- (-414.660) (-413.983) [-414.150] (-415.555) * (-414.565) (-413.308) (-413.379) [-412.311] -- 0:00:22
626500 -- (-414.713) [-414.071] (-414.699) (-414.713) * (-415.892) (-412.669) [-412.796] (-413.631) -- 0:00:22
627000 -- [-412.459] (-413.701) (-414.062) (-413.986) * [-413.045] (-413.336) (-415.300) (-414.752) -- 0:00:22
627500 -- (-413.600) (-415.748) (-412.282) [-412.368] * (-422.390) (-412.358) [-414.234] (-414.573) -- 0:00:22
628000 -- [-415.503] (-412.431) (-413.844) (-413.055) * (-417.548) (-413.568) (-416.642) [-415.342] -- 0:00:22
628500 -- (-412.923) (-414.965) [-419.415] (-414.399) * (-415.728) (-414.116) (-413.331) [-416.000] -- 0:00:22
629000 -- (-411.950) [-413.975] (-416.040) (-413.826) * [-414.085] (-412.998) (-413.150) (-413.103) -- 0:00:22
629500 -- (-417.128) [-413.468] (-416.948) (-418.874) * (-412.310) [-412.661] (-412.673) (-417.916) -- 0:00:22
630000 -- (-420.404) (-415.258) [-414.446] (-413.117) * (-411.933) (-416.494) [-413.357] (-414.004) -- 0:00:22
Average standard deviation of split frequencies: 0.008876
630500 -- [-414.670] (-412.967) (-413.349) (-412.445) * [-412.850] (-413.396) (-415.052) (-413.228) -- 0:00:22
631000 -- (-413.023) [-411.996] (-413.110) (-413.019) * [-414.523] (-414.673) (-414.851) (-417.644) -- 0:00:22
631500 -- (-416.647) (-413.105) [-413.112] (-413.771) * (-414.739) (-415.276) [-412.975] (-413.786) -- 0:00:22
632000 -- (-416.945) (-413.277) (-414.437) [-413.190] * (-412.925) (-414.274) (-416.831) [-414.748] -- 0:00:22
632500 -- (-414.493) (-416.727) [-415.981] (-412.392) * (-412.911) [-412.537] (-413.015) (-411.901) -- 0:00:22
633000 -- (-412.967) (-412.979) (-416.380) [-413.836] * (-412.494) (-412.636) (-416.854) [-414.017] -- 0:00:22
633500 -- (-416.240) (-413.404) [-412.685] (-414.976) * [-412.590] (-414.599) (-413.452) (-413.530) -- 0:00:21
634000 -- (-412.194) [-412.386] (-413.634) (-413.172) * (-413.040) [-414.560] (-417.031) (-414.388) -- 0:00:21
634500 -- (-412.526) [-413.583] (-413.898) (-415.900) * (-414.620) (-416.349) [-412.757] (-416.242) -- 0:00:21
635000 -- [-414.749] (-414.724) (-414.534) (-415.687) * [-412.444] (-416.752) (-413.393) (-415.021) -- 0:00:21
Average standard deviation of split frequencies: 0.009543
635500 -- [-412.334] (-414.256) (-414.703) (-412.226) * (-414.932) (-418.937) [-413.570] (-412.636) -- 0:00:21
636000 -- (-416.563) [-413.156] (-415.070) (-414.754) * [-414.422] (-413.024) (-413.248) (-419.659) -- 0:00:21
636500 -- (-416.648) (-416.503) [-413.915] (-412.524) * (-413.892) [-413.278] (-417.290) (-423.219) -- 0:00:21
637000 -- (-412.346) [-413.154] (-416.984) (-413.359) * (-414.023) (-415.453) [-416.103] (-419.802) -- 0:00:21
637500 -- [-412.061] (-415.911) (-416.271) (-415.403) * (-413.244) (-417.473) (-412.434) [-413.843] -- 0:00:21
638000 -- (-413.696) [-414.454] (-416.074) (-414.131) * [-412.548] (-417.573) (-413.329) (-415.912) -- 0:00:21
638500 -- (-414.546) [-416.066] (-412.805) (-413.182) * (-418.161) (-413.365) [-414.959] (-414.997) -- 0:00:21
639000 -- (-412.737) [-411.852] (-415.135) (-415.153) * (-413.849) [-414.618] (-413.131) (-419.146) -- 0:00:21
639500 -- (-414.634) [-412.924] (-414.144) (-414.225) * [-415.446] (-412.798) (-414.197) (-414.969) -- 0:00:21
640000 -- (-413.317) (-414.123) [-414.273] (-417.178) * (-412.815) (-414.161) (-413.431) [-412.953] -- 0:00:21
Average standard deviation of split frequencies: 0.010025
640500 -- [-412.067] (-414.027) (-416.072) (-411.918) * (-418.310) [-412.611] (-414.920) (-413.070) -- 0:00:21
641000 -- [-413.407] (-412.981) (-412.688) (-412.816) * (-414.793) [-412.435] (-413.262) (-412.965) -- 0:00:21
641500 -- [-416.921] (-414.023) (-412.845) (-413.652) * (-412.966) [-413.289] (-412.566) (-411.892) -- 0:00:21
642000 -- (-416.242) (-412.132) (-412.300) [-414.408] * (-414.542) [-415.309] (-413.640) (-414.798) -- 0:00:21
642500 -- (-417.152) (-412.818) [-413.463] (-415.117) * (-413.314) (-412.726) [-413.495] (-412.318) -- 0:00:21
643000 -- (-417.434) [-411.683] (-413.710) (-415.360) * (-414.650) (-417.278) [-414.997] (-413.860) -- 0:00:21
643500 -- [-414.900] (-411.867) (-416.019) (-415.872) * (-413.701) (-416.115) (-413.942) [-414.002] -- 0:00:21
644000 -- (-412.492) (-412.631) (-413.351) [-415.890] * [-412.864] (-417.809) (-413.820) (-414.901) -- 0:00:21
644500 -- (-413.786) [-414.082] (-411.969) (-412.911) * (-415.389) (-412.720) (-414.206) [-415.049] -- 0:00:21
645000 -- (-413.176) (-412.083) [-411.903] (-412.974) * [-416.835] (-412.677) (-413.476) (-413.519) -- 0:00:21
Average standard deviation of split frequencies: 0.010079
645500 -- (-413.214) [-414.811] (-411.874) (-413.373) * (-418.335) (-412.366) (-413.173) [-412.563] -- 0:00:21
646000 -- (-414.291) (-413.230) (-416.076) [-413.527] * (-413.751) (-417.536) (-414.833) [-412.100] -- 0:00:21
646500 -- (-413.167) (-414.404) (-417.586) [-414.092] * (-411.747) (-416.575) (-414.200) [-414.057] -- 0:00:21
647000 -- (-413.631) (-414.155) [-416.564] (-414.105) * (-413.512) [-414.147] (-414.098) (-413.477) -- 0:00:21
647500 -- [-414.266] (-413.008) (-412.671) (-414.157) * (-417.298) (-412.760) [-415.450] (-414.196) -- 0:00:21
648000 -- (-414.069) [-413.553] (-412.934) (-414.908) * [-415.319] (-412.709) (-416.965) (-418.952) -- 0:00:21
648500 -- (-414.025) (-412.681) (-415.029) [-414.508] * (-412.575) [-412.563] (-421.625) (-413.428) -- 0:00:21
649000 -- [-412.478] (-413.416) (-416.259) (-417.544) * (-412.982) [-413.428] (-420.695) (-415.015) -- 0:00:21
649500 -- [-411.973] (-413.209) (-415.398) (-414.322) * (-412.766) [-412.618] (-412.501) (-412.665) -- 0:00:21
650000 -- [-411.911] (-415.766) (-413.897) (-415.426) * [-411.905] (-415.282) (-413.615) (-412.841) -- 0:00:21
Average standard deviation of split frequencies: 0.009735
650500 -- (-413.003) [-412.424] (-414.102) (-417.181) * (-412.246) (-412.916) [-412.574] (-414.168) -- 0:00:20
651000 -- (-415.115) (-415.367) [-411.666] (-420.696) * (-413.157) (-416.325) [-414.019] (-412.613) -- 0:00:20
651500 -- (-413.956) [-413.226] (-412.837) (-414.189) * (-413.157) (-415.246) [-413.812] (-416.550) -- 0:00:20
652000 -- [-412.609] (-417.951) (-418.317) (-414.135) * (-412.813) (-417.226) [-413.051] (-412.578) -- 0:00:20
652500 -- (-415.662) (-414.015) (-416.248) [-416.454] * (-414.731) [-411.752] (-417.135) (-414.755) -- 0:00:20
653000 -- (-414.199) [-413.135] (-419.042) (-416.662) * [-415.472] (-413.460) (-413.810) (-416.703) -- 0:00:20
653500 -- (-414.132) (-419.173) (-415.714) [-415.281] * (-415.388) [-414.058] (-415.547) (-414.205) -- 0:00:20
654000 -- (-412.937) (-415.466) [-413.376] (-412.556) * (-416.086) (-413.592) (-414.177) [-413.141] -- 0:00:20
654500 -- (-414.835) (-415.612) [-413.211] (-412.710) * (-415.119) (-412.576) [-415.875] (-415.948) -- 0:00:20
655000 -- [-413.300] (-415.088) (-412.588) (-412.108) * (-413.219) (-414.005) [-412.898] (-416.942) -- 0:00:20
Average standard deviation of split frequencies: 0.010510
655500 -- (-415.063) [-413.600] (-415.255) (-416.303) * [-414.206] (-416.719) (-413.885) (-412.233) -- 0:00:20
656000 -- (-413.344) [-414.813] (-414.013) (-413.313) * (-412.502) [-413.943] (-414.775) (-413.719) -- 0:00:20
656500 -- [-411.585] (-416.912) (-412.303) (-414.320) * (-411.555) (-413.424) [-412.883] (-415.871) -- 0:00:20
657000 -- [-413.713] (-414.300) (-415.185) (-414.356) * (-413.216) [-413.185] (-418.496) (-413.895) -- 0:00:20
657500 -- [-413.820] (-412.992) (-415.228) (-412.460) * (-413.958) (-413.301) (-413.398) [-413.066] -- 0:00:20
658000 -- (-412.275) (-416.248) [-414.505] (-419.335) * (-413.228) [-412.975] (-414.582) (-412.310) -- 0:00:20
658500 -- (-413.922) (-416.222) (-414.059) [-413.867] * (-412.963) [-413.007] (-417.546) (-412.314) -- 0:00:20
659000 -- [-415.241] (-413.000) (-416.819) (-415.076) * (-412.605) [-413.722] (-416.790) (-413.789) -- 0:00:20
659500 -- [-412.457] (-414.411) (-413.665) (-418.583) * (-415.487) [-413.199] (-418.188) (-413.330) -- 0:00:20
660000 -- (-414.501) [-414.792] (-411.855) (-414.925) * (-414.328) (-417.830) [-420.038] (-412.433) -- 0:00:20
Average standard deviation of split frequencies: 0.011193
660500 -- (-412.582) [-413.324] (-415.299) (-412.371) * [-412.533] (-413.595) (-412.651) (-414.538) -- 0:00:20
661000 -- (-412.067) (-414.040) [-414.097] (-412.085) * (-411.603) (-414.005) [-413.414] (-415.413) -- 0:00:20
661500 -- (-414.170) [-415.470] (-411.776) (-416.474) * (-413.973) (-413.962) (-415.016) [-413.800] -- 0:00:20
662000 -- [-413.310] (-419.965) (-412.178) (-414.219) * [-414.343] (-417.071) (-412.936) (-415.987) -- 0:00:20
662500 -- [-412.780] (-414.646) (-412.385) (-413.936) * (-418.140) (-416.412) (-415.453) [-412.550] -- 0:00:20
663000 -- (-412.335) (-412.154) (-411.630) [-414.376] * (-414.798) (-415.293) [-412.544] (-414.495) -- 0:00:20
663500 -- (-415.229) (-412.803) (-413.390) [-414.279] * [-415.560] (-412.920) (-413.261) (-413.517) -- 0:00:20
664000 -- [-412.972] (-415.112) (-414.150) (-414.440) * [-416.004] (-414.388) (-413.942) (-413.343) -- 0:00:20
664500 -- (-413.771) [-412.004] (-415.244) (-413.071) * (-415.296) [-414.064] (-414.645) (-413.626) -- 0:00:20
665000 -- (-413.475) (-414.083) [-414.136] (-412.913) * (-417.429) (-414.094) [-414.082] (-413.704) -- 0:00:20
Average standard deviation of split frequencies: 0.010706
665500 -- (-414.932) (-413.305) [-416.181] (-414.336) * (-415.830) (-413.597) [-412.276] (-415.003) -- 0:00:20
666000 -- (-415.740) [-413.840] (-416.141) (-414.075) * (-423.486) [-413.427] (-412.318) (-415.619) -- 0:00:20
666500 -- (-417.759) (-416.672) [-415.183] (-412.282) * [-416.744] (-415.684) (-413.098) (-413.240) -- 0:00:20
667000 -- (-416.861) (-417.680) [-414.714] (-413.345) * [-413.864] (-414.520) (-414.861) (-415.501) -- 0:00:19
667500 -- (-414.282) (-414.252) (-415.382) [-418.918] * (-415.933) (-414.790) [-414.279] (-413.016) -- 0:00:19
668000 -- (-414.634) [-412.609] (-416.415) (-412.873) * (-414.929) (-413.915) (-414.320) [-415.408] -- 0:00:19
668500 -- (-412.902) (-416.713) (-415.745) [-413.571] * (-412.618) [-414.430] (-414.108) (-414.866) -- 0:00:19
669000 -- (-414.133) (-416.439) [-413.915] (-412.003) * [-413.528] (-414.006) (-412.940) (-414.180) -- 0:00:19
669500 -- [-414.164] (-413.677) (-419.104) (-413.516) * (-415.502) (-414.301) [-412.169] (-412.877) -- 0:00:19
670000 -- (-415.955) (-411.893) (-414.174) [-414.608] * (-417.568) (-414.554) [-413.545] (-415.665) -- 0:00:19
Average standard deviation of split frequencies: 0.011027
670500 -- (-415.518) (-412.648) [-412.432] (-415.258) * (-413.054) (-413.977) [-412.551] (-412.293) -- 0:00:19
671000 -- (-413.135) (-413.550) (-413.381) [-414.573] * [-412.303] (-413.960) (-412.538) (-412.951) -- 0:00:19
671500 -- [-414.032] (-412.884) (-413.920) (-413.487) * (-415.653) (-411.753) (-412.318) [-415.295] -- 0:00:19
672000 -- (-418.196) [-413.219] (-413.810) (-412.313) * (-416.310) (-412.879) [-412.572] (-417.234) -- 0:00:19
672500 -- (-413.765) (-412.947) (-419.960) [-416.704] * (-412.454) (-412.073) (-413.756) [-413.389] -- 0:00:19
673000 -- (-412.669) (-415.058) [-416.294] (-415.701) * (-417.097) (-412.514) [-412.866] (-413.281) -- 0:00:19
673500 -- (-412.540) (-413.171) [-415.185] (-414.460) * (-418.253) [-412.999] (-416.044) (-413.707) -- 0:00:19
674000 -- (-416.676) [-413.245] (-414.117) (-415.340) * (-421.179) (-414.154) (-414.299) [-413.452] -- 0:00:19
674500 -- (-414.726) (-413.051) (-412.783) [-414.220] * (-414.185) (-414.584) [-413.261] (-413.398) -- 0:00:19
675000 -- (-414.816) [-414.148] (-412.998) (-416.229) * (-413.434) [-414.433] (-414.282) (-412.598) -- 0:00:19
Average standard deviation of split frequencies: 0.010896
675500 -- (-413.710) (-412.728) [-414.559] (-415.207) * (-412.371) (-412.654) (-413.935) [-412.204] -- 0:00:19
676000 -- (-416.447) (-417.685) [-413.230] (-413.098) * (-412.442) (-414.210) [-416.633] (-412.202) -- 0:00:19
676500 -- [-414.582] (-418.698) (-418.953) (-414.354) * (-411.983) [-415.910] (-412.478) (-413.031) -- 0:00:19
677000 -- (-411.967) (-412.734) [-413.356] (-416.890) * [-412.737] (-415.213) (-412.052) (-413.644) -- 0:00:19
677500 -- (-414.789) [-415.149] (-414.996) (-413.156) * (-413.896) [-412.847] (-411.855) (-413.327) -- 0:00:19
678000 -- (-414.101) (-416.143) [-414.082] (-412.175) * (-414.074) (-411.975) (-412.736) [-416.201] -- 0:00:19
678500 -- (-412.699) (-414.730) (-413.716) [-412.867] * [-413.462] (-412.726) (-411.648) (-415.154) -- 0:00:19
679000 -- (-413.832) (-419.066) [-414.923] (-414.537) * (-414.448) (-415.073) [-418.170] (-413.999) -- 0:00:19
679500 -- (-416.926) (-413.958) [-411.965] (-415.061) * (-415.532) [-413.588] (-421.020) (-414.543) -- 0:00:19
680000 -- (-415.118) [-413.513] (-412.479) (-413.422) * (-413.166) (-413.806) [-414.698] (-415.748) -- 0:00:19
Average standard deviation of split frequencies: 0.010908
680500 -- [-413.632] (-412.768) (-413.381) (-414.524) * (-412.653) [-416.167] (-412.425) (-418.588) -- 0:00:19
681000 -- [-413.883] (-413.196) (-413.882) (-415.243) * [-411.788] (-413.824) (-414.684) (-412.067) -- 0:00:19
681500 -- [-413.394] (-413.947) (-413.011) (-411.901) * (-413.836) (-418.100) [-413.159] (-412.149) -- 0:00:19
682000 -- (-411.995) (-416.268) (-414.323) [-411.909] * (-417.687) (-412.864) [-418.062] (-412.371) -- 0:00:19
682500 -- [-411.979] (-413.100) (-414.757) (-415.598) * (-414.792) (-412.597) (-413.657) [-416.269] -- 0:00:19
683000 -- [-414.333] (-412.544) (-414.190) (-414.739) * (-413.546) (-411.903) [-414.553] (-418.750) -- 0:00:19
683500 -- [-413.891] (-412.220) (-419.821) (-413.028) * (-412.579) (-412.273) (-413.682) [-415.476] -- 0:00:18
684000 -- [-413.920] (-411.536) (-412.123) (-416.079) * (-413.767) (-413.502) [-414.306] (-414.064) -- 0:00:18
684500 -- (-413.189) (-416.342) [-413.978] (-414.216) * (-416.667) (-418.468) (-415.323) [-419.969] -- 0:00:18
685000 -- [-413.698] (-415.617) (-415.290) (-413.172) * (-412.606) (-414.593) [-412.292] (-416.642) -- 0:00:18
Average standard deviation of split frequencies: 0.010952
685500 -- (-412.596) [-414.025] (-414.047) (-412.468) * (-417.785) (-415.414) [-412.622] (-416.181) -- 0:00:18
686000 -- (-411.624) (-411.876) [-415.684] (-415.900) * [-414.117] (-412.472) (-414.246) (-417.014) -- 0:00:18
686500 -- (-413.945) [-414.108] (-412.703) (-416.920) * (-416.678) (-412.235) [-412.895] (-416.444) -- 0:00:18
687000 -- (-413.867) (-411.775) [-414.700] (-415.947) * (-413.423) (-413.113) (-413.200) [-412.411] -- 0:00:18
687500 -- (-414.679) (-412.813) (-414.263) [-411.891] * (-414.331) (-413.106) (-412.234) [-414.285] -- 0:00:18
688000 -- (-417.616) (-414.733) (-414.976) [-412.949] * (-412.614) (-413.993) [-414.787] (-414.260) -- 0:00:18
688500 -- (-415.545) (-414.041) [-416.504] (-416.154) * (-412.874) (-414.635) (-415.263) [-413.380] -- 0:00:18
689000 -- (-413.904) [-412.371] (-415.205) (-414.091) * [-412.765] (-415.449) (-414.404) (-414.166) -- 0:00:18
689500 -- (-422.585) [-417.517] (-413.886) (-417.290) * (-413.361) (-414.336) (-416.450) [-413.711] -- 0:00:18
690000 -- (-414.499) (-415.371) (-412.848) [-412.387] * (-415.521) [-411.830] (-413.857) (-412.505) -- 0:00:18
Average standard deviation of split frequencies: 0.010793
690500 -- (-413.056) [-412.801] (-412.604) (-413.674) * (-413.732) [-413.531] (-413.283) (-414.851) -- 0:00:18
691000 -- (-413.370) (-413.030) [-413.731] (-412.841) * (-417.834) (-413.536) (-412.891) [-414.324] -- 0:00:18
691500 -- [-416.768] (-415.360) (-413.522) (-414.116) * (-415.709) (-416.939) [-412.659] (-412.306) -- 0:00:18
692000 -- (-413.433) (-412.572) (-414.246) [-414.187] * (-415.221) [-413.363] (-412.880) (-414.008) -- 0:00:18
692500 -- (-415.541) (-413.791) (-413.093) [-416.990] * [-416.307] (-413.434) (-414.441) (-412.675) -- 0:00:18
693000 -- (-414.183) (-413.185) (-415.613) [-411.846] * (-412.453) (-415.132) (-418.444) [-415.902] -- 0:00:18
693500 -- (-414.996) (-417.845) [-414.276] (-413.746) * [-414.307] (-415.355) (-412.514) (-415.237) -- 0:00:18
694000 -- (-414.473) (-416.917) [-412.611] (-414.107) * (-417.844) (-413.739) (-412.968) [-413.767] -- 0:00:18
694500 -- (-413.441) (-415.965) (-412.067) [-412.573] * (-413.330) (-413.841) (-412.925) [-413.985] -- 0:00:18
695000 -- (-414.342) (-413.245) [-413.947] (-412.910) * (-413.077) [-416.923] (-415.350) (-411.849) -- 0:00:18
Average standard deviation of split frequencies: 0.011049
695500 -- (-414.230) (-412.367) (-415.468) [-416.121] * (-416.920) [-413.070] (-414.255) (-413.971) -- 0:00:18
696000 -- (-412.232) (-415.155) (-417.353) [-413.085] * [-414.962] (-414.069) (-414.032) (-412.275) -- 0:00:18
696500 -- [-412.298] (-415.275) (-419.876) (-414.582) * (-413.058) (-416.622) [-412.739] (-412.657) -- 0:00:18
697000 -- (-413.194) (-413.229) [-412.967] (-414.205) * (-413.810) [-414.086] (-412.389) (-415.213) -- 0:00:18
697500 -- [-413.527] (-413.385) (-412.005) (-412.349) * (-416.954) [-413.554] (-413.190) (-413.233) -- 0:00:18
698000 -- (-413.634) [-414.098] (-415.514) (-414.296) * (-414.783) (-412.477) [-412.912] (-412.439) -- 0:00:18
698500 -- (-415.344) (-415.393) [-412.719] (-412.786) * (-417.216) (-412.486) (-416.136) [-412.639] -- 0:00:18
699000 -- (-413.308) [-414.094] (-412.507) (-413.845) * (-415.620) (-412.048) (-416.924) [-414.464] -- 0:00:18
699500 -- [-412.768] (-425.757) (-419.885) (-412.560) * (-414.573) [-411.908] (-421.099) (-413.789) -- 0:00:18
700000 -- (-414.307) (-420.973) [-412.855] (-412.902) * [-412.960] (-411.996) (-416.757) (-413.243) -- 0:00:18
Average standard deviation of split frequencies: 0.011017
700500 -- (-413.132) [-416.865] (-412.809) (-412.022) * (-413.132) (-412.192) [-414.390] (-415.831) -- 0:00:17
701000 -- (-415.346) (-412.170) [-415.976] (-413.851) * (-413.364) (-415.376) (-412.384) [-412.482] -- 0:00:17
701500 -- (-418.445) (-414.880) [-413.450] (-412.612) * (-415.190) [-413.418] (-413.580) (-413.059) -- 0:00:17
702000 -- (-411.746) [-416.071] (-413.587) (-413.464) * (-416.866) (-415.877) (-413.271) [-413.744] -- 0:00:17
702500 -- (-414.693) (-413.110) [-412.426] (-414.871) * (-412.564) (-415.072) (-412.411) [-413.085] -- 0:00:17
703000 -- (-413.620) (-414.416) [-412.344] (-413.386) * [-411.812] (-413.210) (-416.986) (-415.549) -- 0:00:17
703500 -- (-411.806) (-415.152) (-413.783) [-415.543] * [-412.834] (-412.077) (-416.981) (-415.092) -- 0:00:17
704000 -- (-417.798) (-418.215) [-414.869] (-413.393) * [-413.273] (-414.214) (-415.420) (-417.680) -- 0:00:17
704500 -- [-413.075] (-418.964) (-420.648) (-418.059) * (-417.009) (-421.194) (-415.075) [-412.443] -- 0:00:17
705000 -- [-414.698] (-413.906) (-413.374) (-415.201) * (-415.406) (-412.751) [-413.127] (-415.340) -- 0:00:17
Average standard deviation of split frequencies: 0.011351
705500 -- (-412.134) [-413.868] (-411.851) (-412.391) * (-413.917) (-412.784) (-412.912) [-413.106] -- 0:00:17
706000 -- (-412.469) [-415.082] (-411.703) (-414.021) * (-414.411) (-414.101) (-413.988) [-413.006] -- 0:00:17
706500 -- (-412.390) (-414.397) [-412.687] (-413.433) * [-412.943] (-419.258) (-417.762) (-414.798) -- 0:00:17
707000 -- (-415.927) [-412.550] (-413.991) (-413.422) * (-415.328) (-418.056) [-416.758] (-415.106) -- 0:00:17
707500 -- (-413.990) (-417.661) [-413.259] (-416.156) * (-416.709) (-415.632) [-414.740] (-412.762) -- 0:00:17
708000 -- (-415.170) [-412.814] (-412.396) (-416.697) * (-422.289) (-416.531) (-412.620) [-413.958] -- 0:00:17
708500 -- (-415.908) [-412.426] (-414.439) (-415.800) * [-414.096] (-413.549) (-412.049) (-419.230) -- 0:00:17
709000 -- (-414.691) (-411.948) (-415.847) [-413.044] * [-415.173] (-411.900) (-413.705) (-414.268) -- 0:00:17
709500 -- (-415.169) [-411.776] (-414.258) (-414.393) * [-412.692] (-413.639) (-411.871) (-412.750) -- 0:00:17
710000 -- [-413.341] (-414.907) (-413.919) (-412.317) * [-415.166] (-416.112) (-413.991) (-412.668) -- 0:00:17
Average standard deviation of split frequencies: 0.011028
710500 -- (-415.782) [-413.685] (-413.944) (-416.603) * (-416.235) (-414.079) [-414.033] (-415.381) -- 0:00:17
711000 -- (-420.014) (-413.561) [-412.476] (-413.107) * (-413.945) (-414.812) [-412.811] (-412.550) -- 0:00:17
711500 -- (-416.384) [-416.404] (-412.328) (-412.559) * (-414.199) (-413.175) [-413.018] (-413.468) -- 0:00:17
712000 -- (-413.117) (-412.760) (-412.964) [-413.176] * (-416.653) (-413.892) (-412.070) [-412.708] -- 0:00:17
712500 -- (-412.977) (-414.887) [-412.058] (-412.191) * (-419.326) (-412.668) (-412.844) [-412.373] -- 0:00:17
713000 -- (-413.272) (-414.368) (-412.115) [-412.267] * (-416.344) (-413.274) (-412.712) [-412.157] -- 0:00:17
713500 -- (-412.935) (-413.127) [-414.136] (-412.907) * (-412.592) (-414.232) (-413.489) [-412.636] -- 0:00:17
714000 -- (-412.585) (-415.865) [-413.665] (-416.620) * (-412.724) (-413.289) [-413.971] (-412.695) -- 0:00:17
714500 -- [-413.901] (-413.745) (-413.652) (-411.670) * [-414.854] (-415.962) (-412.969) (-417.799) -- 0:00:17
715000 -- [-414.246] (-412.491) (-413.835) (-412.477) * (-417.268) (-416.910) (-412.511) [-414.916] -- 0:00:17
Average standard deviation of split frequencies: 0.011275
715500 -- (-412.392) (-413.536) (-415.414) [-411.973] * (-413.324) (-414.580) [-413.274] (-419.035) -- 0:00:17
716000 -- [-416.353] (-412.789) (-413.778) (-415.656) * (-413.029) (-414.859) (-417.278) [-414.869] -- 0:00:17
716500 -- (-414.339) (-414.054) (-413.748) [-412.528] * (-414.391) (-414.468) [-414.349] (-416.248) -- 0:00:17
717000 -- (-413.744) (-415.281) (-415.705) [-412.309] * (-412.060) (-415.245) (-414.551) [-412.822] -- 0:00:16
717500 -- (-416.392) (-419.430) [-414.233] (-413.921) * (-417.016) (-413.773) (-412.622) [-412.687] -- 0:00:16
718000 -- (-413.099) [-412.797] (-414.838) (-416.029) * (-414.693) (-412.110) (-415.044) [-414.028] -- 0:00:16
718500 -- [-417.749] (-412.432) (-415.604) (-413.604) * [-416.148] (-413.383) (-413.203) (-415.997) -- 0:00:16
719000 -- [-416.632] (-413.082) (-413.551) (-412.074) * (-417.286) (-413.850) (-418.260) [-416.190] -- 0:00:16
719500 -- (-413.171) (-414.726) [-416.051] (-412.837) * (-412.330) [-412.048] (-420.919) (-413.807) -- 0:00:16
720000 -- (-413.313) (-413.039) [-415.200] (-415.027) * (-415.020) (-412.992) [-413.878] (-416.957) -- 0:00:16
Average standard deviation of split frequencies: 0.011079
720500 -- (-414.989) [-413.128] (-412.812) (-417.129) * [-411.877] (-414.367) (-414.106) (-414.012) -- 0:00:16
721000 -- [-414.144] (-412.242) (-413.980) (-415.265) * (-412.599) [-413.737] (-414.061) (-414.083) -- 0:00:16
721500 -- (-411.918) (-415.207) (-415.171) [-412.288] * (-413.802) (-416.805) (-414.344) [-415.228] -- 0:00:16
722000 -- (-412.863) [-413.521] (-413.625) (-413.827) * [-414.671] (-413.866) (-413.781) (-418.580) -- 0:00:16
722500 -- (-414.780) [-413.969] (-412.734) (-412.099) * (-418.874) (-414.822) (-413.615) [-413.674] -- 0:00:16
723000 -- [-418.480] (-415.312) (-412.755) (-413.320) * (-414.224) [-412.312] (-412.444) (-415.367) -- 0:00:16
723500 -- [-417.711] (-413.491) (-414.226) (-415.099) * [-415.289] (-415.990) (-413.208) (-413.313) -- 0:00:16
724000 -- (-414.728) (-413.787) (-415.021) [-413.407] * [-417.536] (-412.085) (-413.825) (-412.958) -- 0:00:16
724500 -- (-414.139) (-413.182) [-413.226] (-413.044) * (-412.253) (-411.796) (-413.522) [-413.484] -- 0:00:16
725000 -- [-413.701] (-416.370) (-412.205) (-412.541) * (-417.287) (-415.190) (-413.960) [-412.475] -- 0:00:16
Average standard deviation of split frequencies: 0.011160
725500 -- (-413.789) (-415.238) [-416.099] (-419.939) * (-416.132) (-414.724) (-412.121) [-413.473] -- 0:00:16
726000 -- (-415.617) (-413.849) (-413.583) [-415.710] * (-415.388) [-415.309] (-413.683) (-412.327) -- 0:00:16
726500 -- (-414.723) (-414.378) [-412.942] (-419.058) * (-413.055) [-412.899] (-413.877) (-411.986) -- 0:00:16
727000 -- (-413.293) (-416.948) [-412.159] (-414.864) * [-414.713] (-413.579) (-412.634) (-413.414) -- 0:00:16
727500 -- (-412.161) (-417.034) [-413.865] (-415.734) * [-413.075] (-414.894) (-413.911) (-414.294) -- 0:00:16
728000 -- (-412.448) (-413.747) (-412.658) [-413.378] * (-415.629) [-415.016] (-413.195) (-414.506) -- 0:00:16
728500 -- (-412.106) (-414.138) (-414.763) [-413.753] * (-414.777) [-413.139] (-413.817) (-411.978) -- 0:00:16
729000 -- (-412.160) [-413.849] (-418.531) (-413.120) * (-412.568) (-412.476) (-413.399) [-412.869] -- 0:00:16
729500 -- (-412.787) (-413.608) [-413.676] (-411.882) * (-413.421) [-413.558] (-412.234) (-412.712) -- 0:00:16
730000 -- (-412.669) (-414.272) [-415.842] (-413.678) * (-412.910) (-414.789) [-413.439] (-412.795) -- 0:00:16
Average standard deviation of split frequencies: 0.011170
730500 -- (-413.299) (-412.919) (-417.866) [-416.083] * [-413.264] (-414.951) (-413.180) (-414.127) -- 0:00:16
731000 -- (-414.798) [-412.824] (-417.311) (-413.737) * (-414.361) (-413.396) (-413.887) [-417.454] -- 0:00:16
731500 -- [-413.954] (-414.264) (-416.184) (-415.512) * [-413.960] (-412.897) (-413.373) (-413.601) -- 0:00:16
732000 -- [-413.939] (-420.343) (-415.447) (-416.916) * (-414.733) [-415.937] (-416.292) (-412.331) -- 0:00:16
732500 -- (-415.376) [-412.884] (-412.618) (-412.687) * (-416.544) (-414.084) (-415.723) [-415.762] -- 0:00:16
733000 -- (-415.418) (-421.923) [-414.587] (-413.593) * [-414.736] (-414.862) (-416.650) (-412.763) -- 0:00:16
733500 -- (-413.427) (-415.039) (-412.843) [-416.203] * (-415.612) (-412.275) [-415.705] (-413.627) -- 0:00:15
734000 -- (-415.906) (-412.852) (-412.965) [-416.531] * (-415.028) (-412.473) (-413.428) [-414.704] -- 0:00:15
734500 -- (-415.096) (-413.783) (-413.308) [-414.727] * (-416.929) [-413.120] (-415.447) (-415.203) -- 0:00:15
735000 -- [-414.357] (-412.229) (-412.021) (-413.260) * (-414.663) (-415.211) (-415.266) [-412.536] -- 0:00:15
Average standard deviation of split frequencies: 0.010738
735500 -- (-415.508) (-412.508) (-411.942) [-416.575] * (-413.270) (-413.847) (-414.062) [-414.346] -- 0:00:15
736000 -- [-414.196] (-417.641) (-412.612) (-413.453) * [-414.191] (-412.927) (-413.516) (-414.053) -- 0:00:15
736500 -- (-415.631) (-420.550) (-413.775) [-412.491] * (-417.488) [-412.355] (-412.673) (-414.124) -- 0:00:15
737000 -- (-415.395) (-413.666) (-413.178) [-414.647] * (-415.224) (-413.641) [-413.820] (-414.394) -- 0:00:15
737500 -- (-412.380) (-412.364) (-416.308) [-415.260] * (-418.541) (-412.521) [-412.070] (-412.100) -- 0:00:15
738000 -- [-414.958] (-416.043) (-412.542) (-414.631) * (-414.796) (-413.437) [-412.845] (-412.411) -- 0:00:15
738500 -- (-413.750) [-420.064] (-415.104) (-412.905) * (-413.102) (-415.095) [-412.286] (-414.319) -- 0:00:15
739000 -- (-411.597) [-412.899] (-413.040) (-414.361) * (-414.263) (-414.983) [-414.021] (-413.538) -- 0:00:15
739500 -- [-412.823] (-418.475) (-412.891) (-413.552) * [-416.041] (-418.922) (-413.068) (-412.658) -- 0:00:15
740000 -- (-412.796) (-415.447) [-412.142] (-412.219) * [-414.465] (-414.781) (-414.561) (-412.741) -- 0:00:15
Average standard deviation of split frequencies: 0.011615
740500 -- (-418.792) (-416.961) [-413.552] (-412.831) * (-419.279) (-416.507) (-413.559) [-416.861] -- 0:00:15
741000 -- [-413.586] (-419.166) (-415.201) (-414.861) * (-418.008) [-413.563] (-414.571) (-416.505) -- 0:00:15
741500 -- (-412.483) [-413.751] (-415.052) (-412.934) * (-416.601) (-414.052) [-413.102] (-414.029) -- 0:00:15
742000 -- (-415.608) (-414.372) (-413.953) [-414.034] * (-412.959) (-413.140) (-415.178) [-412.014] -- 0:00:15
742500 -- (-415.731) (-415.499) [-413.186] (-415.082) * (-413.566) (-412.727) (-413.934) [-414.908] -- 0:00:15
743000 -- (-412.586) (-415.378) [-414.296] (-416.809) * (-412.824) [-413.567] (-413.690) (-417.622) -- 0:00:15
743500 -- (-414.723) (-417.266) (-413.364) [-413.533] * (-412.052) (-413.666) (-414.355) [-418.383] -- 0:00:15
744000 -- [-414.103] (-413.713) (-413.592) (-414.043) * (-412.666) (-414.726) [-415.175] (-413.996) -- 0:00:15
744500 -- (-413.259) (-416.150) (-413.142) [-413.676] * (-412.882) (-412.963) (-415.120) [-414.712] -- 0:00:15
745000 -- (-412.946) (-415.862) (-412.509) [-412.650] * (-413.453) (-412.884) (-412.696) [-414.486] -- 0:00:15
Average standard deviation of split frequencies: 0.011560
745500 -- (-413.592) [-414.319] (-413.930) (-412.335) * (-415.176) (-412.045) [-413.259] (-414.662) -- 0:00:15
746000 -- [-415.154] (-413.426) (-417.155) (-413.287) * (-413.886) [-413.646] (-414.341) (-414.117) -- 0:00:15
746500 -- (-417.489) (-414.870) (-413.406) [-413.094] * [-413.390] (-412.452) (-412.426) (-414.716) -- 0:00:15
747000 -- [-413.571] (-413.749) (-412.277) (-413.607) * [-413.073] (-413.365) (-414.203) (-414.502) -- 0:00:15
747500 -- [-413.352] (-414.203) (-411.906) (-414.434) * (-412.981) [-412.828] (-414.790) (-415.736) -- 0:00:15
748000 -- [-412.752] (-414.870) (-417.611) (-417.957) * (-412.448) [-416.582] (-413.958) (-413.423) -- 0:00:15
748500 -- (-412.516) (-416.504) (-413.525) [-413.213] * [-412.279] (-414.024) (-413.541) (-414.754) -- 0:00:15
749000 -- (-413.991) [-411.782] (-414.479) (-414.519) * (-413.783) (-413.627) (-415.268) [-414.518] -- 0:00:15
749500 -- (-414.070) (-413.358) (-411.908) [-416.490] * (-413.062) (-411.665) (-413.669) [-414.408] -- 0:00:15
750000 -- (-413.901) (-414.175) (-412.511) [-413.361] * (-416.348) (-412.471) [-412.511] (-414.987) -- 0:00:15
Average standard deviation of split frequencies: 0.011784
750500 -- [-413.888] (-418.394) (-412.842) (-415.192) * (-412.853) (-414.190) [-416.429] (-411.952) -- 0:00:14
751000 -- [-412.780] (-416.244) (-414.099) (-413.759) * (-412.872) [-412.409] (-413.160) (-412.853) -- 0:00:14
751500 -- (-413.135) [-414.936] (-412.649) (-413.868) * (-413.164) (-419.785) [-412.658] (-414.045) -- 0:00:14
752000 -- (-415.880) (-419.148) (-414.363) [-414.747] * [-412.650] (-413.620) (-414.496) (-412.626) -- 0:00:14
752500 -- (-412.785) (-415.816) (-413.284) [-413.084] * [-415.876] (-414.399) (-413.442) (-412.768) -- 0:00:14
753000 -- (-412.750) (-417.025) (-413.636) [-413.094] * (-412.439) (-413.925) [-413.144] (-417.199) -- 0:00:14
753500 -- (-412.832) [-413.125] (-414.899) (-419.903) * (-413.152) (-415.598) [-412.754] (-413.987) -- 0:00:14
754000 -- (-411.675) [-412.250] (-416.063) (-412.034) * [-414.369] (-412.386) (-412.890) (-417.248) -- 0:00:14
754500 -- (-412.483) [-412.681] (-417.061) (-412.191) * [-414.729] (-412.534) (-415.513) (-418.812) -- 0:00:14
755000 -- (-415.409) (-417.503) [-418.576] (-413.391) * (-414.622) (-412.104) [-414.589] (-412.888) -- 0:00:14
Average standard deviation of split frequencies: 0.011811
755500 -- [-416.185] (-414.418) (-412.768) (-414.024) * (-412.560) (-412.816) [-412.426] (-414.496) -- 0:00:14
756000 -- (-414.246) (-418.940) (-412.598) [-412.487] * (-412.195) (-412.812) (-415.523) [-415.777] -- 0:00:14
756500 -- (-417.194) (-413.543) [-417.545] (-414.245) * (-412.145) [-414.704] (-414.819) (-412.936) -- 0:00:14
757000 -- (-415.894) [-415.238] (-414.631) (-412.465) * (-414.631) (-414.809) (-414.135) [-412.858] -- 0:00:14
757500 -- [-417.893] (-416.788) (-415.213) (-413.489) * (-415.217) [-414.585] (-412.667) (-412.181) -- 0:00:14
758000 -- [-413.214] (-414.473) (-413.520) (-413.728) * (-414.511) (-414.680) [-415.781] (-414.528) -- 0:00:14
758500 -- (-413.604) (-415.545) (-413.847) [-414.863] * (-414.473) (-413.862) (-413.516) [-412.560] -- 0:00:14
759000 -- (-413.293) (-413.257) [-411.774] (-414.356) * (-414.429) (-413.407) (-416.085) [-413.678] -- 0:00:14
759500 -- (-412.337) [-413.694] (-416.828) (-413.063) * (-413.095) (-414.362) (-414.162) [-420.172] -- 0:00:14
760000 -- (-412.806) [-413.663] (-419.572) (-414.446) * (-412.013) (-415.638) (-413.421) [-415.024] -- 0:00:14
Average standard deviation of split frequencies: 0.011852
760500 -- (-412.934) (-413.311) (-418.322) [-414.649] * (-414.343) (-413.827) [-412.631] (-416.842) -- 0:00:14
761000 -- [-415.473] (-413.877) (-414.169) (-413.508) * (-413.267) (-415.957) (-413.313) [-416.291] -- 0:00:14
761500 -- (-413.745) (-412.355) [-411.984] (-413.773) * [-413.306] (-415.170) (-414.113) (-413.892) -- 0:00:14
762000 -- (-413.592) [-413.445] (-415.496) (-415.517) * [-413.641] (-412.846) (-415.174) (-415.307) -- 0:00:14
762500 -- (-415.610) (-417.957) (-413.596) [-413.508] * [-413.940] (-415.534) (-414.496) (-413.097) -- 0:00:14
763000 -- (-414.444) (-413.760) (-413.200) [-413.438] * (-416.432) [-414.024] (-413.690) (-413.520) -- 0:00:14
763500 -- (-413.029) (-411.932) (-412.978) [-413.791] * (-413.607) (-413.353) (-413.192) [-414.792] -- 0:00:14
764000 -- (-412.080) (-413.028) (-413.525) [-413.620] * [-414.517] (-413.027) (-413.932) (-414.962) -- 0:00:14
764500 -- (-412.235) (-413.092) (-413.588) [-413.127] * [-417.443] (-412.884) (-412.735) (-414.287) -- 0:00:14
765000 -- (-412.527) [-413.795] (-416.009) (-414.682) * (-412.785) (-413.990) [-414.289] (-419.115) -- 0:00:14
Average standard deviation of split frequencies: 0.011476
765500 -- (-414.883) [-413.918] (-418.902) (-414.327) * [-413.377] (-413.608) (-417.955) (-415.678) -- 0:00:14
766000 -- [-411.893] (-414.476) (-415.956) (-413.345) * [-412.992] (-414.834) (-414.471) (-415.687) -- 0:00:14
766500 -- (-413.519) (-416.395) (-413.158) [-412.969] * [-414.539] (-417.831) (-413.765) (-414.306) -- 0:00:14
767000 -- [-414.915] (-413.751) (-413.051) (-411.782) * (-415.248) (-416.377) [-414.847] (-412.560) -- 0:00:13
767500 -- [-414.587] (-414.250) (-413.726) (-412.499) * [-416.660] (-414.285) (-415.804) (-416.011) -- 0:00:13
768000 -- (-414.603) (-414.812) (-412.538) [-415.240] * (-413.108) (-414.523) (-414.573) [-414.099] -- 0:00:13
768500 -- (-412.724) (-412.526) (-419.228) [-420.213] * [-412.141] (-412.219) (-413.952) (-413.763) -- 0:00:13
769000 -- (-413.605) [-416.798] (-415.469) (-417.330) * (-412.871) (-417.081) [-415.806] (-414.155) -- 0:00:13
769500 -- (-413.591) (-413.873) [-413.527] (-414.463) * (-413.469) (-414.722) [-414.549] (-413.096) -- 0:00:13
770000 -- (-414.944) [-412.623] (-413.253) (-412.588) * (-414.907) [-416.954] (-413.894) (-412.637) -- 0:00:13
Average standard deviation of split frequencies: 0.011851
770500 -- (-416.633) (-414.560) [-415.362] (-413.697) * (-413.945) (-413.938) [-413.388] (-414.101) -- 0:00:13
771000 -- (-413.007) [-413.958] (-414.406) (-413.347) * (-413.754) (-413.852) (-412.240) [-413.733] -- 0:00:13
771500 -- [-413.672] (-416.193) (-413.110) (-412.854) * (-414.783) (-413.666) (-413.599) [-412.148] -- 0:00:13
772000 -- [-411.950] (-412.273) (-415.829) (-417.008) * (-413.927) (-413.261) (-413.824) [-413.828] -- 0:00:13
772500 -- [-413.652] (-412.914) (-417.882) (-417.190) * (-415.662) (-413.233) [-414.018] (-416.464) -- 0:00:13
773000 -- (-413.460) (-420.041) [-412.905] (-415.141) * (-413.965) (-414.824) [-415.348] (-413.974) -- 0:00:13
773500 -- (-412.332) (-413.222) [-413.679] (-415.587) * [-414.821] (-416.004) (-413.531) (-412.384) -- 0:00:13
774000 -- (-412.895) (-413.595) (-413.250) [-414.024] * [-413.082] (-418.234) (-413.112) (-413.720) -- 0:00:13
774500 -- (-414.354) (-414.800) [-412.395] (-411.957) * (-414.904) (-412.569) [-415.453] (-412.482) -- 0:00:13
775000 -- (-419.565) (-415.070) [-414.412] (-414.863) * (-414.932) [-415.511] (-415.450) (-412.971) -- 0:00:13
Average standard deviation of split frequencies: 0.011352
775500 -- (-416.099) [-414.979] (-418.152) (-412.199) * [-413.007] (-415.016) (-411.774) (-413.818) -- 0:00:13
776000 -- (-414.987) (-414.976) (-412.918) [-412.245] * (-418.240) [-412.853] (-413.560) (-418.280) -- 0:00:13
776500 -- (-411.554) (-413.316) (-417.015) [-412.650] * (-415.254) (-416.744) [-413.407] (-414.534) -- 0:00:13
777000 -- (-412.347) (-412.340) [-413.087] (-416.239) * (-415.680) (-412.831) (-414.303) [-414.036] -- 0:00:13
777500 -- (-414.960) (-414.341) (-414.517) [-416.858] * (-418.521) (-412.810) [-412.008] (-419.137) -- 0:00:13
778000 -- (-413.603) (-423.937) [-420.765] (-420.951) * [-415.611] (-411.869) (-412.087) (-416.454) -- 0:00:13
778500 -- [-412.857] (-413.054) (-414.127) (-415.829) * (-413.060) [-412.720] (-414.201) (-414.138) -- 0:00:13
779000 -- (-412.761) [-412.177] (-413.967) (-412.968) * (-412.482) [-412.984] (-412.592) (-413.441) -- 0:00:13
779500 -- (-413.104) (-412.823) (-415.725) [-413.611] * [-413.845] (-412.287) (-414.290) (-412.638) -- 0:00:13
780000 -- [-413.416] (-412.853) (-414.277) (-412.393) * (-412.726) [-412.543] (-414.270) (-415.834) -- 0:00:13
Average standard deviation of split frequencies: 0.011209
780500 -- (-414.328) (-416.069) (-413.719) [-414.524] * [-420.198] (-414.288) (-414.075) (-416.758) -- 0:00:13
781000 -- (-418.630) (-416.252) (-415.487) [-414.964] * [-413.501] (-414.471) (-414.087) (-412.695) -- 0:00:13
781500 -- (-416.336) [-415.341] (-412.751) (-414.219) * (-412.814) [-415.122] (-420.169) (-412.840) -- 0:00:13
782000 -- (-414.054) (-414.119) (-413.237) [-414.818] * (-412.880) (-413.969) (-416.093) [-416.668] -- 0:00:13
782500 -- (-416.999) (-417.751) (-414.375) [-414.222] * (-414.285) [-412.790] (-413.414) (-418.701) -- 0:00:13
783000 -- (-413.899) (-412.386) (-413.487) [-414.354] * (-412.520) [-412.941] (-413.297) (-414.590) -- 0:00:13
783500 -- (-417.338) [-415.974] (-416.778) (-413.502) * (-412.214) (-416.238) (-417.656) [-412.510] -- 0:00:12
784000 -- (-412.350) (-415.121) [-415.068] (-412.741) * (-414.733) [-413.977] (-415.390) (-414.495) -- 0:00:12
784500 -- (-416.056) (-413.303) [-414.226] (-414.361) * [-412.166] (-415.012) (-414.265) (-414.538) -- 0:00:12
785000 -- (-412.531) (-413.401) [-412.800] (-415.190) * (-414.311) [-413.987] (-413.140) (-412.517) -- 0:00:12
Average standard deviation of split frequencies: 0.011283
785500 -- (-413.192) (-413.525) (-414.915) [-413.295] * (-414.134) (-425.735) (-414.420) [-413.116] -- 0:00:12
786000 -- (-412.221) (-415.577) [-412.745] (-414.792) * (-413.022) (-424.947) [-413.244] (-415.767) -- 0:00:12
786500 -- (-415.677) (-412.578) [-414.476] (-413.845) * (-412.048) (-412.345) (-413.790) [-413.543] -- 0:00:12
787000 -- (-412.886) (-415.088) [-414.632] (-415.379) * (-414.354) [-413.213] (-413.979) (-416.391) -- 0:00:12
787500 -- (-417.279) [-413.120] (-414.192) (-413.574) * [-417.018] (-416.198) (-413.788) (-415.748) -- 0:00:12
788000 -- (-415.455) (-412.413) (-415.991) [-414.220] * (-414.666) [-415.806] (-413.877) (-412.698) -- 0:00:12
788500 -- (-412.617) (-412.138) [-413.445] (-416.646) * (-415.814) [-412.742] (-415.865) (-411.890) -- 0:00:12
789000 -- (-411.647) (-413.364) [-412.331] (-413.319) * (-412.660) (-414.030) [-412.638] (-415.489) -- 0:00:12
789500 -- (-413.711) [-412.451] (-412.334) (-414.571) * (-415.728) (-419.130) [-412.199] (-413.310) -- 0:00:12
790000 -- (-416.264) (-412.200) (-415.852) [-412.442] * [-411.978] (-413.003) (-412.720) (-413.724) -- 0:00:12
Average standard deviation of split frequencies: 0.011067
790500 -- (-414.416) (-413.690) (-414.937) [-412.817] * (-412.798) (-411.817) [-412.923] (-414.129) -- 0:00:12
791000 -- (-417.551) (-412.815) (-414.295) [-414.499] * [-413.176] (-413.946) (-415.085) (-415.559) -- 0:00:12
791500 -- [-412.728] (-414.439) (-413.273) (-414.540) * [-415.173] (-415.241) (-417.399) (-415.157) -- 0:00:12
792000 -- (-415.992) (-414.634) (-414.201) [-412.924] * (-414.403) [-414.055] (-418.527) (-414.148) -- 0:00:12
792500 -- [-413.360] (-413.609) (-415.401) (-417.288) * (-413.858) [-413.236] (-417.884) (-413.373) -- 0:00:12
793000 -- [-414.918] (-419.817) (-412.427) (-415.347) * [-414.508] (-416.353) (-413.979) (-413.590) -- 0:00:12
793500 -- [-414.451] (-417.396) (-417.758) (-413.987) * [-415.692] (-412.555) (-414.024) (-413.292) -- 0:00:12
794000 -- [-413.992] (-414.866) (-416.797) (-414.393) * (-417.777) (-414.455) (-413.382) [-412.204] -- 0:00:12
794500 -- (-415.247) (-416.905) (-417.845) [-415.369] * (-417.385) (-414.272) (-414.751) [-414.404] -- 0:00:12
795000 -- (-413.684) (-415.355) [-413.459] (-414.969) * [-415.092] (-412.713) (-415.681) (-414.742) -- 0:00:12
Average standard deviation of split frequencies: 0.011437
795500 -- (-413.945) (-414.684) (-414.175) [-413.092] * (-412.196) (-418.229) [-413.307] (-412.119) -- 0:00:12
796000 -- [-413.421] (-416.420) (-414.089) (-412.615) * (-414.338) (-419.107) [-414.544] (-414.106) -- 0:00:12
796500 -- (-413.206) [-415.689] (-413.578) (-416.153) * (-415.524) (-415.750) (-413.053) [-413.022] -- 0:00:12
797000 -- (-412.941) [-413.746] (-414.550) (-412.764) * (-412.505) (-416.239) [-412.459] (-413.982) -- 0:00:12
797500 -- (-414.619) (-415.559) (-413.118) [-414.014] * (-412.019) (-416.476) [-413.836] (-413.810) -- 0:00:12
798000 -- [-416.761] (-414.307) (-417.311) (-413.379) * (-413.765) (-417.431) [-412.426] (-413.709) -- 0:00:12
798500 -- (-414.570) (-412.474) (-416.553) [-412.513] * [-413.778] (-415.098) (-412.565) (-411.930) -- 0:00:12
799000 -- (-413.730) [-415.880] (-415.296) (-415.583) * (-412.671) (-412.672) (-414.953) [-412.493] -- 0:00:12
799500 -- (-415.835) (-413.945) (-417.946) [-414.698] * (-412.857) (-417.575) [-413.815] (-414.609) -- 0:00:12
800000 -- (-412.567) (-414.448) (-414.576) [-415.868] * [-414.273] (-416.085) (-415.392) (-415.036) -- 0:00:12
Average standard deviation of split frequencies: 0.010782
800500 -- (-414.468) [-412.497] (-417.106) (-417.361) * (-413.199) [-413.251] (-416.095) (-417.516) -- 0:00:11
801000 -- (-415.952) [-416.576] (-421.187) (-418.336) * (-415.104) (-413.684) (-414.770) [-413.464] -- 0:00:11
801500 -- (-417.947) [-412.196] (-417.191) (-415.069) * (-411.715) (-412.554) (-418.232) [-414.361] -- 0:00:11
802000 -- (-413.316) [-411.890] (-415.770) (-413.569) * (-414.759) (-414.518) [-413.417] (-413.320) -- 0:00:11
802500 -- (-414.922) [-414.443] (-413.197) (-416.145) * (-416.738) (-412.547) [-413.608] (-412.720) -- 0:00:11
803000 -- [-414.697] (-412.404) (-414.647) (-413.801) * (-414.940) (-412.799) (-415.272) [-415.642] -- 0:00:11
803500 -- (-412.860) (-412.123) [-412.417] (-414.975) * (-414.865) (-413.589) [-414.047] (-415.498) -- 0:00:11
804000 -- (-412.467) (-415.254) [-412.264] (-416.070) * (-420.084) (-417.214) [-413.174] (-413.181) -- 0:00:11
804500 -- (-414.926) [-414.873] (-415.562) (-413.766) * [-411.724] (-412.814) (-413.450) (-414.065) -- 0:00:11
805000 -- (-412.684) (-414.193) [-413.800] (-413.401) * (-414.240) (-414.372) (-413.148) [-413.136] -- 0:00:11
Average standard deviation of split frequencies: 0.010418
805500 -- (-417.050) (-415.167) (-419.265) [-413.700] * [-412.670] (-416.607) (-418.584) (-413.930) -- 0:00:11
806000 -- [-414.201] (-412.707) (-413.505) (-415.840) * (-415.359) (-414.822) [-414.176] (-417.981) -- 0:00:11
806500 -- (-413.967) (-415.317) [-413.880] (-414.630) * (-412.787) [-412.179] (-413.354) (-413.808) -- 0:00:11
807000 -- (-414.723) (-412.049) (-413.546) [-415.247] * (-416.723) (-412.117) [-413.002] (-414.531) -- 0:00:11
807500 -- (-413.347) [-412.270] (-413.489) (-416.416) * [-413.311] (-413.319) (-415.061) (-416.219) -- 0:00:11
808000 -- (-414.027) (-412.943) (-412.614) [-414.057] * [-413.829] (-412.394) (-421.358) (-414.560) -- 0:00:11
808500 -- (-413.065) [-414.851] (-413.722) (-416.988) * (-415.014) [-413.047] (-414.920) (-414.846) -- 0:00:11
809000 -- (-414.206) [-414.340] (-416.395) (-416.346) * (-412.708) (-412.127) (-414.922) [-412.562] -- 0:00:11
809500 -- (-411.777) (-420.415) (-416.481) [-417.618] * [-414.522] (-413.280) (-412.699) (-413.369) -- 0:00:11
810000 -- (-416.014) (-422.276) [-414.121] (-412.490) * (-413.928) [-416.072] (-416.260) (-412.264) -- 0:00:11
Average standard deviation of split frequencies: 0.009595
810500 -- (-412.209) (-414.350) [-412.408] (-415.526) * (-420.756) (-414.318) (-414.088) [-414.524] -- 0:00:11
811000 -- (-414.539) (-412.493) [-416.195] (-413.609) * (-414.488) [-412.611] (-413.447) (-412.949) -- 0:00:11
811500 -- (-418.631) (-412.176) [-413.312] (-417.571) * (-412.099) [-413.429] (-413.576) (-414.888) -- 0:00:11
812000 -- (-413.754) (-413.271) (-414.123) [-417.205] * (-412.764) (-414.249) (-415.826) [-416.370] -- 0:00:11
812500 -- (-413.041) (-412.065) (-416.395) [-413.480] * (-412.559) (-414.947) [-416.533] (-414.016) -- 0:00:11
813000 -- (-417.182) [-413.515] (-413.396) (-414.504) * (-417.103) (-416.724) [-413.415] (-412.016) -- 0:00:11
813500 -- (-415.421) (-412.781) (-414.804) [-412.336] * (-415.290) (-421.390) (-418.094) [-413.827] -- 0:00:11
814000 -- [-414.451] (-413.841) (-414.074) (-413.638) * (-414.949) (-416.351) (-415.511) [-413.930] -- 0:00:11
814500 -- (-412.484) (-414.446) [-412.540] (-413.275) * (-414.177) (-413.028) (-414.496) [-414.810] -- 0:00:11
815000 -- [-413.712] (-413.184) (-413.151) (-416.232) * (-413.737) [-414.677] (-413.842) (-414.404) -- 0:00:11
Average standard deviation of split frequencies: 0.009785
815500 -- (-414.042) [-413.388] (-412.881) (-416.012) * [-412.523] (-413.497) (-413.772) (-414.533) -- 0:00:11
816000 -- (-414.573) (-414.172) [-413.559] (-413.168) * [-415.847] (-418.947) (-417.521) (-414.751) -- 0:00:11
816500 -- [-414.821] (-414.608) (-412.382) (-411.885) * (-413.182) (-417.576) (-413.767) [-414.750] -- 0:00:11
817000 -- (-417.374) (-417.301) (-412.203) [-413.384] * [-412.854] (-412.084) (-413.291) (-415.499) -- 0:00:10
817500 -- (-415.661) [-413.179] (-413.123) (-413.658) * (-412.852) (-413.628) (-415.127) [-412.228] -- 0:00:10
818000 -- [-412.484] (-415.643) (-415.414) (-415.140) * [-413.036] (-413.976) (-415.231) (-413.720) -- 0:00:10
818500 -- [-412.520] (-419.144) (-414.460) (-415.178) * (-414.333) (-412.151) [-415.769] (-416.050) -- 0:00:10
819000 -- [-412.702] (-415.721) (-412.790) (-412.909) * (-416.396) (-414.925) (-415.452) [-414.219] -- 0:00:10
819500 -- [-413.773] (-414.098) (-414.641) (-412.679) * [-413.810] (-421.039) (-414.493) (-415.147) -- 0:00:10
820000 -- (-413.380) (-412.514) (-413.686) [-413.426] * (-413.019) (-416.952) [-413.378] (-416.290) -- 0:00:10
Average standard deviation of split frequencies: 0.010124
820500 -- [-412.063] (-412.825) (-414.944) (-414.412) * (-412.225) (-413.121) [-412.527] (-418.422) -- 0:00:10
821000 -- (-412.731) [-417.155] (-416.919) (-416.697) * (-412.192) (-412.880) [-412.136] (-413.386) -- 0:00:10
821500 -- [-412.802] (-413.727) (-413.626) (-414.331) * (-415.077) [-416.483] (-414.225) (-417.705) -- 0:00:10
822000 -- [-413.690] (-418.290) (-417.168) (-414.576) * (-416.624) (-416.347) [-414.007] (-413.849) -- 0:00:10
822500 -- (-413.577) [-414.399] (-413.624) (-411.963) * [-412.995] (-417.992) (-412.001) (-414.938) -- 0:00:10
823000 -- (-414.601) (-415.505) [-412.997] (-411.965) * (-415.522) (-416.916) (-415.376) [-418.657] -- 0:00:10
823500 -- (-412.828) (-412.153) (-413.179) [-412.149] * (-414.459) (-413.002) [-415.676] (-419.209) -- 0:00:10
824000 -- (-412.773) (-413.560) [-412.770] (-413.206) * [-413.796] (-415.681) (-416.077) (-414.452) -- 0:00:10
824500 -- [-413.461] (-418.306) (-414.072) (-413.327) * (-416.558) (-412.576) (-413.557) [-413.803] -- 0:00:10
825000 -- (-413.188) (-412.177) (-414.201) [-412.318] * (-415.266) [-412.908] (-413.558) (-412.486) -- 0:00:10
Average standard deviation of split frequencies: 0.009809
825500 -- (-414.263) (-412.435) [-411.779] (-412.358) * (-414.312) (-416.168) (-413.426) [-414.977] -- 0:00:10
826000 -- (-412.546) (-415.508) [-412.317] (-412.777) * (-417.514) [-414.412] (-414.797) (-416.641) -- 0:00:10
826500 -- (-414.872) (-412.710) [-416.255] (-412.822) * [-412.524] (-412.822) (-412.956) (-412.286) -- 0:00:10
827000 -- (-412.910) [-413.730] (-413.183) (-414.920) * (-412.150) (-412.346) [-413.993] (-417.407) -- 0:00:10
827500 -- (-415.383) [-414.458] (-416.606) (-413.068) * [-414.441] (-415.287) (-414.445) (-413.557) -- 0:00:10
828000 -- (-418.924) [-412.288] (-417.735) (-413.106) * (-417.805) (-416.133) [-413.885] (-415.567) -- 0:00:10
828500 -- (-413.231) (-413.417) (-412.483) [-412.972] * (-418.445) (-417.890) (-414.596) [-411.986] -- 0:00:10
829000 -- [-412.471] (-415.463) (-412.447) (-415.456) * (-414.090) (-415.103) (-415.842) [-413.888] -- 0:00:10
829500 -- (-412.800) (-413.906) [-411.719] (-415.281) * [-412.561] (-412.109) (-416.209) (-413.164) -- 0:00:10
830000 -- (-415.363) (-414.950) [-414.406] (-413.855) * (-414.148) (-412.997) [-416.141] (-413.067) -- 0:00:10
Average standard deviation of split frequencies: 0.009789
830500 -- (-413.952) (-416.351) [-414.287] (-413.076) * (-415.738) (-415.687) (-418.161) [-412.311] -- 0:00:10
831000 -- (-412.885) (-416.261) [-412.983] (-416.964) * (-413.158) (-416.552) (-416.119) [-413.179] -- 0:00:10
831500 -- [-412.875] (-417.136) (-416.692) (-413.555) * (-412.734) [-412.328] (-413.415) (-413.445) -- 0:00:10
832000 -- [-414.800] (-415.414) (-416.057) (-416.637) * (-413.677) [-414.216] (-412.847) (-414.296) -- 0:00:10
832500 -- (-417.473) (-413.256) [-413.701] (-415.637) * [-412.810] (-418.337) (-415.240) (-412.888) -- 0:00:10
833000 -- (-414.115) [-412.859] (-416.406) (-417.199) * (-412.510) (-414.984) (-412.848) [-414.439] -- 0:00:10
833500 -- (-415.145) [-414.029] (-413.666) (-412.376) * [-412.475] (-413.857) (-413.995) (-413.750) -- 0:00:09
834000 -- (-412.812) [-413.996] (-412.263) (-412.658) * [-413.898] (-414.296) (-413.455) (-414.327) -- 0:00:09
834500 -- (-414.500) (-414.514) [-413.610] (-412.808) * (-413.363) (-415.009) [-413.395] (-415.925) -- 0:00:09
835000 -- (-416.305) (-414.954) (-414.811) [-412.262] * (-414.551) [-417.141] (-415.161) (-415.171) -- 0:00:09
Average standard deviation of split frequencies: 0.009586
835500 -- (-414.870) [-413.725] (-417.399) (-412.261) * (-414.833) (-413.331) (-413.848) [-413.280] -- 0:00:09
836000 -- [-415.310] (-413.552) (-415.555) (-414.091) * (-413.084) (-416.662) (-413.247) [-411.844] -- 0:00:09
836500 -- (-414.722) [-416.666] (-414.930) (-413.361) * (-414.247) [-417.167] (-414.259) (-411.987) -- 0:00:09
837000 -- (-413.279) (-412.594) [-413.736] (-413.868) * (-415.524) (-418.842) (-414.173) [-412.339] -- 0:00:09
837500 -- (-417.852) [-412.729] (-414.561) (-413.167) * (-413.757) [-413.543] (-417.404) (-413.961) -- 0:00:09
838000 -- (-413.841) [-411.910] (-415.784) (-416.321) * (-416.699) (-413.412) [-412.925] (-414.546) -- 0:00:09
838500 -- [-415.898] (-412.586) (-416.718) (-414.222) * (-413.319) (-414.332) (-412.126) [-412.234] -- 0:00:09
839000 -- (-415.151) [-418.081] (-414.295) (-415.987) * (-414.276) (-413.447) [-412.346] (-416.335) -- 0:00:09
839500 -- (-413.587) [-415.181] (-411.676) (-416.534) * (-416.030) (-416.462) [-412.794] (-417.032) -- 0:00:09
840000 -- (-413.557) (-415.540) (-413.780) [-415.259] * (-412.925) (-415.012) [-412.843] (-414.809) -- 0:00:09
Average standard deviation of split frequencies: 0.009322
840500 -- [-416.264] (-412.513) (-413.978) (-413.531) * (-413.113) [-412.744] (-413.045) (-413.703) -- 0:00:09
841000 -- (-412.973) (-415.648) [-413.270] (-413.626) * (-415.362) [-412.828] (-417.544) (-412.099) -- 0:00:09
841500 -- (-412.974) (-412.789) [-412.288] (-413.066) * (-416.657) (-413.692) [-412.952] (-414.310) -- 0:00:09
842000 -- (-414.695) (-415.516) (-413.871) [-413.290] * (-412.821) [-412.367] (-414.979) (-415.701) -- 0:00:09
842500 -- (-415.332) (-412.451) (-412.665) [-419.131] * [-412.195] (-412.594) (-413.367) (-415.625) -- 0:00:09
843000 -- (-414.969) (-412.725) (-414.295) [-412.621] * (-412.655) (-412.514) [-412.824] (-416.441) -- 0:00:09
843500 -- (-413.565) (-415.257) (-413.313) [-413.554] * (-413.634) (-412.001) (-417.510) [-413.817] -- 0:00:09
844000 -- (-414.075) (-412.380) [-413.504] (-412.634) * (-414.438) [-412.899] (-414.815) (-412.190) -- 0:00:09
844500 -- (-413.909) (-412.980) (-415.418) [-412.477] * [-414.747] (-412.408) (-414.512) (-414.432) -- 0:00:09
845000 -- [-413.712] (-414.949) (-412.835) (-412.375) * (-416.617) (-417.132) [-415.754] (-417.488) -- 0:00:09
Average standard deviation of split frequencies: 0.009090
845500 -- (-412.793) [-412.367] (-412.363) (-417.627) * (-412.905) [-416.569] (-412.490) (-413.744) -- 0:00:09
846000 -- [-411.916] (-416.043) (-416.657) (-414.664) * (-412.058) [-412.742] (-412.967) (-414.140) -- 0:00:09
846500 -- (-412.228) (-415.901) [-413.503] (-412.586) * (-414.741) [-414.324] (-419.611) (-416.616) -- 0:00:09
847000 -- (-413.572) (-415.924) [-413.837] (-412.169) * (-413.847) (-413.601) [-413.925] (-412.673) -- 0:00:09
847500 -- (-412.821) [-413.422] (-419.359) (-412.324) * (-416.976) (-412.121) (-415.379) [-413.650] -- 0:00:09
848000 -- (-418.287) (-412.586) (-416.007) [-413.102] * [-414.740] (-412.969) (-414.495) (-413.598) -- 0:00:09
848500 -- (-419.837) [-414.281] (-412.798) (-414.266) * (-414.399) (-412.574) (-414.146) [-412.770] -- 0:00:09
849000 -- (-412.526) [-413.976] (-413.451) (-417.585) * (-412.886) (-413.235) [-412.880] (-414.899) -- 0:00:09
849500 -- (-413.680) (-412.351) (-414.547) [-413.042] * [-414.417] (-414.535) (-415.044) (-419.212) -- 0:00:09
850000 -- (-414.397) (-413.760) (-416.425) [-412.884] * [-413.841] (-415.274) (-412.315) (-412.933) -- 0:00:09
Average standard deviation of split frequencies: 0.008763
850500 -- (-412.549) (-415.037) (-416.856) [-413.362] * [-417.156] (-414.019) (-413.432) (-412.992) -- 0:00:08
851000 -- [-413.941] (-413.898) (-415.123) (-414.075) * [-413.389] (-413.820) (-414.261) (-414.556) -- 0:00:08
851500 -- [-417.308] (-413.229) (-415.806) (-415.532) * (-413.928) (-418.138) (-415.535) [-414.354] -- 0:00:08
852000 -- [-414.019] (-412.134) (-412.880) (-413.972) * [-415.195] (-415.305) (-417.601) (-415.012) -- 0:00:08
852500 -- (-414.742) (-413.236) [-416.381] (-413.773) * [-413.712] (-413.382) (-416.974) (-414.942) -- 0:00:08
853000 -- (-414.438) [-412.129] (-415.615) (-414.007) * [-413.793] (-413.131) (-415.026) (-412.871) -- 0:00:08
853500 -- (-412.617) [-413.101] (-413.150) (-413.384) * (-412.887) (-413.043) (-413.153) [-412.708] -- 0:00:08
854000 -- (-413.473) (-416.271) [-412.814] (-412.517) * (-414.945) (-414.889) [-414.000] (-414.590) -- 0:00:08
854500 -- (-412.262) [-416.740] (-414.223) (-412.022) * (-415.279) (-417.357) (-414.068) [-416.632] -- 0:00:08
855000 -- (-419.224) (-415.905) (-416.536) [-414.810] * (-416.125) (-415.850) [-411.703] (-412.490) -- 0:00:08
Average standard deviation of split frequencies: 0.008329
855500 -- (-414.576) (-415.454) [-413.794] (-413.458) * (-412.337) (-414.005) (-412.966) [-413.691] -- 0:00:08
856000 -- (-416.119) (-414.847) (-414.130) [-415.479] * (-413.047) (-412.934) (-412.484) [-412.486] -- 0:00:08
856500 -- [-412.887] (-412.973) (-411.685) (-417.858) * (-417.457) (-413.581) [-413.600] (-420.483) -- 0:00:08
857000 -- (-412.221) (-414.640) [-411.801] (-412.561) * (-415.793) (-414.269) [-415.855] (-415.229) -- 0:00:08
857500 -- (-412.608) [-413.111] (-412.260) (-413.054) * (-414.585) (-415.912) [-413.687] (-413.596) -- 0:00:08
858000 -- (-412.973) [-412.804] (-415.308) (-411.849) * [-412.761] (-415.399) (-413.159) (-415.428) -- 0:00:08
858500 -- (-413.670) (-413.169) (-417.519) [-414.606] * (-413.916) [-418.457] (-413.786) (-414.254) -- 0:00:08
859000 -- [-413.821] (-412.019) (-412.410) (-417.490) * (-414.953) [-417.124] (-415.157) (-413.175) -- 0:00:08
859500 -- (-414.054) (-414.080) (-413.560) [-414.057] * (-413.382) (-415.107) [-415.807] (-413.250) -- 0:00:08
860000 -- (-416.242) (-412.088) (-414.780) [-413.758] * (-412.546) (-414.768) (-415.430) [-412.657] -- 0:00:08
Average standard deviation of split frequencies: 0.008079
860500 -- (-412.900) [-412.122] (-415.795) (-416.676) * (-416.806) (-412.536) (-413.010) [-414.192] -- 0:00:08
861000 -- (-412.199) [-411.891] (-416.254) (-416.207) * (-414.556) (-411.971) [-413.105] (-414.828) -- 0:00:08
861500 -- [-411.956] (-416.192) (-414.520) (-417.002) * (-415.812) [-412.641] (-413.110) (-413.309) -- 0:00:08
862000 -- [-414.784] (-413.328) (-412.963) (-416.187) * (-413.599) [-414.351] (-414.455) (-412.165) -- 0:00:08
862500 -- (-417.602) [-414.864] (-414.856) (-412.655) * (-414.245) (-414.542) [-417.009] (-412.713) -- 0:00:08
863000 -- [-414.615] (-412.750) (-412.529) (-417.056) * (-412.338) (-414.972) [-412.956] (-413.407) -- 0:00:08
863500 -- (-414.191) [-412.356] (-413.489) (-412.944) * [-413.722] (-415.421) (-414.272) (-412.847) -- 0:00:08
864000 -- [-415.406] (-416.248) (-415.981) (-414.099) * [-414.494] (-416.653) (-416.495) (-414.283) -- 0:00:08
864500 -- (-413.510) (-413.478) (-416.521) [-415.014] * (-414.911) [-414.659] (-416.169) (-415.145) -- 0:00:08
865000 -- [-414.437] (-417.730) (-414.721) (-414.949) * [-419.479] (-415.686) (-412.509) (-413.711) -- 0:00:08
Average standard deviation of split frequencies: 0.007893
865500 -- [-412.001] (-415.965) (-414.717) (-415.202) * (-411.624) [-412.280] (-413.233) (-414.942) -- 0:00:08
866000 -- (-413.030) [-413.840] (-419.129) (-415.381) * (-412.032) (-418.333) [-412.019] (-416.292) -- 0:00:08
866500 -- (-413.031) [-413.803] (-416.405) (-412.323) * [-415.152] (-412.698) (-418.938) (-416.686) -- 0:00:08
867000 -- [-412.640] (-416.277) (-412.281) (-412.847) * (-411.857) [-412.955] (-413.317) (-413.390) -- 0:00:07
867500 -- [-412.771] (-416.540) (-414.857) (-413.302) * (-414.208) (-413.073) (-415.835) [-412.674] -- 0:00:07
868000 -- [-413.480] (-414.338) (-412.471) (-415.393) * (-413.258) [-411.905] (-414.331) (-414.339) -- 0:00:07
868500 -- (-413.730) [-413.401] (-413.185) (-420.409) * [-413.279] (-412.564) (-413.019) (-414.239) -- 0:00:07
869000 -- [-413.374] (-414.671) (-412.229) (-412.632) * [-412.730] (-412.120) (-414.057) (-418.275) -- 0:00:07
869500 -- (-415.898) (-412.594) (-413.503) [-412.372] * (-418.045) [-413.059] (-412.663) (-417.703) -- 0:00:07
870000 -- (-415.099) (-412.652) (-416.329) [-412.238] * (-412.466) [-413.935] (-416.481) (-414.749) -- 0:00:07
Average standard deviation of split frequencies: 0.007749
870500 -- [-418.013] (-414.667) (-414.242) (-411.940) * (-414.602) [-414.730] (-413.214) (-413.544) -- 0:00:07
871000 -- [-413.515] (-412.891) (-412.535) (-413.034) * [-412.550] (-414.480) (-413.330) (-414.079) -- 0:00:07
871500 -- (-417.376) (-419.117) [-411.679] (-413.699) * [-414.361] (-413.643) (-412.547) (-413.436) -- 0:00:07
872000 -- (-415.731) [-414.701] (-411.947) (-416.538) * (-418.133) (-413.417) (-413.077) [-413.952] -- 0:00:07
872500 -- [-415.120] (-414.332) (-415.927) (-415.992) * [-413.622] (-415.783) (-420.925) (-414.954) -- 0:00:07
873000 -- (-412.943) (-413.702) [-416.118] (-418.542) * (-413.099) (-417.986) (-417.886) [-413.682] -- 0:00:07
873500 -- [-413.235] (-412.847) (-413.147) (-414.464) * [-412.799] (-415.577) (-419.961) (-412.670) -- 0:00:07
874000 -- (-414.744) (-412.461) (-412.331) [-414.291] * [-412.035] (-414.708) (-414.850) (-413.523) -- 0:00:07
874500 -- (-414.732) (-414.062) [-411.766] (-412.512) * (-413.783) (-415.533) [-411.798] (-413.018) -- 0:00:07
875000 -- (-418.210) [-413.972] (-413.845) (-412.146) * (-412.840) (-414.337) (-413.976) [-416.441] -- 0:00:07
Average standard deviation of split frequencies: 0.007964
875500 -- (-416.073) [-412.195] (-415.072) (-413.326) * [-412.073] (-413.175) (-416.256) (-415.160) -- 0:00:07
876000 -- (-411.876) (-413.244) (-412.024) [-415.131] * [-414.024] (-413.387) (-418.027) (-412.899) -- 0:00:07
876500 -- (-413.950) (-417.959) (-414.173) [-411.851] * (-413.072) [-414.739] (-415.080) (-411.789) -- 0:00:07
877000 -- (-416.198) (-415.683) (-416.870) [-414.014] * (-414.532) (-413.371) (-414.842) [-415.655] -- 0:00:07
877500 -- (-418.634) [-414.520] (-414.299) (-411.820) * (-411.741) (-415.443) [-415.176] (-412.371) -- 0:00:07
878000 -- (-414.691) (-414.140) [-417.334] (-415.385) * (-411.775) [-414.200] (-417.115) (-414.234) -- 0:00:07
878500 -- (-414.907) [-412.550] (-413.552) (-413.571) * (-411.811) (-415.385) [-415.765] (-417.689) -- 0:00:07
879000 -- (-415.984) (-414.328) (-414.756) [-413.355] * (-415.742) (-416.602) [-412.628] (-411.883) -- 0:00:07
879500 -- [-412.849] (-412.663) (-415.107) (-412.789) * (-413.010) [-413.899] (-413.085) (-415.191) -- 0:00:07
880000 -- (-415.058) (-413.329) [-415.993] (-415.487) * (-411.762) (-414.469) [-412.340] (-413.002) -- 0:00:07
Average standard deviation of split frequencies: 0.008431
880500 -- (-415.731) (-419.120) [-414.623] (-415.819) * (-413.036) [-417.742] (-412.165) (-413.613) -- 0:00:07
881000 -- [-414.183] (-414.021) (-416.316) (-413.265) * (-413.214) (-415.372) [-414.606] (-413.579) -- 0:00:07
881500 -- (-413.772) [-412.672] (-417.621) (-417.699) * (-416.788) (-413.882) (-418.922) [-412.084] -- 0:00:07
882000 -- [-412.831] (-414.673) (-414.125) (-417.058) * (-412.645) (-419.760) (-417.114) [-413.735] -- 0:00:07
882500 -- [-412.938] (-413.170) (-416.405) (-413.853) * [-414.600] (-414.905) (-413.374) (-412.630) -- 0:00:07
883000 -- [-413.934] (-412.538) (-412.711) (-414.873) * (-412.017) [-412.516] (-413.645) (-413.320) -- 0:00:07
883500 -- (-415.722) (-413.601) (-413.878) [-414.680] * (-415.326) (-413.569) (-414.654) [-412.455] -- 0:00:06
884000 -- (-414.242) [-411.987] (-412.194) (-413.169) * (-414.650) [-415.498] (-413.232) (-414.465) -- 0:00:06
884500 -- (-411.897) (-412.092) [-412.102] (-414.754) * [-413.326] (-416.468) (-420.762) (-413.275) -- 0:00:06
885000 -- (-414.475) (-412.365) [-414.258] (-414.904) * (-413.854) [-413.922] (-412.807) (-412.347) -- 0:00:06
Average standard deviation of split frequencies: 0.008200
885500 -- (-413.549) (-417.081) (-415.991) [-413.561] * (-413.569) (-419.672) [-412.682] (-412.080) -- 0:00:06
886000 -- (-413.757) (-414.795) (-413.087) [-418.286] * [-412.699] (-419.023) (-412.994) (-412.982) -- 0:00:06
886500 -- [-412.934] (-412.610) (-417.746) (-414.156) * (-414.122) (-415.454) (-413.081) [-413.093] -- 0:00:06
887000 -- (-414.039) (-413.286) (-412.358) [-412.330] * (-417.974) (-416.738) [-415.397] (-420.589) -- 0:00:06
887500 -- (-414.213) [-412.274] (-418.158) (-416.060) * (-414.061) (-420.489) [-417.295] (-414.530) -- 0:00:06
888000 -- [-414.682] (-412.900) (-415.806) (-421.141) * (-417.286) (-418.522) [-415.009] (-416.130) -- 0:00:06
888500 -- (-412.399) [-416.339] (-420.807) (-418.342) * (-418.303) (-412.406) (-415.011) [-415.784] -- 0:00:06
889000 -- (-417.032) (-413.891) [-417.495] (-417.908) * [-414.540] (-411.976) (-414.367) (-413.857) -- 0:00:06
889500 -- (-416.579) (-414.067) [-413.787] (-414.843) * (-412.316) [-412.247] (-411.679) (-414.334) -- 0:00:06
890000 -- (-413.594) (-414.768) [-412.713] (-413.473) * [-411.662] (-412.907) (-413.505) (-414.860) -- 0:00:06
Average standard deviation of split frequencies: 0.007674
890500 -- (-413.726) [-416.993] (-413.474) (-413.552) * (-411.911) (-413.196) (-412.608) [-413.256] -- 0:00:06
891000 -- (-411.914) (-413.736) [-411.840] (-413.457) * (-412.834) (-413.156) [-413.058] (-414.762) -- 0:00:06
891500 -- (-415.914) (-413.049) [-412.467] (-415.742) * [-414.480] (-413.736) (-413.760) (-414.061) -- 0:00:06
892000 -- (-414.670) (-414.556) (-415.903) [-417.044] * (-414.436) (-417.572) (-414.601) [-412.992] -- 0:00:06
892500 -- (-415.779) [-414.824] (-418.220) (-418.240) * [-414.199] (-413.222) (-414.114) (-414.050) -- 0:00:06
893000 -- [-415.019] (-417.548) (-412.737) (-412.979) * (-414.570) (-412.790) (-414.623) [-412.852] -- 0:00:06
893500 -- (-413.511) (-413.930) [-417.092] (-413.821) * (-413.500) (-414.239) (-413.831) [-412.482] -- 0:00:06
894000 -- (-412.842) [-415.439] (-419.536) (-415.642) * (-412.259) [-413.920] (-414.364) (-414.119) -- 0:00:06
894500 -- (-412.493) [-415.614] (-414.759) (-415.117) * (-418.440) (-413.058) (-412.293) [-414.105] -- 0:00:06
895000 -- (-416.695) [-415.983] (-414.316) (-415.909) * (-416.616) (-411.862) (-412.098) [-413.777] -- 0:00:06
Average standard deviation of split frequencies: 0.007366
895500 -- (-413.314) (-419.498) [-414.309] (-415.565) * [-419.270] (-413.463) (-412.636) (-416.683) -- 0:00:06
896000 -- [-416.437] (-417.229) (-412.790) (-413.032) * (-414.620) (-415.604) [-416.152] (-414.479) -- 0:00:06
896500 -- [-414.382] (-413.686) (-413.110) (-412.734) * [-413.524] (-416.115) (-412.920) (-414.998) -- 0:00:06
897000 -- (-415.055) (-412.449) (-415.780) [-414.583] * (-416.741) (-417.769) (-412.636) [-414.647] -- 0:00:06
897500 -- (-413.628) (-415.285) [-413.348] (-417.887) * (-414.494) [-413.503] (-417.525) (-416.885) -- 0:00:06
898000 -- (-413.146) [-412.573] (-412.061) (-416.016) * (-412.219) (-414.263) [-412.971] (-416.666) -- 0:00:06
898500 -- [-412.018] (-414.970) (-412.631) (-412.753) * (-416.984) (-417.399) [-415.386] (-412.041) -- 0:00:06
899000 -- (-411.974) (-413.752) [-412.093] (-412.350) * (-415.649) (-413.463) (-413.208) [-412.302] -- 0:00:06
899500 -- (-412.831) (-417.382) [-412.015] (-412.587) * [-413.292] (-415.948) (-414.557) (-415.154) -- 0:00:06
900000 -- (-413.499) (-412.786) [-411.966] (-413.703) * (-414.204) [-412.664] (-416.542) (-414.452) -- 0:00:06
Average standard deviation of split frequencies: 0.007099
900500 -- (-415.589) (-413.686) (-411.649) [-413.361] * (-415.905) (-414.399) (-414.450) [-414.662] -- 0:00:05
901000 -- (-415.620) (-413.301) [-416.365] (-413.516) * (-419.093) (-413.174) [-415.100] (-413.162) -- 0:00:05
901500 -- (-417.986) (-416.143) [-411.863] (-411.646) * (-414.680) (-415.799) (-417.332) [-414.771] -- 0:00:05
902000 -- [-413.071] (-412.035) (-417.142) (-412.155) * (-412.191) (-412.780) (-414.555) [-412.668] -- 0:00:05
902500 -- (-414.519) [-412.131] (-414.157) (-414.473) * (-414.846) (-413.945) (-413.905) [-412.277] -- 0:00:05
903000 -- [-413.746] (-414.423) (-415.408) (-421.184) * (-416.321) (-414.451) (-413.545) [-412.810] -- 0:00:05
903500 -- [-412.857] (-414.696) (-416.829) (-413.160) * (-417.405) (-414.357) [-415.324] (-413.653) -- 0:00:05
904000 -- [-413.265] (-413.960) (-414.499) (-413.091) * [-414.365] (-413.268) (-412.587) (-413.074) -- 0:00:05
904500 -- (-413.768) (-413.194) (-412.345) [-412.725] * (-414.814) (-411.922) (-413.194) [-415.322] -- 0:00:05
905000 -- (-415.321) (-416.508) (-414.386) [-412.491] * (-417.438) (-414.049) [-413.145] (-414.845) -- 0:00:05
Average standard deviation of split frequencies: 0.006732
905500 -- [-414.608] (-413.506) (-416.869) (-414.280) * (-414.776) [-414.293] (-412.305) (-414.599) -- 0:00:05
906000 -- (-414.039) [-413.537] (-413.257) (-412.564) * (-415.589) (-419.483) [-414.458] (-413.375) -- 0:00:05
906500 -- (-415.114) (-413.723) (-412.093) [-412.667] * (-414.818) [-413.046] (-412.303) (-416.278) -- 0:00:05
907000 -- (-424.474) [-411.877] (-412.350) (-415.503) * [-416.183] (-417.241) (-412.059) (-412.952) -- 0:00:05
907500 -- (-414.041) [-412.011] (-415.450) (-413.084) * [-416.654] (-412.367) (-412.122) (-412.714) -- 0:00:05
908000 -- (-413.798) (-413.606) (-420.924) [-413.981] * (-413.706) [-413.571] (-416.715) (-414.003) -- 0:00:05
908500 -- [-413.062] (-413.701) (-415.411) (-413.171) * [-414.096] (-415.733) (-413.205) (-414.019) -- 0:00:05
909000 -- [-414.441] (-413.201) (-416.097) (-414.778) * (-414.066) (-414.696) (-413.262) [-415.210] -- 0:00:05
909500 -- (-412.282) [-413.466] (-418.112) (-412.870) * (-412.429) (-416.507) [-413.774] (-414.950) -- 0:00:05
910000 -- [-412.359] (-413.212) (-416.271) (-417.554) * (-413.596) (-413.593) (-413.186) [-413.592] -- 0:00:05
Average standard deviation of split frequencies: 0.006535
910500 -- (-413.105) (-412.771) [-416.747] (-413.609) * [-414.877] (-414.082) (-414.232) (-415.423) -- 0:00:05
911000 -- (-415.248) (-412.859) [-412.763] (-417.339) * (-412.761) (-414.806) (-416.101) [-414.785] -- 0:00:05
911500 -- (-416.729) [-412.100] (-414.053) (-417.551) * (-413.712) (-413.092) (-412.851) [-414.433] -- 0:00:05
912000 -- [-416.073] (-413.366) (-412.941) (-419.204) * (-416.911) [-413.534] (-415.795) (-414.186) -- 0:00:05
912500 -- (-414.442) (-414.081) (-415.660) [-413.361] * (-413.695) (-413.168) [-412.392] (-413.622) -- 0:00:05
913000 -- (-413.506) (-415.651) [-412.821] (-415.120) * [-413.036] (-413.740) (-412.671) (-416.156) -- 0:00:05
913500 -- [-412.400] (-414.519) (-414.386) (-418.169) * (-412.999) [-413.272] (-413.964) (-415.791) -- 0:00:05
914000 -- (-412.788) [-414.567] (-415.125) (-414.448) * (-412.032) [-412.895] (-414.876) (-413.754) -- 0:00:05
914500 -- (-415.098) [-413.712] (-412.955) (-413.574) * [-413.124] (-413.256) (-412.635) (-420.602) -- 0:00:05
915000 -- (-412.164) (-417.585) [-416.341] (-412.271) * (-412.609) (-413.507) [-415.142] (-419.431) -- 0:00:05
Average standard deviation of split frequencies: 0.006690
915500 -- (-411.872) (-413.481) (-414.853) [-412.340] * (-415.553) (-412.629) (-412.470) [-414.176] -- 0:00:05
916000 -- (-414.681) (-413.382) [-418.698] (-415.562) * (-413.208) (-414.768) (-417.128) [-416.851] -- 0:00:05
916500 -- (-412.312) (-414.170) (-422.276) [-414.285] * (-412.373) (-414.355) [-413.668] (-415.850) -- 0:00:05
917000 -- [-412.936] (-413.873) (-418.071) (-412.222) * (-414.757) (-417.807) [-412.185] (-415.270) -- 0:00:04
917500 -- (-413.347) (-413.484) (-419.230) [-416.135] * (-416.887) (-415.750) (-416.063) [-412.623] -- 0:00:04
918000 -- (-413.338) (-412.519) [-414.953] (-415.090) * (-414.507) (-419.290) (-413.783) [-412.896] -- 0:00:04
918500 -- [-417.022] (-412.285) (-415.498) (-413.657) * (-414.844) [-413.575] (-413.464) (-413.053) -- 0:00:04
919000 -- (-413.153) [-412.832] (-415.181) (-412.465) * (-412.829) (-414.578) [-412.537] (-412.215) -- 0:00:04
919500 -- (-414.022) (-413.831) (-413.583) [-412.631] * (-415.766) (-415.147) [-412.721] (-415.239) -- 0:00:04
920000 -- [-413.627] (-413.911) (-414.393) (-415.980) * (-414.751) [-412.940] (-415.071) (-415.533) -- 0:00:04
Average standard deviation of split frequencies: 0.006827
920500 -- (-414.179) [-414.963] (-415.891) (-414.866) * [-411.893] (-414.937) (-417.417) (-412.600) -- 0:00:04
921000 -- (-412.816) (-412.337) (-413.919) [-415.027] * (-415.412) (-417.699) (-412.237) [-415.322] -- 0:00:04
921500 -- (-413.322) [-412.092] (-413.815) (-414.210) * [-416.925] (-416.914) (-412.238) (-414.988) -- 0:00:04
922000 -- (-412.216) [-412.256] (-414.865) (-414.884) * [-413.025] (-417.989) (-416.602) (-414.572) -- 0:00:04
922500 -- (-414.800) (-414.038) [-412.984] (-416.327) * [-412.728] (-415.507) (-413.804) (-416.355) -- 0:00:04
923000 -- [-413.566] (-413.544) (-413.471) (-413.731) * (-412.046) [-415.375] (-416.235) (-413.280) -- 0:00:04
923500 -- (-411.974) [-413.815] (-413.751) (-412.686) * (-415.144) (-414.870) (-413.519) [-413.242] -- 0:00:04
924000 -- [-414.617] (-412.570) (-414.174) (-416.097) * (-414.740) (-415.130) [-415.067] (-412.631) -- 0:00:04
924500 -- (-414.048) (-412.618) [-413.871] (-414.998) * [-413.235] (-412.787) (-411.773) (-412.534) -- 0:00:04
925000 -- (-414.576) (-412.777) (-412.894) [-412.546] * (-414.253) [-414.224] (-413.639) (-415.173) -- 0:00:04
Average standard deviation of split frequencies: 0.006618
925500 -- (-413.834) (-413.409) (-421.226) [-412.566] * (-413.418) (-413.408) [-413.526] (-413.879) -- 0:00:04
926000 -- (-414.678) [-413.611] (-412.340) (-413.430) * (-414.291) [-412.024] (-414.628) (-413.670) -- 0:00:04
926500 -- [-413.271] (-413.029) (-412.660) (-413.584) * (-417.428) (-414.929) [-418.456] (-413.030) -- 0:00:04
927000 -- (-419.378) (-411.851) (-415.544) [-415.753] * [-415.982] (-417.527) (-412.819) (-414.540) -- 0:00:04
927500 -- [-413.108] (-412.082) (-415.756) (-414.364) * (-417.312) [-413.679] (-414.796) (-412.070) -- 0:00:04
928000 -- (-412.904) (-412.391) (-414.460) [-413.042] * [-415.016] (-412.942) (-412.820) (-411.665) -- 0:00:04
928500 -- [-413.883] (-417.681) (-412.903) (-416.583) * (-412.925) (-412.985) (-413.949) [-413.353] -- 0:00:04
929000 -- [-414.193] (-414.191) (-415.716) (-411.859) * (-411.792) (-414.346) [-414.709] (-413.090) -- 0:00:04
929500 -- (-413.674) (-419.775) (-412.860) [-412.187] * (-412.506) (-412.863) [-415.188] (-415.497) -- 0:00:04
930000 -- [-417.035] (-418.604) (-412.058) (-411.982) * (-415.256) [-412.373] (-414.538) (-415.388) -- 0:00:04
Average standard deviation of split frequencies: 0.006754
930500 -- [-412.836] (-415.748) (-416.163) (-417.973) * (-415.184) [-412.135] (-412.795) (-412.264) -- 0:00:04
931000 -- (-412.879) (-412.566) [-414.433] (-416.145) * (-414.085) (-412.472) (-413.355) [-414.545] -- 0:00:04
931500 -- (-412.716) (-412.573) (-416.959) [-418.096] * (-414.083) [-413.959] (-413.600) (-415.061) -- 0:00:04
932000 -- [-412.586] (-413.292) (-413.263) (-412.540) * [-412.722] (-411.879) (-412.973) (-415.052) -- 0:00:04
932500 -- [-412.099] (-413.601) (-413.371) (-412.994) * [-411.861] (-415.638) (-412.088) (-413.079) -- 0:00:04
933000 -- (-415.716) [-413.551] (-413.704) (-414.614) * (-412.065) [-415.692] (-413.097) (-413.405) -- 0:00:04
933500 -- [-415.335] (-413.901) (-413.290) (-414.228) * (-416.811) (-413.278) (-412.343) [-411.967] -- 0:00:03
934000 -- (-413.098) (-414.248) [-415.631] (-413.655) * (-416.687) [-414.604] (-412.115) (-412.376) -- 0:00:03
934500 -- (-415.306) (-416.487) (-413.389) [-414.245] * (-412.847) (-413.266) [-413.224] (-414.454) -- 0:00:03
935000 -- (-416.142) [-415.848] (-421.272) (-414.171) * (-413.102) (-418.078) (-412.330) [-413.874] -- 0:00:03
Average standard deviation of split frequencies: 0.006581
935500 -- (-413.445) (-415.812) [-418.638] (-414.124) * (-414.549) (-415.450) (-414.479) [-414.460] -- 0:00:03
936000 -- [-413.335] (-414.656) (-416.530) (-416.785) * [-413.417] (-415.151) (-413.225) (-414.972) -- 0:00:03
936500 -- (-414.584) [-413.356] (-413.210) (-418.130) * (-413.130) (-416.300) (-412.627) [-416.951] -- 0:00:03
937000 -- (-413.181) (-413.476) [-413.978] (-413.124) * (-414.185) [-418.982] (-413.595) (-418.706) -- 0:00:03
937500 -- (-415.114) (-412.599) [-414.614] (-412.849) * (-415.394) (-415.072) [-412.416] (-413.249) -- 0:00:03
938000 -- [-414.609] (-413.585) (-413.407) (-414.496) * (-413.800) (-414.688) (-415.346) [-412.305] -- 0:00:03
938500 -- [-414.285] (-412.573) (-413.516) (-416.755) * (-413.529) (-414.634) (-415.192) [-415.916] -- 0:00:03
939000 -- (-415.117) (-412.284) [-412.144] (-412.606) * (-414.267) (-412.595) [-414.114] (-414.138) -- 0:00:03
939500 -- (-416.524) (-413.420) (-412.727) [-411.802] * [-412.177] (-412.922) (-414.634) (-414.367) -- 0:00:03
940000 -- (-414.792) [-414.455] (-413.605) (-412.094) * (-415.427) (-416.949) [-413.169] (-414.202) -- 0:00:03
Average standard deviation of split frequencies: 0.006582
940500 -- (-415.289) [-414.190] (-412.654) (-414.553) * (-412.912) (-412.228) [-412.614] (-413.880) -- 0:00:03
941000 -- (-414.111) (-412.650) [-413.947] (-413.011) * (-414.338) (-411.541) (-414.827) [-417.381] -- 0:00:03
941500 -- (-413.131) (-414.403) [-412.849] (-413.333) * (-417.479) (-412.462) (-419.500) [-416.144] -- 0:00:03
942000 -- (-413.479) (-414.192) (-414.895) [-411.681] * (-412.657) (-412.108) (-417.917) [-417.141] -- 0:00:03
942500 -- [-414.932] (-411.943) (-416.304) (-417.054) * (-415.462) [-411.989] (-412.964) (-417.274) -- 0:00:03
943000 -- (-414.706) [-412.123] (-413.483) (-413.758) * (-411.503) [-414.867] (-415.204) (-413.160) -- 0:00:03
943500 -- (-413.107) [-414.206] (-412.833) (-414.138) * (-416.236) [-412.421] (-415.866) (-412.607) -- 0:00:03
944000 -- (-411.997) (-414.360) [-414.149] (-414.884) * [-412.945] (-412.609) (-413.299) (-414.268) -- 0:00:03
944500 -- [-412.970] (-416.810) (-415.892) (-412.740) * (-413.198) [-412.091] (-413.367) (-413.192) -- 0:00:03
945000 -- (-412.101) [-412.780] (-415.131) (-416.624) * (-413.517) (-413.091) [-411.899] (-416.255) -- 0:00:03
Average standard deviation of split frequencies: 0.006810
945500 -- [-414.175] (-412.363) (-416.365) (-414.993) * (-414.838) (-415.600) [-411.995] (-413.821) -- 0:00:03
946000 -- (-417.719) (-414.197) [-414.215] (-414.511) * [-418.754] (-412.754) (-412.608) (-415.727) -- 0:00:03
946500 -- (-414.025) (-413.211) (-415.744) [-411.822] * (-415.539) (-416.196) [-412.420] (-412.458) -- 0:00:03
947000 -- [-415.732] (-416.186) (-414.419) (-411.781) * [-417.175] (-415.284) (-413.330) (-412.627) -- 0:00:03
947500 -- (-412.672) (-416.646) [-412.385] (-413.912) * (-419.005) (-412.488) [-415.378] (-412.445) -- 0:00:03
948000 -- (-414.734) [-415.880] (-416.859) (-416.023) * [-414.537] (-411.711) (-414.561) (-415.641) -- 0:00:03
948500 -- (-413.099) [-413.447] (-416.083) (-415.623) * [-413.376] (-413.064) (-412.943) (-413.865) -- 0:00:03
949000 -- (-413.340) [-413.062] (-415.313) (-414.489) * (-416.335) (-412.446) (-412.485) [-412.081] -- 0:00:03
949500 -- (-413.899) [-416.012] (-415.127) (-413.700) * (-414.833) [-415.164] (-416.371) (-414.542) -- 0:00:03
950000 -- (-415.590) (-417.507) [-417.972] (-412.661) * [-413.077] (-413.985) (-412.542) (-412.007) -- 0:00:03
Average standard deviation of split frequencies: 0.006579
950500 -- (-416.082) (-415.954) (-414.990) [-415.991] * (-413.079) [-416.079] (-412.897) (-412.738) -- 0:00:02
951000 -- [-413.375] (-416.849) (-414.826) (-416.377) * (-414.823) (-418.268) [-414.171] (-413.828) -- 0:00:02
951500 -- (-412.503) (-415.453) (-416.378) [-414.713] * (-421.872) (-415.476) (-414.839) [-413.045] -- 0:00:02
952000 -- (-412.366) [-413.232] (-412.201) (-412.605) * [-413.279] (-412.097) (-416.405) (-413.675) -- 0:00:02
952500 -- (-411.883) (-416.498) (-414.447) [-414.662] * [-414.682] (-417.579) (-413.058) (-417.260) -- 0:00:02
953000 -- (-412.393) (-412.506) (-415.294) [-412.450] * (-416.015) (-413.589) [-416.999] (-416.696) -- 0:00:02
953500 -- [-412.559] (-415.707) (-413.059) (-413.860) * (-416.555) [-414.037] (-417.779) (-418.776) -- 0:00:02
954000 -- (-412.813) (-416.134) (-414.894) [-415.134] * (-414.037) [-414.719] (-414.053) (-415.611) -- 0:00:02
954500 -- (-414.119) [-415.910] (-415.190) (-414.900) * [-415.417] (-414.240) (-414.504) (-417.507) -- 0:00:02
955000 -- (-417.314) [-414.381] (-415.501) (-413.085) * (-411.956) [-412.846] (-412.659) (-413.056) -- 0:00:02
Average standard deviation of split frequencies: 0.006312
955500 -- (-412.899) (-412.399) (-412.729) [-411.975] * [-411.869] (-418.341) (-412.854) (-415.995) -- 0:00:02
956000 -- (-413.612) (-411.786) (-416.569) [-412.811] * [-412.418] (-414.092) (-412.715) (-416.664) -- 0:00:02
956500 -- (-413.461) (-412.430) (-415.524) [-416.262] * (-412.203) (-413.216) (-413.990) [-416.522] -- 0:00:02
957000 -- (-414.431) (-414.084) (-413.776) [-416.132] * (-412.074) (-417.047) (-413.454) [-416.330] -- 0:00:02
957500 -- (-412.831) (-415.033) [-415.824] (-412.465) * (-412.242) [-412.861] (-412.720) (-419.228) -- 0:00:02
958000 -- (-413.608) (-415.474) [-413.155] (-413.922) * (-414.654) (-416.958) (-414.410) [-414.972] -- 0:00:02
958500 -- (-414.058) [-413.649] (-412.429) (-413.782) * (-413.828) (-414.274) [-412.542] (-413.679) -- 0:00:02
959000 -- (-414.745) (-413.201) [-412.519] (-415.466) * (-411.725) (-415.434) [-413.336] (-416.029) -- 0:00:02
959500 -- [-413.017] (-413.878) (-415.369) (-411.626) * [-412.796] (-413.054) (-414.367) (-414.753) -- 0:00:02
960000 -- (-414.700) (-412.426) (-418.918) [-415.191] * (-412.284) [-415.283] (-412.573) (-413.179) -- 0:00:02
Average standard deviation of split frequencies: 0.006117
960500 -- (-416.533) [-413.847] (-413.892) (-414.264) * (-411.574) (-412.777) (-413.295) [-413.299] -- 0:00:02
961000 -- (-415.117) (-412.170) [-414.926] (-413.566) * (-412.475) (-413.755) (-412.944) [-413.947] -- 0:00:02
961500 -- [-414.124] (-421.335) (-419.482) (-416.666) * [-415.775] (-412.522) (-414.582) (-412.639) -- 0:00:02
962000 -- (-412.720) (-412.809) [-414.757] (-418.082) * (-413.261) (-414.692) (-413.618) [-414.157] -- 0:00:02
962500 -- (-414.528) [-412.347] (-417.465) (-413.268) * (-414.308) (-411.956) (-414.294) [-413.152] -- 0:00:02
963000 -- (-414.658) (-413.322) [-413.282] (-415.565) * (-415.978) [-413.992] (-415.474) (-412.734) -- 0:00:02
963500 -- (-417.103) [-413.569] (-413.141) (-416.099) * (-420.339) [-416.379] (-414.409) (-413.524) -- 0:00:02
964000 -- [-414.242] (-412.331) (-413.739) (-413.448) * (-413.989) (-413.844) [-413.530] (-417.903) -- 0:00:02
964500 -- [-412.134] (-412.152) (-412.877) (-414.314) * [-416.236] (-412.322) (-412.903) (-419.955) -- 0:00:02
965000 -- (-413.088) (-413.966) [-414.296] (-412.841) * (-417.031) (-412.406) [-414.138] (-413.373) -- 0:00:02
Average standard deviation of split frequencies: 0.005764
965500 -- [-413.464] (-414.488) (-414.182) (-414.548) * (-416.284) (-417.546) [-411.803] (-419.227) -- 0:00:02
966000 -- (-413.176) (-411.989) [-414.430] (-417.487) * [-413.515] (-413.648) (-415.685) (-417.057) -- 0:00:02
966500 -- (-414.870) (-415.647) [-415.328] (-412.301) * (-414.555) [-414.736] (-416.140) (-418.219) -- 0:00:02
967000 -- (-416.259) (-415.621) (-412.580) [-413.637] * (-412.711) (-413.225) (-417.298) [-418.395] -- 0:00:01
967500 -- [-413.705] (-415.618) (-413.088) (-414.420) * [-412.522] (-412.025) (-414.511) (-414.209) -- 0:00:01
968000 -- [-416.462] (-413.011) (-412.829) (-413.577) * [-411.960] (-412.748) (-415.363) (-416.380) -- 0:00:01
968500 -- (-413.509) (-413.355) [-414.727] (-411.866) * (-411.842) (-411.862) [-415.193] (-414.631) -- 0:00:01
969000 -- (-412.919) (-412.425) (-415.259) [-414.341] * (-416.637) (-411.820) (-418.945) [-412.167] -- 0:00:01
969500 -- (-415.503) [-412.252] (-413.829) (-412.555) * (-413.068) [-411.816] (-417.866) (-413.449) -- 0:00:01
970000 -- (-419.267) (-412.646) (-413.287) [-413.411] * (-411.938) (-418.187) (-412.561) [-413.189] -- 0:00:01
Average standard deviation of split frequencies: 0.005860
970500 -- (-416.380) (-416.110) [-415.351] (-413.285) * (-413.054) (-416.311) [-412.476] (-413.400) -- 0:00:01
971000 -- (-416.109) [-416.510] (-415.457) (-412.722) * (-412.480) (-413.833) (-412.764) [-414.966] -- 0:00:01
971500 -- [-415.344] (-417.288) (-413.755) (-413.753) * [-414.431] (-411.619) (-416.049) (-413.456) -- 0:00:01
972000 -- (-413.808) [-417.644] (-412.149) (-416.807) * (-415.509) (-412.869) (-414.824) [-412.849] -- 0:00:01
972500 -- (-414.725) [-414.731] (-413.194) (-414.260) * (-412.784) (-413.019) [-414.412] (-411.943) -- 0:00:01
973000 -- (-413.686) (-416.624) [-417.224] (-417.005) * (-415.378) [-412.723] (-413.989) (-415.893) -- 0:00:01
973500 -- (-412.483) (-414.630) (-413.055) [-412.123] * (-412.297) [-412.960] (-415.708) (-414.885) -- 0:00:01
974000 -- (-414.156) (-412.285) (-412.489) [-412.095] * (-412.298) [-414.020] (-419.410) (-413.218) -- 0:00:01
974500 -- [-412.694] (-412.203) (-412.331) (-412.168) * (-412.871) (-413.122) (-417.970) [-412.227] -- 0:00:01
975000 -- (-413.958) [-412.904] (-413.537) (-413.221) * (-414.544) [-413.139] (-414.959) (-412.411) -- 0:00:01
Average standard deviation of split frequencies: 0.006247
975500 -- (-415.780) (-415.160) [-414.942] (-413.159) * (-415.477) [-412.477] (-412.908) (-412.291) -- 0:00:01
976000 -- [-413.027] (-416.109) (-413.020) (-412.539) * [-413.411] (-411.915) (-416.255) (-417.770) -- 0:00:01
976500 -- (-413.335) (-416.218) (-413.543) [-412.248] * (-412.882) (-412.415) (-413.791) [-414.771] -- 0:00:01
977000 -- [-413.558] (-420.981) (-414.238) (-415.024) * (-412.969) (-417.357) (-415.756) [-413.494] -- 0:00:01
977500 -- [-415.533] (-415.082) (-413.483) (-412.617) * [-415.597] (-413.701) (-415.583) (-414.354) -- 0:00:01
978000 -- (-413.258) (-416.232) [-414.026] (-415.177) * (-414.463) (-414.897) [-412.938] (-412.820) -- 0:00:01
978500 -- [-413.821] (-416.769) (-412.960) (-414.071) * (-414.157) (-416.768) (-413.639) [-412.084] -- 0:00:01
979000 -- (-413.547) [-414.829] (-413.558) (-415.824) * (-414.850) (-415.776) [-412.646] (-412.771) -- 0:00:01
979500 -- [-415.751] (-413.981) (-415.400) (-413.892) * [-412.671] (-415.627) (-412.830) (-413.668) -- 0:00:01
980000 -- [-413.095] (-413.847) (-413.166) (-413.816) * [-415.695] (-413.128) (-414.529) (-413.931) -- 0:00:01
Average standard deviation of split frequencies: 0.006281
980500 -- [-413.846] (-424.983) (-412.919) (-415.351) * [-412.663] (-414.649) (-412.321) (-413.105) -- 0:00:01
981000 -- [-414.107] (-424.528) (-417.727) (-415.963) * [-416.497] (-414.327) (-413.948) (-413.345) -- 0:00:01
981500 -- (-413.655) (-415.681) (-415.636) [-415.066] * (-412.372) (-414.560) [-413.014] (-413.347) -- 0:00:01
982000 -- (-413.924) (-418.515) (-414.032) [-411.588] * (-411.633) [-416.309] (-413.817) (-413.916) -- 0:00:01
982500 -- (-416.401) (-417.959) (-415.888) [-411.870] * (-412.078) (-415.296) [-414.603] (-412.617) -- 0:00:01
983000 -- (-417.360) (-419.266) (-414.823) [-413.692] * (-415.316) [-413.334] (-415.840) (-412.279) -- 0:00:01
983500 -- (-415.184) [-418.074] (-413.764) (-414.482) * (-414.114) (-415.918) [-414.567] (-415.803) -- 0:00:00
984000 -- [-413.401] (-412.526) (-413.605) (-416.725) * (-413.590) [-412.308] (-411.943) (-414.661) -- 0:00:00
984500 -- (-416.547) (-419.708) (-412.810) [-416.143] * (-415.187) (-413.599) (-414.154) [-416.170] -- 0:00:00
985000 -- (-416.164) (-413.383) [-413.870] (-414.512) * (-417.563) (-412.820) [-415.402] (-414.145) -- 0:00:00
Average standard deviation of split frequencies: 0.006693
985500 -- [-415.384] (-413.770) (-419.386) (-419.320) * (-413.083) [-412.693] (-413.236) (-414.895) -- 0:00:00
986000 -- (-414.578) (-414.091) [-415.151] (-413.782) * (-412.900) (-413.405) [-411.906] (-413.615) -- 0:00:00
986500 -- (-412.703) (-418.199) [-413.829] (-412.302) * (-416.510) (-417.311) (-414.192) [-411.992] -- 0:00:00
987000 -- (-415.690) [-416.954] (-414.806) (-413.239) * [-413.523] (-414.660) (-414.042) (-413.849) -- 0:00:00
987500 -- (-412.134) [-416.225] (-414.894) (-412.746) * (-413.939) (-412.720) (-415.869) [-413.823] -- 0:00:00
988000 -- (-414.900) (-417.819) (-416.340) [-412.316] * (-414.186) (-412.100) [-412.324] (-413.434) -- 0:00:00
988500 -- (-414.391) [-414.255] (-414.467) (-412.508) * (-411.840) [-412.022] (-412.305) (-415.389) -- 0:00:00
989000 -- (-414.619) (-413.736) [-414.654] (-413.336) * (-412.678) (-414.199) [-412.939] (-415.540) -- 0:00:00
989500 -- (-414.084) (-416.220) [-417.314] (-413.593) * (-414.570) [-418.113] (-412.363) (-413.212) -- 0:00:00
990000 -- [-415.292] (-414.205) (-414.770) (-411.948) * (-412.512) [-411.784] (-415.140) (-415.309) -- 0:00:00
Average standard deviation of split frequencies: 0.006535
990500 -- (-412.636) (-413.744) (-418.582) [-413.402] * (-415.639) [-413.031] (-414.448) (-412.079) -- 0:00:00
991000 -- (-415.093) [-412.090] (-416.436) (-412.621) * (-415.418) [-414.683] (-413.424) (-415.757) -- 0:00:00
991500 -- (-413.607) (-412.533) (-416.459) [-415.431] * (-414.115) [-415.613] (-415.688) (-413.444) -- 0:00:00
992000 -- [-412.379] (-417.435) (-415.919) (-418.670) * [-414.020] (-415.985) (-415.084) (-419.725) -- 0:00:00
992500 -- (-413.100) [-414.534] (-418.926) (-414.174) * (-414.917) (-414.168) (-420.240) [-418.193] -- 0:00:00
993000 -- (-412.765) (-416.890) [-416.276] (-415.384) * [-414.245] (-414.418) (-412.412) (-417.250) -- 0:00:00
993500 -- (-415.398) [-413.365] (-416.783) (-413.619) * (-413.664) [-412.899] (-414.551) (-414.782) -- 0:00:00
994000 -- [-412.646] (-412.489) (-412.570) (-415.866) * (-414.905) (-412.958) (-414.277) [-414.997] -- 0:00:00
994500 -- [-411.955] (-412.485) (-416.577) (-413.097) * [-414.649] (-412.440) (-413.279) (-413.582) -- 0:00:00
995000 -- [-415.307] (-412.980) (-414.151) (-413.063) * (-411.681) (-413.136) (-413.622) [-412.767] -- 0:00:00
Average standard deviation of split frequencies: 0.006090
995500 -- (-412.118) (-412.825) (-414.405) [-414.017] * (-411.890) (-413.111) (-413.499) [-412.758] -- 0:00:00
996000 -- [-413.611] (-413.245) (-412.959) (-413.906) * (-416.141) (-415.010) (-417.307) [-415.752] -- 0:00:00
996500 -- (-417.153) (-415.369) (-414.825) [-412.069] * [-412.206] (-417.856) (-414.528) (-416.883) -- 0:00:00
997000 -- (-413.109) (-412.003) (-414.786) [-412.546] * [-414.331] (-416.134) (-417.049) (-417.820) -- 0:00:00
997500 -- (-413.437) (-412.323) (-412.270) [-413.228] * (-412.372) (-414.442) [-413.952] (-415.886) -- 0:00:00
998000 -- (-413.655) (-412.091) [-413.457] (-414.505) * (-413.061) [-415.163] (-415.440) (-413.213) -- 0:00:00
998500 -- [-416.893] (-412.171) (-414.431) (-417.372) * (-412.064) (-413.023) (-412.357) [-417.511] -- 0:00:00
999000 -- [-412.611] (-414.619) (-413.311) (-414.020) * (-415.326) (-415.302) (-416.531) [-412.157] -- 0:00:00
999500 -- (-412.419) [-412.849] (-411.833) (-412.706) * (-412.471) [-415.274] (-412.772) (-412.372) -- 0:00:00
1000000 -- (-412.806) [-412.981] (-412.185) (-415.631) * [-412.551] (-420.179) (-413.350) (-413.478) -- 0:00:00
Average standard deviation of split frequencies: 0.005999
Analysis completed in 60 seconds
Analysis used 58.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -411.47
Likelihood of best state for "cold" chain of run 2 was -411.47
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
38.8 % ( 29 %) Dirichlet(Pi{all})
37.2 % ( 28 %) Slider(Pi{all})
78.4 % ( 52 %) Multiplier(Alpha{1,2})
77.5 % ( 54 %) Multiplier(Alpha{3})
26.0 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.2 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 72 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
38.6 % ( 29 %) Dirichlet(Pi{all})
37.9 % ( 26 %) Slider(Pi{all})
78.7 % ( 48 %) Multiplier(Alpha{1,2})
78.0 % ( 52 %) Multiplier(Alpha{3})
25.7 % ( 24 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166795 0.82 0.67
3 | 166420 166844 0.84
4 | 166787 166767 166387
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167497 0.82 0.67
3 | 166365 166624 0.84
4 | 166168 166991 166355
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -413.34
| 1 1 2 1 |
| 1 2 2 |
| 1 1 2 |
| 22 1 21 2 22 *2 22 2 2 1 |
| 1 21 1 * * 111 2 111 22 |
| 1 2 2 2 1 22 1 * 2 1 1 1|
| 21 2 1 2 2 1 1 2 |
| 2 11 1 22 22 1 |
| 2 1 * 12 2 1 21 2|
|2 2 1 2 1 2 2 1 * 1 1 2 2 1 |
| 21 2 2 1 1 21 1 |
| 1 1 2 1 1 |
| 1 2 |
| |
|1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -414.83
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.21 -416.45
2 -413.24 -415.86
--------------------------------------
TOTAL -413.22 -416.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893329 0.092390 0.373330 1.508401 0.853901 1501.00 1501.00 1.001
r(A<->C){all} 0.157645 0.018346 0.000020 0.419746 0.121443 248.86 249.69 1.000
r(A<->G){all} 0.166438 0.020294 0.000054 0.445765 0.126959 190.40 246.87 1.000
r(A<->T){all} 0.173924 0.022501 0.000062 0.480428 0.132708 287.87 340.82 1.002
r(C<->G){all} 0.178388 0.021412 0.000017 0.464581 0.140650 227.20 271.12 1.001
r(C<->T){all} 0.172109 0.020614 0.000025 0.453904 0.134419 236.89 239.60 1.000
r(G<->T){all} 0.151496 0.016751 0.000007 0.413324 0.118181 287.31 374.16 1.003
pi(A){all} 0.275413 0.000636 0.226469 0.322940 0.274362 1278.85 1323.24 1.000
pi(C){all} 0.372611 0.000745 0.319916 0.428017 0.372241 1119.29 1310.15 1.000
pi(G){all} 0.189316 0.000489 0.148805 0.234216 0.188992 1174.50 1279.09 1.000
pi(T){all} 0.162660 0.000429 0.122092 0.203119 0.162025 1399.49 1409.84 1.000
alpha{1,2} 0.403707 0.217961 0.000245 1.323610 0.247985 1252.69 1287.69 1.001
alpha{3} 0.457759 0.237279 0.000107 1.434738 0.292657 990.61 1069.44 1.000
pinvar{all} 0.994572 0.000043 0.982670 0.999997 0.996645 1258.49 1379.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- ..*.*.
9 -- .*...*
10 -- .****.
11 -- .*..*.
12 -- .***.*
13 -- ...*.*
14 -- ..**..
15 -- ..****
16 -- .**...
17 -- ..*..*
18 -- ....**
19 -- .*.***
20 -- ...**.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 480 0.159893 0.009422 0.153231 0.166556 2
8 452 0.150566 0.011306 0.142572 0.158561 2
9 445 0.148235 0.005182 0.144570 0.151899 2
10 434 0.144570 0.008480 0.138574 0.150566 2
11 431 0.143571 0.003298 0.141239 0.145903 2
12 431 0.143571 0.002355 0.141905 0.145237 2
13 427 0.142239 0.008009 0.136576 0.147901 2
14 427 0.142239 0.000471 0.141905 0.142572 2
15 425 0.141572 0.002355 0.139907 0.143238 2
16 423 0.140906 0.015546 0.129913 0.151899 2
17 410 0.136576 0.000000 0.136576 0.136576 2
18 410 0.136576 0.000000 0.136576 0.136576 2
19 408 0.135909 0.000942 0.135243 0.136576 2
20 404 0.134577 0.017901 0.121919 0.147235 2
21 400 0.133245 0.004711 0.129913 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098910 0.010189 0.000003 0.294246 0.068858 1.000 2
length{all}[2] 0.099033 0.010256 0.000037 0.299242 0.066648 1.000 2
length{all}[3] 0.099693 0.010649 0.000118 0.299579 0.066896 1.002 2
length{all}[4] 0.098642 0.010000 0.000073 0.299182 0.068820 1.000 2
length{all}[5] 0.099876 0.009828 0.000094 0.298871 0.069180 1.000 2
length{all}[6] 0.099877 0.009407 0.000003 0.288533 0.069394 1.000 2
length{all}[7] 0.102369 0.010274 0.000025 0.277277 0.070795 1.000 2
length{all}[8] 0.095902 0.010840 0.000379 0.291307 0.063632 1.001 2
length{all}[9] 0.102977 0.010524 0.000102 0.294798 0.072078 0.998 2
length{all}[10] 0.085626 0.007004 0.000192 0.269252 0.063220 1.000 2
length{all}[11] 0.095572 0.008239 0.000039 0.251603 0.067871 0.998 2
length{all}[12] 0.098681 0.009517 0.000046 0.286331 0.068631 1.004 2
length{all}[13] 0.102948 0.008924 0.000257 0.306834 0.073686 0.998 2
length{all}[14] 0.096178 0.008012 0.000033 0.279621 0.071370 0.999 2
length{all}[15] 0.090223 0.008636 0.000221 0.281685 0.058294 0.998 2
length{all}[16] 0.095863 0.009975 0.000004 0.295810 0.065616 0.998 2
length{all}[17] 0.105717 0.012520 0.000042 0.327900 0.068917 0.999 2
length{all}[18] 0.104494 0.010685 0.000401 0.293212 0.078611 0.998 2
length{all}[19] 0.100944 0.011076 0.000352 0.328268 0.068857 1.000 2
length{all}[20] 0.099074 0.010583 0.000409 0.311353 0.069164 1.001 2
length{all}[21] 0.103066 0.010435 0.000045 0.304241 0.073560 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005999
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 309
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 103 / 103 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 103 / 103 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.036508 0.083251 0.097566 0.071909 0.026663 0.072686 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -432.303661
Iterating by ming2
Initial: fx= 432.303661
x= 0.03651 0.08325 0.09757 0.07191 0.02666 0.07269 0.30000 1.30000
1 h-m-p 0.0000 0.0003 247.3518 +++ 416.243155 m 0.0003 14 | 1/8
2 h-m-p 0.0047 0.0422 12.5779 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 226.7766 ++ 411.255840 m 0.0001 46 | 2/8
4 h-m-p 0.0020 0.0941 9.9988 ------------.. | 2/8
5 h-m-p 0.0000 0.0004 202.8717 +++ 396.744917 m 0.0004 79 | 3/8
6 h-m-p 0.0073 0.3551 8.4408 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 176.9892 ++ 396.503582 m 0.0000 112 | 4/8
8 h-m-p 0.0008 0.4106 7.4443 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 144.3413 ++ 394.311620 m 0.0001 143 | 5/8
10 h-m-p 0.0021 0.6175 5.1636 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 102.1437 ++ 392.818840 m 0.0001 175 | 6/8
12 h-m-p 0.2657 8.0000 0.0000 +++ 392.818840 m 8.0000 187 | 6/8
13 h-m-p 1.3330 8.0000 0.0000 ++ 392.818840 m 8.0000 200 | 6/8
14 h-m-p 0.0160 8.0000 0.0446 +++++ 392.818839 m 8.0000 216 | 6/8
15 h-m-p 0.2933 1.4666 0.5449 ---------C 392.818839 0 0.0000 238 | 6/8
16 h-m-p 0.0160 8.0000 0.0007 +++++ 392.818839 m 8.0000 254 | 6/8
17 h-m-p 0.0073 1.0260 0.7845 ---------N 392.818839 0 0.0000 276 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 392.818839 m 8.0000 316 | 6/8
20 h-m-p 0.0160 8.0000 0.0919 +++++ 392.818834 m 8.0000 332 | 6/8
21 h-m-p 1.0214 5.3508 0.7194 C 392.818832 0 1.1673 345 | 6/8
22 h-m-p 1.6000 8.0000 0.1577 Y 392.818832 0 1.0009 358 | 6/8
23 h-m-p 1.6000 8.0000 0.0046 Y 392.818832 0 1.1291 371 | 6/8
24 h-m-p 1.6000 8.0000 0.0003 ++ 392.818832 m 8.0000 384 | 6/8
25 h-m-p 0.1384 8.0000 0.0161 ++C 392.818832 0 2.8738 399 | 6/8
26 h-m-p 1.6000 8.0000 0.0016 ++ 392.818832 m 8.0000 412 | 6/8
27 h-m-p 0.0059 1.0703 2.1330 --------C 392.818832 0 0.0000 433 | 6/8
28 h-m-p 0.0160 8.0000 0.7375 +++Y 392.818831 0 1.6581 447 | 6/8
29 h-m-p 1.6000 8.0000 0.0815 Y 392.818831 0 1.2260 460 | 6/8
30 h-m-p 1.6000 8.0000 0.0019 ++ 392.818831 m 8.0000 473 | 6/8
31 h-m-p 1.6000 8.0000 0.0018 ++ 392.818831 m 8.0000 486 | 6/8
32 h-m-p 0.1630 8.0000 0.0895 ++C 392.818831 0 2.6086 501 | 6/8
33 h-m-p 1.6000 8.0000 0.0104 ++ 392.818831 m 8.0000 514 | 6/8
34 h-m-p 0.0085 0.3700 9.7300 --------Y 392.818831 0 0.0000 535 | 6/8
35 h-m-p 0.0160 8.0000 0.6378 +++++ 392.818814 m 8.0000 549 | 6/8
36 h-m-p 1.6000 8.0000 0.9806 ++ 392.818807 m 8.0000 562 | 6/8
37 h-m-p 1.4679 8.0000 5.3443 ++ 392.818798 m 8.0000 575 | 6/8
38 h-m-p 1.6000 8.0000 7.6384 ++ 392.818795 m 8.0000 586 | 6/8
39 h-m-p 1.6000 8.0000 4.1305 ++ 392.818795 m 8.0000 597 | 6/8
40 h-m-p 0.6946 3.4729 43.4586 ---------C 392.818795 0 0.0000 617 | 6/8
41 h-m-p 1.6000 8.0000 0.0000 C 392.818795 0 0.4000 628 | 6/8
42 h-m-p 0.5135 8.0000 0.0000 Y 392.818795 0 0.5135 641 | 6/8
43 h-m-p 0.0160 8.0000 0.0006 -------------.. | 6/8
44 h-m-p 0.0160 8.0000 0.0000 -------C 392.818795 0 0.0000 685
Out..
lnL = -392.818795
686 lfun, 686 eigenQcodon, 4116 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054240 0.104790 0.093443 0.052049 0.019145 0.029832 86.476476 0.696207 0.371581
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.267676
np = 9
lnL0 = -427.402483
Iterating by ming2
Initial: fx= 427.402483
x= 0.05424 0.10479 0.09344 0.05205 0.01914 0.02983 86.47648 0.69621 0.37158
1 h-m-p 0.0000 0.0002 231.5120 +++ 416.664643 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0008 96.5760 ++ 410.789910 m 0.0008 27 | 2/9
3 h-m-p 0.0000 0.0001 914.0865 ++ 402.353483 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 438.3281 ++ 401.486773 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 28074.5109 ++ 395.556784 m 0.0000 63 | 5/9
6 h-m-p 0.0263 0.8559 1.7677 -------------.. | 5/9
7 h-m-p 0.0000 0.0001 141.1871 ++ 393.679219 m 0.0001 98 | 6/9
8 h-m-p 0.0145 1.3504 0.6393 -------------.. | 6/9
9 h-m-p 0.0000 0.0001 101.6330 ++ 392.818854 m 0.0001 136 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 392.818854 m 8.0000 148 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 392.818854 m 8.0000 165 | 6/9
12 h-m-p 0.0099 4.9489 0.1913 +++++ 392.818824 m 4.9489 183 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 C 392.818824 0 0.4000 198 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 Y 392.818824 0 0.4000 212
Out..
lnL = -392.818824
213 lfun, 639 eigenQcodon, 2556 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081270 0.037847 0.068442 0.010273 0.054818 0.078424 86.467947 1.580671 0.189774 0.184139 137.669795
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.011379
np = 11
lnL0 = -405.517816
Iterating by ming2
Initial: fx= 405.517816
x= 0.08127 0.03785 0.06844 0.01027 0.05482 0.07842 86.46795 1.58067 0.18977 0.18414 137.66980
1 h-m-p 0.0000 0.0006 36.3182 +++ 404.617063 m 0.0006 17 | 1/11
2 h-m-p 0.0021 0.0632 9.5605 +++ 399.497374 m 0.0632 32 | 2/11
3 h-m-p 0.0000 0.0000 14304.3760 ++ 399.265698 m 0.0000 46 | 3/11
4 h-m-p 0.0000 0.0000 10107.1758 ++ 398.834818 m 0.0000 60 | 4/11
5 h-m-p 0.0001 0.0004 341.2407 ++ 398.187564 m 0.0004 74 | 5/11
6 h-m-p 0.0003 0.0013 200.4801 ++ 396.971641 m 0.0013 88 | 6/11
7 h-m-p 0.4738 8.0000 0.5264 +YCCC 395.485993 3 4.0137 108 | 6/11
8 h-m-p 0.0817 0.4087 3.1319 ++ 392.818809 m 0.4087 127 | 7/11
9 h-m-p 1.6000 8.0000 0.0003 ++ 392.818809 m 8.0000 141 | 7/11
10 h-m-p 0.0160 8.0000 11.6814 ------------Y 392.818809 0 0.0000 171 | 7/11
11 h-m-p 0.0160 8.0000 0.0004 +++++ 392.818809 m 8.0000 188 | 7/11
12 h-m-p 0.0160 8.0000 3.1505 +++C 392.818805 0 1.2795 209 | 7/11
13 h-m-p 1.6000 8.0000 1.2006 Y 392.818805 0 0.2107 223 | 7/11
14 h-m-p 1.6000 8.0000 0.0047 -----C 392.818805 0 0.0004 242 | 7/11
15 h-m-p 1.0623 8.0000 0.0000 -------------N 392.818805 0 0.0000 273
Out..
lnL = -392.818805
274 lfun, 1096 eigenQcodon, 4932 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -392.818475 S = -392.816647 -0.000698
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:03
did 20 / 40 patterns 0:03
did 30 / 40 patterns 0:03
did 40 / 40 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058832 0.057924 0.102195 0.104230 0.057922 0.105325 86.427046 1.099556 1.460784
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.317617
np = 9
lnL0 = -439.621615
Iterating by ming2
Initial: fx= 439.621615
x= 0.05883 0.05792 0.10219 0.10423 0.05792 0.10532 86.42705 1.09956 1.46078
1 h-m-p 0.0000 0.0006 221.5592 +++ 407.225015 m 0.0006 15 | 1/9
2 h-m-p 0.0091 0.0789 13.9577 -------------.. | 1/9
3 h-m-p 0.0000 0.0000 220.5234 ++ 407.223585 m 0.0000 50 | 2/9
4 h-m-p 0.0004 0.2115 5.5268 -----------.. | 2/9
5 h-m-p 0.0000 0.0000 196.3265 ++ 406.862326 m 0.0000 83 | 3/9
6 h-m-p 0.0005 0.2268 5.0211 -----------.. | 3/9
7 h-m-p 0.0000 0.0005 168.9264 +++ 393.384592 m 0.0005 117 | 4/9
8 h-m-p 0.0295 0.7243 2.1507 --------------.. | 4/9
9 h-m-p 0.0000 0.0000 145.0148 ++ 392.939078 m 0.0000 153 | 5/9
10 h-m-p 0.0027 1.3742 1.9534 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 102.7193 ++ 392.818848 m 0.0000 187 | 6/9
12 h-m-p 0.0837 8.0000 0.0000 --N 392.818848 0 0.0013 201 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 ---C 392.818848 0 0.0001 219
Out..
lnL = -392.818848
220 lfun, 2420 eigenQcodon, 13200 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099216 0.084649 0.065247 0.084752 0.076958 0.108163 86.427046 0.900000 0.518935 1.522278 125.731255
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.017452
np = 11
lnL0 = -404.712233
Iterating by ming2
Initial: fx= 404.712233
x= 0.09922 0.08465 0.06525 0.08475 0.07696 0.10816 86.42705 0.90000 0.51894 1.52228 125.73126
1 h-m-p 0.0000 0.0015 68.0883 +++YYCYCYCCC 401.684656 8 0.0009 32 | 0/11
2 h-m-p 0.0010 0.0051 28.3177 ++ 397.078950 m 0.0051 46 | 1/11
3 h-m-p 0.0115 0.0577 4.6620 ++ 396.282241 m 0.0577 60 | 2/11
4 h-m-p 0.0003 0.0013 11.8000 ++ 395.979423 m 0.0013 74 | 3/11
5 h-m-p 0.0001 0.0025 102.5457 +++ 394.778916 m 0.0025 89 | 4/11
6 h-m-p 0.0017 0.0084 7.2996 ++ 394.329720 m 0.0084 103 | 5/11
7 h-m-p 0.0003 0.0016 65.1428 ++ 393.059963 m 0.0016 117 | 6/11
8 h-m-p 0.0001 0.0008 1988.6305 ---------.. | 6/11
9 h-m-p 0.0000 0.0000 82.9885 ++ 392.818806 m 0.0000 152 | 7/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 392.818806 m 8.0000 166
Out..
lnL = -392.818806
167 lfun, 2004 eigenQcodon, 11022 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -392.819301 S = -392.816674 -0.001150
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:10
did 20 / 40 patterns 0:10
did 30 / 40 patterns 0:10
did 40 / 40 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
NC_011896_1_WP_010907474_1_22_MLBR_RS15410 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
NC_002677_1_NP_301149_1_21_ML0023 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
**************************************************
NC_011896_1_WP_010907474_1_22_MLBR_RS15410 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
NC_002677_1_NP_301149_1_21_ML0023 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
**************************************************
NC_011896_1_WP_010907474_1_22_MLBR_RS15410 RGT
NC_002677_1_NP_301149_1_21_ML0023 RGT
NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980 RGT
NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305 RGT
NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125 RGT
NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125 RGT
***
>NC_011896_1_WP_010907474_1_22_MLBR_RS15410 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT >NC_002677_1_NP_301149_1_21_ML0023 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT >NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT >NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT >NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT >NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA AGGGGGACT
>NC_011896_1_WP_010907474_1_22_MLBR_RS15410 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT >NC_002677_1_NP_301149_1_21_ML0023 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT >NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT >NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT >NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT >NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR RGT
#NEXUS
[ID: 0247188275]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907474_1_22_MLBR_RS15410
NC_002677_1_NP_301149_1_21_ML0023
NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980
NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305
NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125
NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907474_1_22_MLBR_RS15410,
2 NC_002677_1_NP_301149_1_21_ML0023,
3 NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980,
4 NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305,
5 NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125,
6 NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06885756,2:0.06664847,3:0.06689576,4:0.06882025,5:0.06917951,6:0.06939363);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06885756,2:0.06664847,3:0.06689576,4:0.06882025,5:0.06917951,6:0.06939363);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.21 -416.45
2 -413.24 -415.86
--------------------------------------
TOTAL -413.22 -416.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893329 0.092390 0.373330 1.508401 0.853901 1501.00 1501.00 1.001
r(A<->C){all} 0.157645 0.018346 0.000020 0.419746 0.121443 248.86 249.69 1.000
r(A<->G){all} 0.166438 0.020294 0.000054 0.445765 0.126959 190.40 246.87 1.000
r(A<->T){all} 0.173924 0.022501 0.000062 0.480428 0.132708 287.87 340.82 1.002
r(C<->G){all} 0.178388 0.021412 0.000017 0.464581 0.140650 227.20 271.12 1.001
r(C<->T){all} 0.172109 0.020614 0.000025 0.453904 0.134419 236.89 239.60 1.000
r(G<->T){all} 0.151496 0.016751 0.000007 0.413324 0.118181 287.31 374.16 1.003
pi(A){all} 0.275413 0.000636 0.226469 0.322940 0.274362 1278.85 1323.24 1.000
pi(C){all} 0.372611 0.000745 0.319916 0.428017 0.372241 1119.29 1310.15 1.000
pi(G){all} 0.189316 0.000489 0.148805 0.234216 0.188992 1174.50 1279.09 1.000
pi(T){all} 0.162660 0.000429 0.122092 0.203119 0.162025 1399.49 1409.84 1.000
alpha{1,2} 0.403707 0.217961 0.000245 1.323610 0.247985 1252.69 1287.69 1.001
alpha{3} 0.457759 0.237279 0.000107 1.434738 0.292657 990.61 1069.44 1.000
pinvar{all} 0.994572 0.000043 0.982670 0.999997 0.996645 1258.49 1379.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0023/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 103
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 4 4 4 4 4 4 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 2 2 2 | CCC 4 4 4 4 4 4 | CAC 9 9 9 9 9 9 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2
CTG 1 1 1 1 1 1 | CCG 3 3 3 3 3 3 | CAG 1 1 1 1 1 1 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 8 8 8 8 8 8 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 0 0 0 0 0 0 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 0 0 0 0 0 0 | Asp GAT 0 0 0 0 0 0 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 3 3 3 | GCC 1 1 1 1 1 1 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 2 2 2 2 2 2 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 0 0 0 0 0 0 | GCG 0 0 0 0 0 0 | GAG 1 1 1 1 1 1 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907474_1_22_MLBR_RS15410
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
#2: NC_002677_1_NP_301149_1_21_ML0023
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
#3: NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
#4: NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
#5: NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
#6: NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 6
TTC 24 | TCC 0 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 24 | Arg R CGT 0
CTC 12 | CCC 24 | CAC 54 | CGC 12
CTA 12 | CCA 0 | Gln Q CAA 24 | CGA 12
CTG 6 | CCG 18 | CAG 6 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 6
ATC 42 | ACC 48 | AAC 30 | AGC 24
ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 0 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 0 | Asp D GAT 0 | Gly G GGT 6
GTC 18 | GCC 6 | GAC 18 | GGC 24
GTA 12 | GCA 0 | Glu E GAA 0 | GGA 0
GTG 0 | GCG 0 | GAG 6 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11650 C:0.33981 A:0.36893 G:0.17476
position 2: T:0.24272 C:0.22330 A:0.31068 G:0.22330
position 3: T:0.12621 C:0.56311 A:0.14563 G:0.16505
Average T:0.16181 C:0.37540 A:0.27508 G:0.18770
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -392.818795 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 86.476476 125.731255
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907474_1_22_MLBR_RS15410: 0.000004, NC_002677_1_NP_301149_1_21_ML0023: 0.000004, NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980: 0.000004, NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305: 0.000004, NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125: 0.000004, NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 86.47648
omega (dN/dS) = 125.73126
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
7..2 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
7..3 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
7..4 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
7..5 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
7..6 0.000 239.4 69.6 125.7313 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -392.818824 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 86.467947 0.000010 0.694964
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907474_1_22_MLBR_RS15410: 0.000004, NC_002677_1_NP_301149_1_21_ML0023: 0.000004, NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980: 0.000004, NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305: 0.000004, NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125: 0.000004, NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 86.46795
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.69496 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 239.4 69.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -392.818805 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 86.427046 0.856756 0.122770 0.000001 137.703500
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907474_1_22_MLBR_RS15410: 0.000004, NC_002677_1_NP_301149_1_21_ML0023: 0.000004, NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980: 0.000004, NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305: 0.000004, NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125: 0.000004, NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 86.42705
MLEs of dN/dS (w) for site classes (K=3)
p: 0.85676 0.12277 0.02047
w: 0.00000 1.00000 137.70350
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
7..2 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
7..3 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
7..4 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
7..5 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
7..6 0.000 239.4 69.6 2.9422 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907474_1_22_MLBR_RS15410)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907474_1_22_MLBR_RS15410)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -392.818848 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 86.427046 1.098731 1.460713
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907474_1_22_MLBR_RS15410: 0.000004, NC_002677_1_NP_301149_1_21_ML0023: 0.000004, NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980: 0.000004, NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305: 0.000004, NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125: 0.000004, NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 86.42705
Parameters in M7 (beta):
p = 1.09873 q = 1.46071
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.04577 0.12677 0.20574 0.28526 0.36671 0.45132 0.54066 0.63718 0.74567 0.88087
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
7..2 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
7..3 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
7..4 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
7..5 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
7..6 0.000 239.4 69.6 0.4286 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -392.818806 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 86.427020 0.978945 0.005000 1.653226 125.735902
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907474_1_22_MLBR_RS15410: 0.000004, NC_002677_1_NP_301149_1_21_ML0023: 0.000004, NZ_LVXE01000010_1_WP_010907474_1_287_A3216_RS14980: 0.000004, NZ_LYPH01000099_1_WP_010907474_1_2864_A8144_RS16305: 0.000004, NZ_CP029543_1_WP_010907474_1_22_DIJ64_RS00125: 0.000004, NZ_AP014567_1_WP_010907474_1_22_JK2ML_RS00125: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 86.42702
Parameters in M8 (beta&w>1):
p0 = 0.97895 p = 0.00500 q = 1.65323
(p1 = 0.02105) w = 125.73590
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09789 0.09789 0.09789 0.09789 0.09789 0.09789 0.09789 0.09789 0.09789 0.09789 0.02105
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 125.73590
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
7..2 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
7..3 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
7..4 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
7..5 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
7..6 0.000 239.4 69.6 2.6473 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907474_1_22_MLBR_RS15410)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907474_1_22_MLBR_RS15410)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:10
Model 1: NearlyNeutral -392.818824 Model 2: PositiveSelection -392.818805 Model 0: one-ratio -392.818795 Model 7: beta -392.818848 Model 8: beta&w>1 -392.818806 Model 0 vs 1 5.7999999967250915E-5 Model 2 vs 1 3.800000001774606E-5 Model 8 vs 7 8.400000001529406E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
