--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:15:15 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0023/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -413.21 -416.45
2 -413.24 -415.86
--------------------------------------
TOTAL -413.22 -416.20
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893329 0.092390 0.373330 1.508401 0.853901 1501.00 1501.00 1.001
r(A<->C){all} 0.157645 0.018346 0.000020 0.419746 0.121443 248.86 249.69 1.000
r(A<->G){all} 0.166438 0.020294 0.000054 0.445765 0.126959 190.40 246.87 1.000
r(A<->T){all} 0.173924 0.022501 0.000062 0.480428 0.132708 287.87 340.82 1.002
r(C<->G){all} 0.178388 0.021412 0.000017 0.464581 0.140650 227.20 271.12 1.001
r(C<->T){all} 0.172109 0.020614 0.000025 0.453904 0.134419 236.89 239.60 1.000
r(G<->T){all} 0.151496 0.016751 0.000007 0.413324 0.118181 287.31 374.16 1.003
pi(A){all} 0.275413 0.000636 0.226469 0.322940 0.274362 1278.85 1323.24 1.000
pi(C){all} 0.372611 0.000745 0.319916 0.428017 0.372241 1119.29 1310.15 1.000
pi(G){all} 0.189316 0.000489 0.148805 0.234216 0.188992 1174.50 1279.09 1.000
pi(T){all} 0.162660 0.000429 0.122092 0.203119 0.162025 1399.49 1409.84 1.000
alpha{1,2} 0.403707 0.217961 0.000245 1.323610 0.247985 1252.69 1287.69 1.001
alpha{3} 0.457759 0.237279 0.000107 1.434738 0.292657 990.61 1069.44 1.000
pinvar{all} 0.994572 0.000043 0.982670 0.999997 0.996645 1258.49 1379.74 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -392.818824
Model 2: PositiveSelection -392.818805
Model 0: one-ratio -392.818795
Model 7: beta -392.818848
Model 8: beta&w>1 -392.818806
Model 0 vs 1 5.7999999967250915E-5
Model 2 vs 1 3.800000001774606E-5
Model 8 vs 7 8.400000001529406E-5
>C1
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C2
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C3
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C4
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C5
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C6
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=103
C1 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C2 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C3 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C4 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C5 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C6 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
**************************************************
C1 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C2 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C3 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C4 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C5 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C6 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
**************************************************
C1 RGT
C2 RGT
C3 RGT
C4 RGT
C5 RGT
C6 RGT
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 103 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 103 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3090]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3090]--->[3090]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.444 Mb, Max= 30.618 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C2 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C3 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C4 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C5 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
C6 LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
**************************************************
C1 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C2 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C3 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C4 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C5 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
C6 VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
**************************************************
C1 RGT
C2 RGT
C3 RGT
C4 RGT
C5 RGT
C6 RGT
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C2 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C3 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C4 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C5 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
C6 TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
**************************************************
C1 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C2 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C3 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C4 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C5 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
C6 CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
**************************************************
C1 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C2 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C3 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C4 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C5 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
C6 GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
**************************************************
C1 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C2 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C3 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C4 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C5 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
C6 GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
**************************************************
C1 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C2 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C3 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C4 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C5 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
C6 CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
**************************************************
C1 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C2 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C3 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C4 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C5 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
C6 GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
**************************************************
C1 AGGGGGACT
C2 AGGGGGACT
C3 AGGGGGACT
C4 AGGGGGACT
C5 AGGGGGACT
C6 AGGGGGACT
*********
>C1
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C2
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C3
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C4
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C5
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C6
TTGCCGACCCAACCCCATTTCCGCATCCAACACGACACCGTCAACCAATT
CAGCAAAAGGACCCTGTGCCACGGCAGCCTTCTACACCACCTCGGCATCG
GTCGCACTCACACCCACACCCCCGTACTAATGCCGGTCACAACCAACATC
GTCACCATCATCAGCAAAACGGGCCATCACCTCATCGCCAGCCAGTGTAT
CAACTTCGACCACAACTACTGGCCCAACCAAACAAAATTCCCCGGCCGAT
GGCCGGGGAATTTTGTAACCCATGACTCGACTCATCACGAGAGTGGGCGA
AGGGGGACT
>C1
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C2
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C3
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C4
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C5
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
>C6
LPTQPHFRIQHDTVNQFSKRTLCHGSLLHHLGIGRTHTHTPVLMPVTTNI
VTIISKTGHHLIASQCINFDHNYWPNQTKFPGRWPGNFVTHDSTHHESGR
RGT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 309 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788844
Setting output file names to "/data/3res/ML0023/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 905117990
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0247188275
Seed = 1914826894
Swapseed = 1579788844
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -691.556820 -- -24.965149
Chain 2 -- -691.556714 -- -24.965149
Chain 3 -- -691.556714 -- -24.965149
Chain 4 -- -691.556782 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -691.556714 -- -24.965149
Chain 2 -- -691.556820 -- -24.965149
Chain 3 -- -691.556820 -- -24.965149
Chain 4 -- -691.556820 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-691.557] (-691.557) (-691.557) (-691.557) * [-691.557] (-691.557) (-691.557) (-691.557)
500 -- (-432.509) (-432.489) [-430.281] (-432.217) * (-440.305) [-421.013] (-429.212) (-428.275) -- 0:00:00
1000 -- (-423.683) (-427.169) [-421.725] (-418.063) * (-416.854) [-420.904] (-426.207) (-421.765) -- 0:00:00
1500 -- [-425.163] (-421.754) (-422.620) (-423.175) * (-424.901) [-419.393] (-425.625) (-427.782) -- 0:00:00
2000 -- [-420.804] (-426.088) (-419.986) (-416.495) * [-423.410] (-427.119) (-420.556) (-418.892) -- 0:00:00
2500 -- (-423.501) [-423.359] (-420.288) (-419.454) * (-422.336) (-421.677) (-422.496) [-418.007] -- 0:00:00
3000 -- (-419.831) (-426.662) [-423.818] (-419.104) * (-418.079) (-424.683) [-424.288] (-428.571) -- 0:00:00
3500 -- (-424.797) (-425.714) [-419.781] (-422.579) * (-417.779) (-425.016) [-419.117] (-418.160) -- 0:00:00
4000 -- (-423.739) (-420.610) [-421.359] (-421.562) * (-426.413) (-421.949) (-419.207) [-429.613] -- 0:00:00
4500 -- [-419.666] (-424.224) (-424.236) (-419.705) * [-420.506] (-422.881) (-423.208) (-422.577) -- 0:03:41
5000 -- (-429.189) (-423.426) (-436.876) [-426.001] * (-427.846) (-422.975) (-427.588) [-420.834] -- 0:03:19
Average standard deviation of split frequencies: 0.074826
5500 -- (-427.974) (-423.486) (-423.725) [-425.716] * (-426.303) (-424.735) (-418.445) [-427.030] -- 0:03:00
6000 -- (-425.238) (-429.452) (-427.419) [-420.926] * [-424.955] (-422.043) (-424.072) (-426.515) -- 0:02:45
6500 -- (-424.851) [-422.985] (-428.195) (-422.737) * [-428.929] (-417.383) (-423.184) (-426.945) -- 0:02:32
7000 -- [-421.516] (-422.907) (-421.950) (-430.147) * (-424.696) (-429.058) (-429.866) [-417.989] -- 0:02:21
7500 -- (-419.163) (-424.427) (-428.659) [-423.737] * [-420.849] (-424.460) (-423.881) (-422.409) -- 0:02:12
8000 -- (-422.602) (-430.808) (-424.548) [-424.581] * [-420.426] (-429.478) (-419.597) (-421.345) -- 0:02:04
8500 -- (-424.091) (-421.653) (-424.423) [-425.115] * (-425.125) [-424.130] (-421.669) (-430.673) -- 0:01:56
9000 -- [-421.606] (-422.272) (-433.027) (-422.854) * (-421.923) (-426.093) (-426.141) [-426.787] -- 0:01:50
9500 -- (-427.136) (-421.158) [-427.306] (-422.367) * (-422.589) [-422.960] (-427.498) (-432.074) -- 0:01:44
10000 -- [-420.560] (-421.485) (-420.590) (-436.453) * (-436.684) [-422.364] (-421.684) (-427.737) -- 0:01:39
Average standard deviation of split frequencies: 0.073657
10500 -- (-417.556) (-428.728) [-417.019] (-426.778) * (-429.327) (-427.242) [-428.855] (-426.163) -- 0:01:34
11000 -- (-426.963) (-421.375) (-420.270) [-418.975] * [-423.317] (-425.698) (-422.353) (-422.441) -- 0:01:29
11500 -- [-419.671] (-422.827) (-438.350) (-422.760) * (-413.517) [-421.887] (-421.319) (-427.246) -- 0:01:25
12000 -- (-431.202) [-428.224] (-427.565) (-426.760) * [-413.201] (-423.423) (-428.493) (-424.215) -- 0:01:22
12500 -- (-421.806) (-419.426) (-425.687) [-425.932] * [-412.808] (-424.036) (-421.973) (-418.677) -- 0:01:19
13000 -- (-426.683) (-423.713) [-422.952] (-426.464) * (-412.664) (-427.221) (-422.448) [-421.368] -- 0:01:15
13500 -- (-428.321) [-414.446] (-433.022) (-421.371) * (-413.733) (-422.548) [-428.229] (-424.492) -- 0:01:13
14000 -- (-434.069) (-424.168) [-421.101] (-426.434) * (-412.603) (-426.951) [-426.917] (-424.872) -- 0:01:10
14500 -- (-427.295) [-423.221] (-418.876) (-426.173) * (-413.310) [-421.329] (-427.521) (-426.090) -- 0:01:07
15000 -- [-419.443] (-418.265) (-420.655) (-422.956) * [-411.928] (-423.947) (-446.141) (-423.893) -- 0:01:05
Average standard deviation of split frequencies: 0.049105
15500 -- (-422.991) (-423.735) [-422.942] (-423.823) * (-414.398) (-422.090) (-431.711) [-422.401] -- 0:01:03
16000 -- (-420.834) (-428.302) (-421.686) [-425.532] * (-413.176) (-423.936) (-427.887) [-426.928] -- 0:01:01
16500 -- (-427.620) (-423.601) (-425.678) [-424.568] * [-413.631] (-421.653) (-416.897) (-428.677) -- 0:00:59
17000 -- [-417.266] (-429.409) (-420.358) (-439.492) * (-417.057) [-422.643] (-416.019) (-425.307) -- 0:00:57
17500 -- (-418.904) [-425.103] (-421.033) (-431.133) * (-415.126) (-421.581) (-415.323) [-429.575] -- 0:01:52
18000 -- (-422.718) [-422.509] (-433.792) (-424.191) * (-414.083) [-426.577] (-415.361) (-423.581) -- 0:01:49
18500 -- (-427.053) (-419.378) [-422.463] (-417.806) * (-414.228) [-426.012] (-413.184) (-414.746) -- 0:01:46
19000 -- (-426.420) [-426.184] (-419.509) (-413.167) * (-413.224) (-419.837) [-412.730] (-413.954) -- 0:01:43
19500 -- (-425.859) [-417.802] (-420.260) (-412.170) * (-412.923) (-417.824) [-412.235] (-412.887) -- 0:01:40
20000 -- (-433.605) [-422.028] (-424.353) (-416.032) * [-414.326] (-421.013) (-417.385) (-413.364) -- 0:01:38
Average standard deviation of split frequencies: 0.042018
20500 -- (-426.009) (-422.278) [-426.399] (-415.468) * (-415.606) (-429.854) (-414.962) [-412.492] -- 0:01:35
21000 -- (-420.271) [-416.236] (-425.242) (-418.195) * (-415.669) (-425.200) (-413.403) [-413.005] -- 0:01:33
21500 -- (-432.686) (-416.727) [-423.896] (-417.376) * (-414.709) (-439.782) (-413.213) [-413.157] -- 0:01:31
22000 -- (-427.277) [-420.369] (-420.386) (-420.247) * [-413.594] (-418.832) (-413.180) (-412.356) -- 0:01:28
22500 -- [-421.476] (-420.698) (-430.318) (-415.376) * [-414.585] (-417.814) (-415.218) (-416.980) -- 0:01:26
23000 -- (-412.407) (-423.629) [-425.302] (-419.680) * (-413.719) [-412.699] (-413.454) (-415.165) -- 0:01:24
23500 -- (-414.926) (-422.908) [-428.751] (-415.826) * (-416.161) [-415.941] (-413.313) (-413.548) -- 0:01:23
24000 -- (-420.152) [-420.163] (-434.953) (-413.979) * (-414.232) (-413.778) (-412.360) [-414.090] -- 0:01:21
24500 -- [-418.632] (-424.375) (-441.050) (-413.020) * [-413.913] (-413.505) (-414.549) (-413.796) -- 0:01:19
25000 -- (-416.277) [-422.633] (-432.786) (-412.269) * (-417.822) (-414.165) [-414.782] (-414.690) -- 0:01:18
Average standard deviation of split frequencies: 0.039888
25500 -- (-415.993) (-426.682) (-428.800) [-415.513] * (-417.577) (-412.720) (-414.405) [-412.159] -- 0:01:16
26000 -- [-414.652] (-421.586) (-421.913) (-414.890) * (-415.451) (-412.634) [-416.354] (-414.757) -- 0:01:14
26500 -- (-412.766) (-427.876) [-413.171] (-415.803) * (-413.599) [-412.399] (-413.237) (-412.529) -- 0:01:13
27000 -- [-411.975] (-425.681) (-418.904) (-413.715) * (-414.740) (-417.273) (-415.471) [-413.279] -- 0:01:12
27500 -- (-416.442) (-427.984) [-412.197] (-414.211) * (-416.759) [-412.771] (-411.824) (-414.725) -- 0:01:10
28000 -- (-412.739) (-430.138) (-412.535) [-411.910] * (-415.238) (-413.714) [-411.871] (-412.198) -- 0:01:09
28500 -- (-412.231) (-418.842) [-416.321] (-412.982) * [-413.415] (-412.787) (-411.793) (-412.483) -- 0:01:08
29000 -- (-415.083) (-420.331) (-412.362) [-417.469] * [-414.222] (-414.316) (-412.420) (-414.362) -- 0:01:06
29500 -- [-417.206] (-424.606) (-414.126) (-416.918) * (-414.425) (-415.061) (-413.113) [-412.948] -- 0:01:05
30000 -- (-415.345) (-430.006) (-413.312) [-413.331] * (-414.699) (-412.782) (-414.358) [-413.567] -- 0:01:04
Average standard deviation of split frequencies: 0.035136
30500 -- (-415.760) (-427.609) (-415.710) [-413.179] * (-418.531) [-412.952] (-415.341) (-413.184) -- 0:01:03
31000 -- (-416.744) (-421.934) (-415.177) [-413.119] * (-415.505) (-412.473) (-413.904) [-413.040] -- 0:01:02
31500 -- (-414.493) (-423.718) [-413.597] (-413.750) * (-413.367) (-412.502) (-417.209) [-412.577] -- 0:01:01
32000 -- (-415.255) [-425.418] (-413.859) (-413.018) * (-416.214) [-417.142] (-412.454) (-412.207) -- 0:01:00
32500 -- (-413.095) (-421.446) [-413.943] (-415.848) * (-416.736) (-416.823) [-413.799] (-412.560) -- 0:00:59
33000 -- (-414.106) [-425.507] (-417.494) (-412.033) * (-414.091) [-413.665] (-413.818) (-412.631) -- 0:01:27
33500 -- (-411.779) [-423.020] (-413.122) (-416.113) * (-412.194) (-412.754) [-416.034] (-411.846) -- 0:01:26
34000 -- (-412.805) (-427.278) (-413.445) [-415.222] * (-414.126) (-413.761) (-416.872) [-415.703] -- 0:01:25
34500 -- (-416.031) [-419.009] (-413.225) (-412.453) * (-416.760) (-413.259) (-416.411) [-411.738] -- 0:01:23
35000 -- (-414.139) [-425.043] (-415.625) (-415.306) * (-415.318) (-412.755) (-416.298) [-415.329] -- 0:01:22
Average standard deviation of split frequencies: 0.031281
35500 -- [-412.350] (-420.978) (-412.923) (-415.394) * (-416.636) (-413.239) (-415.663) [-415.684] -- 0:01:21
36000 -- (-413.972) (-431.508) (-414.929) [-417.665] * (-416.751) (-419.599) [-413.845] (-414.163) -- 0:01:20
36500 -- (-416.330) [-420.474] (-413.560) (-416.741) * (-414.087) (-418.566) (-414.770) [-412.565] -- 0:01:19
37000 -- [-414.142] (-421.465) (-414.681) (-414.472) * (-416.625) [-417.974] (-412.567) (-412.676) -- 0:01:18
37500 -- (-411.745) (-422.732) (-413.649) [-413.077] * (-414.387) [-413.910] (-412.780) (-413.596) -- 0:01:17
38000 -- (-416.295) (-421.201) [-413.852] (-416.592) * (-415.782) [-416.185] (-416.502) (-414.597) -- 0:01:15
38500 -- (-412.915) (-422.867) [-414.953] (-412.004) * [-416.047] (-415.427) (-414.004) (-413.215) -- 0:01:14
39000 -- (-413.484) (-420.074) [-413.768] (-417.453) * [-413.325] (-413.740) (-418.972) (-414.067) -- 0:01:13
39500 -- [-412.099] (-434.145) (-412.465) (-414.123) * (-413.330) (-413.855) (-413.401) [-417.088] -- 0:01:12
40000 -- (-412.366) (-423.646) (-414.546) [-414.953] * (-414.382) (-412.776) [-413.786] (-415.161) -- 0:01:12
Average standard deviation of split frequencies: 0.027692
40500 -- (-413.464) (-433.290) (-412.094) [-415.483] * (-413.614) (-414.853) [-413.742] (-415.558) -- 0:01:11
41000 -- (-412.242) (-425.817) [-412.895] (-414.169) * (-412.072) [-411.672] (-414.578) (-413.808) -- 0:01:10
41500 -- (-415.453) (-430.240) (-412.711) [-414.003] * (-414.214) [-412.373] (-414.651) (-413.115) -- 0:01:09
42000 -- [-413.819] (-434.875) (-413.971) (-413.217) * [-412.434] (-414.041) (-413.021) (-414.003) -- 0:01:08
42500 -- (-413.733) (-425.387) [-412.324] (-412.236) * [-412.062] (-416.165) (-412.778) (-414.520) -- 0:01:07
43000 -- (-414.325) (-424.325) [-413.758] (-413.405) * [-413.750] (-413.644) (-412.504) (-418.546) -- 0:01:06
43500 -- (-413.121) [-420.301] (-414.055) (-414.806) * [-421.670] (-415.214) (-416.700) (-418.491) -- 0:01:05
44000 -- (-412.376) (-422.887) [-414.634] (-413.680) * (-414.343) (-414.188) [-413.613] (-412.250) -- 0:01:05
44500 -- (-415.361) (-414.635) [-415.156] (-413.126) * (-413.195) (-412.819) (-413.372) [-412.580] -- 0:01:04
45000 -- (-414.230) [-416.075] (-415.786) (-415.694) * [-412.707] (-414.746) (-413.829) (-415.360) -- 0:01:03
Average standard deviation of split frequencies: 0.020008
45500 -- [-412.284] (-412.708) (-414.219) (-413.103) * (-413.655) (-414.884) (-413.681) [-414.616] -- 0:01:02
46000 -- [-413.491] (-418.676) (-414.446) (-413.309) * (-419.628) (-413.052) [-413.833] (-412.752) -- 0:01:02
46500 -- (-416.009) (-412.907) (-415.563) [-413.933] * (-415.971) [-415.440] (-414.396) (-413.646) -- 0:01:01
47000 -- (-414.418) (-412.667) (-413.422) [-413.198] * (-415.274) [-414.040] (-412.680) (-414.068) -- 0:01:00
47500 -- (-414.120) [-413.187] (-412.592) (-413.052) * [-414.811] (-412.114) (-412.176) (-421.779) -- 0:01:00
48000 -- (-412.149) [-414.455] (-416.936) (-417.492) * (-414.046) (-412.151) [-417.758] (-415.341) -- 0:00:59
48500 -- (-412.202) (-413.379) [-413.997] (-413.369) * (-414.056) [-412.259] (-413.640) (-415.699) -- 0:01:18
49000 -- [-418.168] (-413.037) (-413.147) (-412.704) * [-416.205] (-413.676) (-413.440) (-416.717) -- 0:01:17
49500 -- (-413.571) (-413.061) (-412.807) [-413.748] * (-412.996) (-417.047) [-412.953] (-414.348) -- 0:01:16
50000 -- [-414.083] (-415.938) (-413.972) (-412.224) * (-412.788) [-411.653] (-413.882) (-414.099) -- 0:01:16
Average standard deviation of split frequencies: 0.018143
50500 -- (-414.696) (-414.375) (-412.222) [-417.413] * [-412.566] (-415.115) (-414.397) (-414.572) -- 0:01:15
51000 -- (-412.848) (-415.430) (-412.745) [-411.826] * (-412.936) (-413.258) (-414.275) [-413.999] -- 0:01:14
51500 -- (-412.551) (-413.478) [-413.166] (-413.393) * (-414.307) [-415.680] (-417.128) (-412.139) -- 0:01:13
52000 -- (-412.387) [-414.404] (-416.078) (-412.494) * [-417.025] (-415.089) (-412.599) (-411.769) -- 0:01:12
52500 -- (-414.272) (-414.277) (-413.079) [-414.440] * (-413.695) [-416.428] (-413.497) (-417.039) -- 0:01:12
53000 -- (-413.074) (-414.007) [-414.864] (-413.723) * (-414.603) (-416.007) [-413.718] (-412.421) -- 0:01:11
53500 -- (-416.544) [-413.727] (-414.121) (-414.320) * [-412.690] (-415.154) (-417.104) (-414.368) -- 0:01:10
54000 -- [-417.014] (-413.527) (-415.460) (-413.335) * [-412.518] (-412.477) (-414.677) (-413.241) -- 0:01:10
54500 -- (-417.359) (-413.214) [-412.649] (-415.017) * (-411.935) (-417.151) [-414.948] (-416.751) -- 0:01:09
55000 -- (-414.313) (-414.518) (-415.993) [-414.088] * (-412.492) [-417.527] (-412.887) (-414.562) -- 0:01:08
Average standard deviation of split frequencies: 0.022596
55500 -- (-412.620) (-413.093) [-412.434] (-414.833) * (-412.781) (-414.572) (-412.533) [-413.491] -- 0:01:08
56000 -- (-411.850) (-411.592) (-414.470) [-413.464] * (-412.560) [-413.181] (-413.429) (-414.566) -- 0:01:07
56500 -- (-417.843) (-411.691) [-412.826] (-417.203) * [-413.041] (-412.962) (-414.099) (-416.378) -- 0:01:06
57000 -- [-414.447] (-414.621) (-414.262) (-414.286) * [-414.526] (-414.667) (-413.773) (-416.717) -- 0:01:06
57500 -- (-415.121) (-413.361) (-416.532) [-412.415] * (-415.142) [-413.897] (-416.533) (-415.744) -- 0:01:05
58000 -- (-414.427) [-415.046] (-412.590) (-412.393) * (-414.388) [-415.319] (-414.774) (-413.857) -- 0:01:04
58500 -- [-417.643] (-413.783) (-415.863) (-414.243) * (-413.654) (-415.776) [-414.217] (-413.789) -- 0:01:04
59000 -- [-414.538] (-415.082) (-412.670) (-413.754) * (-412.940) (-415.122) (-412.902) [-412.878] -- 0:01:03
59500 -- (-413.392) (-415.360) [-413.464] (-420.387) * (-413.632) (-413.491) (-412.740) [-412.926] -- 0:01:03
60000 -- [-413.115] (-412.900) (-414.034) (-414.341) * (-416.203) [-414.834] (-412.803) (-414.023) -- 0:01:02
Average standard deviation of split frequencies: 0.024225
60500 -- [-412.715] (-418.093) (-416.761) (-421.391) * (-415.285) (-413.166) [-413.865] (-413.776) -- 0:01:02
61000 -- [-413.597] (-417.152) (-412.906) (-412.219) * (-413.333) (-412.773) (-414.757) [-416.024] -- 0:01:01
61500 -- (-414.177) (-416.247) (-413.994) [-415.538] * [-413.378] (-417.311) (-414.175) (-412.915) -- 0:01:01
62000 -- [-413.852] (-414.989) (-414.828) (-413.958) * (-414.260) (-414.404) (-412.585) [-414.280] -- 0:01:00
62500 -- (-413.697) [-414.680] (-414.226) (-415.462) * (-412.645) [-414.319] (-413.256) (-416.202) -- 0:01:00
63000 -- (-412.729) [-415.451] (-416.939) (-413.619) * (-414.122) (-412.014) (-418.232) [-412.384] -- 0:00:59
63500 -- (-413.902) (-414.801) (-412.860) [-414.027] * (-417.171) (-416.143) [-416.058] (-412.827) -- 0:00:58
64000 -- (-416.313) [-412.384] (-415.996) (-412.719) * (-416.438) (-413.534) [-414.473] (-414.790) -- 0:01:13
64500 -- [-416.102] (-415.316) (-412.222) (-413.102) * (-413.386) (-416.926) [-415.546] (-414.593) -- 0:01:12
65000 -- (-421.102) (-414.048) [-412.869] (-415.165) * (-414.000) [-417.752] (-412.288) (-413.735) -- 0:01:11
Average standard deviation of split frequencies: 0.017856
65500 -- (-417.774) (-415.217) (-412.652) [-412.821] * [-412.462] (-418.319) (-413.936) (-412.057) -- 0:01:11
66000 -- (-411.722) (-413.012) [-415.049] (-411.880) * (-416.175) (-421.133) [-413.630] (-412.540) -- 0:01:10
66500 -- (-412.488) (-415.427) (-418.393) [-413.716] * (-415.500) [-415.005] (-414.603) (-412.824) -- 0:01:10
67000 -- (-413.719) (-412.696) [-412.566] (-414.345) * [-412.817] (-414.255) (-415.827) (-415.323) -- 0:01:09
67500 -- [-411.717] (-413.308) (-414.194) (-413.693) * (-413.716) (-412.674) [-412.670] (-416.000) -- 0:01:09
68000 -- (-413.405) (-414.005) (-412.287) [-416.217] * (-417.451) (-412.732) (-415.076) [-412.019] -- 0:01:08
68500 -- (-412.267) (-413.525) (-412.875) [-413.695] * [-413.265] (-414.544) (-412.561) (-414.367) -- 0:01:07
69000 -- [-413.496] (-416.298) (-413.096) (-415.049) * (-414.979) (-414.365) [-414.503] (-415.610) -- 0:01:07
69500 -- (-412.698) (-411.947) [-412.519] (-418.615) * [-414.565] (-413.529) (-412.049) (-414.818) -- 0:01:06
70000 -- (-414.348) (-413.643) [-412.629] (-412.673) * [-412.287] (-413.144) (-416.496) (-414.983) -- 0:01:06
Average standard deviation of split frequencies: 0.026016
70500 -- (-416.027) (-413.682) [-413.694] (-412.677) * (-415.863) (-414.869) (-413.948) [-413.286] -- 0:01:05
71000 -- (-413.720) [-412.158] (-413.174) (-414.379) * [-413.634] (-414.381) (-412.486) (-413.251) -- 0:01:05
71500 -- (-412.700) (-414.363) [-412.025] (-414.485) * (-414.267) [-414.221] (-414.055) (-413.297) -- 0:01:04
72000 -- (-413.995) [-415.586] (-411.865) (-413.418) * [-412.588] (-414.470) (-414.229) (-415.241) -- 0:01:04
72500 -- (-414.292) (-412.310) (-416.654) [-412.894] * [-412.495] (-416.185) (-418.383) (-415.822) -- 0:01:03
73000 -- (-415.297) [-411.971] (-414.043) (-415.187) * (-415.449) (-414.161) (-414.474) [-416.383] -- 0:01:03
73500 -- [-414.314] (-416.301) (-414.232) (-412.575) * [-411.718] (-414.199) (-415.859) (-414.886) -- 0:01:03
74000 -- [-414.327] (-416.053) (-415.685) (-414.654) * (-414.796) [-413.071] (-414.853) (-411.896) -- 0:01:02
74500 -- (-415.561) (-416.360) [-415.439] (-414.979) * [-413.601] (-415.155) (-422.492) (-414.214) -- 0:01:02
75000 -- [-414.757] (-416.188) (-415.274) (-414.527) * (-412.130) (-415.051) [-415.636] (-414.175) -- 0:01:01
Average standard deviation of split frequencies: 0.023505
75500 -- (-412.804) (-414.919) (-413.286) [-417.047] * (-413.201) (-413.746) [-413.598] (-411.956) -- 0:01:01
76000 -- [-414.410] (-413.288) (-412.705) (-416.161) * [-415.899] (-414.034) (-412.248) (-413.573) -- 0:01:00
76500 -- (-413.026) (-413.254) [-415.178] (-413.758) * (-412.364) (-415.322) (-421.827) [-412.792] -- 0:01:00
77000 -- (-413.057) [-413.526] (-412.482) (-413.881) * [-415.294] (-414.003) (-421.940) (-414.593) -- 0:00:59
77500 -- (-416.999) (-414.040) [-416.742] (-416.585) * [-415.685] (-414.168) (-412.998) (-413.438) -- 0:00:59
78000 -- (-414.943) (-415.223) [-414.202] (-415.847) * (-413.291) [-412.171] (-413.333) (-413.732) -- 0:00:59
78500 -- (-413.591) (-414.802) (-413.240) [-413.681] * (-413.452) [-411.944] (-412.270) (-416.062) -- 0:00:58
79000 -- (-413.700) [-416.361] (-413.638) (-413.314) * (-412.347) (-414.238) (-415.357) [-417.235] -- 0:00:58
79500 -- (-412.603) (-414.193) [-413.321] (-413.315) * (-412.543) [-414.262] (-416.670) (-416.222) -- 0:00:57
80000 -- [-413.473] (-413.997) (-412.960) (-414.000) * (-412.799) (-415.056) [-415.090] (-413.881) -- 0:00:57
Average standard deviation of split frequencies: 0.024606
80500 -- (-412.303) (-415.973) [-412.413] (-420.635) * (-413.435) (-417.050) [-412.529] (-413.217) -- 0:00:57
81000 -- (-413.671) (-413.747) (-413.552) [-418.228] * [-416.583] (-414.246) (-412.773) (-412.495) -- 0:01:08
81500 -- [-413.399] (-415.154) (-413.740) (-413.928) * [-413.963] (-414.420) (-414.794) (-413.084) -- 0:01:07
82000 -- (-414.169) [-413.510] (-413.526) (-414.297) * (-417.241) [-418.321] (-413.381) (-412.579) -- 0:01:07
82500 -- (-414.632) [-413.653] (-414.652) (-412.281) * [-413.183] (-414.984) (-413.965) (-414.930) -- 0:01:06
83000 -- [-413.095] (-415.054) (-412.727) (-412.709) * [-417.282] (-420.970) (-411.632) (-413.206) -- 0:01:06
83500 -- (-412.534) [-413.095] (-413.987) (-412.292) * (-416.122) (-414.259) [-414.065] (-412.999) -- 0:01:05
84000 -- (-417.778) (-416.585) [-414.353] (-413.976) * [-413.079] (-412.459) (-415.097) (-414.343) -- 0:01:05
84500 -- (-412.155) (-416.286) (-413.960) [-413.795] * (-413.740) (-413.618) [-412.637] (-414.509) -- 0:01:05
85000 -- (-411.758) [-415.101] (-413.827) (-413.667) * (-417.656) [-414.007] (-412.634) (-412.959) -- 0:01:04
Average standard deviation of split frequencies: 0.024118
85500 -- (-421.692) (-415.802) [-414.463] (-414.722) * (-415.383) [-413.217] (-414.694) (-412.798) -- 0:01:04
86000 -- [-413.525] (-417.748) (-413.103) (-415.210) * (-416.628) (-415.001) [-413.444] (-412.033) -- 0:01:03
86500 -- (-418.103) (-414.398) [-413.875] (-415.983) * (-415.749) [-412.125] (-412.876) (-416.941) -- 0:01:03
87000 -- (-417.799) [-416.455] (-414.662) (-415.098) * (-417.370) (-415.795) (-414.655) [-416.507] -- 0:01:02
87500 -- (-419.776) (-415.731) [-416.031] (-413.856) * (-419.830) [-416.012] (-415.197) (-412.687) -- 0:01:02
88000 -- (-413.186) (-414.299) (-412.423) [-413.657] * (-415.210) (-414.537) [-414.925] (-414.187) -- 0:01:02
88500 -- (-412.551) (-414.893) [-415.173] (-415.832) * (-415.290) (-413.482) (-413.903) [-416.668] -- 0:01:01
89000 -- (-415.911) (-412.912) [-414.405] (-413.861) * [-414.199] (-412.188) (-414.623) (-413.781) -- 0:01:01
89500 -- (-415.171) [-416.969] (-415.540) (-419.206) * [-412.548] (-418.268) (-413.391) (-414.871) -- 0:01:01
90000 -- (-414.293) (-413.844) [-412.391] (-417.967) * (-416.485) [-412.652] (-412.998) (-413.581) -- 0:01:00
Average standard deviation of split frequencies: 0.021317
90500 -- [-414.056] (-412.688) (-414.230) (-413.444) * [-413.249] (-413.170) (-413.352) (-412.991) -- 0:01:00
91000 -- (-415.156) [-413.052] (-413.627) (-413.216) * (-417.760) (-413.314) [-413.007] (-414.235) -- 0:00:59
91500 -- (-415.548) (-413.935) (-413.849) [-418.544] * (-414.094) (-412.048) [-414.086] (-413.427) -- 0:00:59
92000 -- (-417.108) (-419.449) [-413.745] (-415.511) * (-414.594) (-412.719) [-415.024] (-414.253) -- 0:00:59
92500 -- [-413.826] (-413.388) (-412.232) (-413.797) * [-411.874] (-413.369) (-418.387) (-413.808) -- 0:00:58
93000 -- (-413.339) (-412.503) (-412.138) [-412.744] * [-414.620] (-412.416) (-413.718) (-412.449) -- 0:00:58
93500 -- (-414.941) [-411.747] (-412.480) (-412.623) * (-414.976) (-412.744) (-411.976) [-416.046] -- 0:00:58
94000 -- [-412.353] (-414.429) (-412.024) (-412.468) * [-414.511] (-415.933) (-415.413) (-413.347) -- 0:00:57
94500 -- [-412.777] (-415.379) (-412.121) (-414.130) * (-413.004) [-412.784] (-416.524) (-420.854) -- 0:00:57
95000 -- [-414.986] (-416.672) (-414.017) (-416.036) * (-416.750) (-416.228) (-417.567) [-415.342] -- 0:00:57
Average standard deviation of split frequencies: 0.023777
95500 -- [-416.728] (-416.067) (-412.752) (-413.861) * (-413.407) (-412.481) (-415.073) [-415.453] -- 0:00:56
96000 -- (-413.913) (-417.891) (-412.782) [-414.259] * (-415.708) (-413.944) (-416.641) [-414.450] -- 0:00:56
96500 -- [-414.408] (-412.335) (-412.536) (-414.390) * (-417.098) (-417.314) [-411.804] (-414.023) -- 0:00:56
97000 -- (-413.301) [-412.263] (-411.788) (-412.185) * [-414.798] (-416.337) (-417.668) (-413.712) -- 0:00:55
97500 -- (-413.697) [-412.534] (-414.497) (-414.183) * [-414.538] (-412.905) (-412.801) (-418.403) -- 0:00:55
98000 -- (-413.351) (-414.030) (-417.403) [-414.809] * (-412.366) (-414.210) [-413.021] (-414.998) -- 0:01:04
98500 -- (-413.242) (-414.756) (-413.318) [-412.569] * (-414.685) (-413.369) (-412.296) [-414.580] -- 0:01:04
99000 -- [-414.942] (-418.347) (-415.193) (-415.176) * (-414.657) (-412.534) [-414.011] (-414.874) -- 0:01:03
99500 -- [-415.033] (-414.007) (-414.395) (-412.337) * (-414.338) (-412.138) [-413.475] (-416.341) -- 0:01:03
100000 -- [-414.800] (-413.737) (-416.334) (-414.664) * [-417.171] (-412.527) (-414.206) (-414.033) -- 0:01:02
Average standard deviation of split frequencies: 0.022634
100500 -- (-413.030) [-415.919] (-416.103) (-414.609) * (-411.853) (-412.082) (-420.171) [-412.960] -- 0:01:02
101000 -- (-413.664) (-415.159) (-414.093) [-413.246] * (-412.557) (-411.971) (-415.189) [-414.914] -- 0:01:02
101500 -- [-419.557] (-413.704) (-414.861) (-416.355) * (-413.586) (-411.963) (-412.231) [-414.446] -- 0:01:01
102000 -- (-417.801) [-412.025] (-415.753) (-415.372) * (-414.441) (-411.963) [-413.257] (-416.709) -- 0:01:01
102500 -- [-415.832] (-414.793) (-414.164) (-416.068) * (-417.183) [-411.998] (-412.920) (-413.966) -- 0:01:01
103000 -- (-416.413) (-413.430) (-412.324) [-412.180] * [-416.044] (-414.131) (-414.322) (-415.217) -- 0:01:00
103500 -- [-416.879] (-414.331) (-415.385) (-417.719) * [-417.074] (-414.921) (-412.818) (-415.568) -- 0:01:00
104000 -- [-411.919] (-413.358) (-413.872) (-418.225) * (-412.616) [-413.832] (-412.335) (-413.189) -- 0:01:00
104500 -- (-414.060) (-414.177) [-413.697] (-421.916) * (-416.108) [-412.105] (-413.858) (-413.175) -- 0:00:59
105000 -- (-413.199) [-413.472] (-412.036) (-416.286) * (-415.974) (-414.655) (-412.225) [-414.951] -- 0:00:59
Average standard deviation of split frequencies: 0.018456
105500 -- (-413.387) (-413.955) [-413.985] (-413.767) * (-414.414) (-415.077) (-414.122) [-412.219] -- 0:00:59
106000 -- (-416.709) (-412.113) (-415.327) [-413.839] * [-418.943] (-421.849) (-415.688) (-413.326) -- 0:00:59
106500 -- (-413.887) (-413.354) (-414.721) [-415.643] * (-417.772) [-413.783] (-415.720) (-412.580) -- 0:00:58
107000 -- [-413.727] (-415.089) (-415.885) (-423.021) * (-414.113) (-416.556) (-414.310) [-414.181] -- 0:00:58
107500 -- (-412.233) (-415.005) [-417.301] (-422.344) * (-414.063) (-412.757) [-414.708] (-414.569) -- 0:00:58
108000 -- [-417.489] (-416.201) (-417.472) (-420.117) * [-413.708] (-414.181) (-414.748) (-413.860) -- 0:00:57
108500 -- (-413.067) [-413.286] (-415.760) (-414.232) * (-415.748) [-415.887] (-415.596) (-411.938) -- 0:00:57
109000 -- (-413.301) [-416.203] (-419.043) (-413.694) * (-412.599) (-414.523) (-416.696) [-413.052] -- 0:00:57
109500 -- [-414.190] (-414.916) (-416.160) (-414.581) * (-412.784) (-412.166) [-412.229] (-415.195) -- 0:00:56
110000 -- (-415.816) [-412.262] (-416.165) (-414.365) * (-412.946) [-411.745] (-413.910) (-415.257) -- 0:00:56
Average standard deviation of split frequencies: 0.014696
110500 -- (-416.856) (-413.162) (-413.235) [-413.715] * (-415.405) (-412.753) (-415.668) [-414.997] -- 0:00:56
111000 -- (-415.700) (-413.184) (-414.204) [-413.586] * (-413.028) [-412.280] (-414.690) (-414.787) -- 0:00:56
111500 -- [-414.153] (-415.268) (-415.662) (-414.346) * (-412.518) (-413.085) [-416.833] (-417.177) -- 0:00:55
112000 -- (-412.598) [-414.813] (-415.359) (-412.182) * (-416.252) (-413.690) (-414.939) [-413.741] -- 0:00:55
112500 -- (-413.817) (-414.809) [-417.270] (-412.334) * [-419.069] (-412.372) (-415.683) (-418.031) -- 0:00:55
113000 -- (-413.480) [-412.829] (-413.712) (-413.980) * (-414.629) (-414.448) [-414.102] (-412.355) -- 0:00:54
113500 -- (-412.545) (-412.767) (-412.680) [-414.568] * (-420.018) [-420.486] (-413.558) (-414.462) -- 0:00:54
114000 -- (-418.832) [-412.354] (-416.159) (-413.406) * (-415.162) (-414.052) [-413.761] (-423.568) -- 0:00:54
114500 -- (-415.003) (-414.267) (-414.144) [-415.931] * (-414.696) [-413.713] (-416.914) (-421.880) -- 0:01:01
115000 -- (-413.696) (-412.179) (-415.212) [-415.615] * [-411.988] (-414.214) (-416.088) (-413.222) -- 0:01:01
Average standard deviation of split frequencies: 0.014330
115500 -- (-415.653) (-413.112) (-413.666) [-417.157] * (-413.068) (-412.069) [-412.703] (-414.669) -- 0:01:01
116000 -- (-413.959) [-415.145] (-412.475) (-415.229) * [-413.118] (-412.939) (-415.293) (-413.660) -- 0:01:00
116500 -- [-414.608] (-415.043) (-413.222) (-414.829) * (-413.503) (-414.289) (-416.667) [-412.334] -- 0:01:00
117000 -- [-414.275] (-416.587) (-413.985) (-414.725) * (-416.781) (-413.700) [-414.529] (-413.008) -- 0:01:00
117500 -- (-412.373) (-413.085) (-414.202) [-415.641] * [-413.417] (-416.117) (-415.016) (-419.838) -- 0:01:00
118000 -- (-412.693) (-416.526) [-414.062] (-415.232) * (-413.276) (-415.613) [-415.705] (-416.912) -- 0:00:59
118500 -- (-412.338) (-414.275) [-414.696] (-421.643) * [-412.960] (-414.716) (-413.894) (-415.700) -- 0:00:59
119000 -- [-412.334] (-414.454) (-417.205) (-416.300) * (-413.105) (-412.300) (-417.808) [-416.761] -- 0:00:59
119500 -- [-414.328] (-415.184) (-413.296) (-412.387) * [-411.959] (-416.819) (-417.527) (-416.492) -- 0:00:58
120000 -- (-416.214) (-413.133) (-413.568) [-414.064] * (-412.135) (-416.034) (-416.338) [-414.147] -- 0:00:58
Average standard deviation of split frequencies: 0.017146
120500 -- (-419.480) (-416.644) [-413.827] (-413.957) * [-412.919] (-418.353) (-415.349) (-418.326) -- 0:00:58
121000 -- (-414.564) (-413.953) [-412.903] (-412.570) * (-414.562) (-415.892) (-413.874) [-413.741] -- 0:00:58
121500 -- (-415.592) (-413.475) (-417.014) [-413.451] * (-421.376) [-415.966] (-416.324) (-415.563) -- 0:00:57
122000 -- (-414.003) (-415.572) [-412.566] (-414.721) * (-414.615) (-413.818) [-416.201] (-414.446) -- 0:00:57
122500 -- (-413.356) (-415.505) (-413.541) [-415.412] * (-414.373) (-412.889) (-416.692) [-415.630] -- 0:00:57
123000 -- [-414.463] (-415.721) (-413.863) (-417.800) * [-412.463] (-412.505) (-412.466) (-412.960) -- 0:00:57
123500 -- (-412.725) (-413.548) [-413.635] (-412.791) * (-416.994) (-413.219) [-412.403] (-413.587) -- 0:00:56
124000 -- (-414.798) [-413.110] (-413.250) (-413.703) * (-421.784) (-416.185) (-413.602) [-412.874] -- 0:00:56
124500 -- (-413.074) [-411.761] (-413.961) (-412.473) * (-416.727) (-415.702) [-412.492] (-414.887) -- 0:00:56
125000 -- (-413.458) [-412.759] (-413.124) (-413.073) * (-413.172) (-414.450) (-412.724) [-413.320] -- 0:00:56
Average standard deviation of split frequencies: 0.017210
125500 -- (-413.521) (-414.652) [-414.808] (-413.013) * (-413.665) (-415.340) [-415.361] (-415.537) -- 0:00:55
126000 -- [-413.338] (-415.158) (-412.688) (-413.273) * (-416.566) (-415.055) (-413.581) [-413.942] -- 0:00:55
126500 -- [-414.041] (-414.511) (-412.266) (-412.876) * (-419.396) (-411.829) [-413.211] (-413.981) -- 0:00:55
127000 -- (-413.562) (-413.171) [-413.707] (-413.035) * (-416.229) (-412.554) (-413.682) [-413.899] -- 0:00:54
127500 -- (-413.306) (-416.473) (-416.135) [-413.072] * [-415.128] (-413.364) (-416.027) (-415.138) -- 0:00:54
128000 -- (-415.821) (-412.926) [-415.773] (-414.888) * (-412.804) (-415.960) [-413.909] (-416.443) -- 0:00:54
128500 -- [-413.722] (-414.459) (-414.034) (-416.830) * (-414.221) [-412.990] (-416.171) (-416.204) -- 0:00:54
129000 -- [-413.474] (-414.116) (-415.506) (-415.299) * (-413.858) [-413.528] (-414.095) (-413.806) -- 0:00:54
129500 -- [-416.433] (-417.584) (-413.593) (-413.133) * (-413.447) (-415.562) [-411.895] (-413.369) -- 0:00:53
130000 -- (-417.371) (-411.759) [-413.753] (-415.307) * [-416.265] (-413.869) (-412.748) (-413.663) -- 0:00:53
Average standard deviation of split frequencies: 0.015633
130500 -- (-417.747) (-413.460) [-412.924] (-413.707) * (-417.336) (-412.891) [-414.869] (-411.953) -- 0:00:53
131000 -- (-414.582) (-412.356) [-413.725] (-413.538) * (-417.434) [-412.683] (-413.943) (-413.481) -- 0:00:53
131500 -- (-417.197) [-414.686] (-417.184) (-414.112) * (-413.297) (-413.839) (-412.560) [-413.228] -- 0:00:52
132000 -- (-414.241) (-412.104) (-414.552) [-414.685] * (-416.499) (-413.207) (-413.851) [-413.152] -- 0:00:59
132500 -- [-413.060] (-416.512) (-413.646) (-412.042) * [-414.124] (-412.796) (-417.741) (-413.153) -- 0:00:58
133000 -- [-413.398] (-415.227) (-413.510) (-418.076) * [-411.876] (-414.235) (-414.776) (-415.510) -- 0:00:58
133500 -- (-413.608) (-413.440) (-414.338) [-413.379] * [-415.890] (-415.429) (-416.374) (-414.918) -- 0:00:58
134000 -- [-413.269] (-413.192) (-415.761) (-413.559) * (-417.593) (-412.685) [-416.097] (-415.819) -- 0:00:58
134500 -- (-414.552) (-414.874) [-415.297] (-415.577) * (-413.685) [-411.885] (-412.733) (-413.503) -- 0:00:57
135000 -- (-416.721) [-413.960] (-413.785) (-412.297) * (-413.289) (-416.975) [-412.591] (-414.902) -- 0:00:57
Average standard deviation of split frequencies: 0.013457
135500 -- [-416.127] (-412.949) (-417.520) (-412.567) * [-415.013] (-416.668) (-413.541) (-414.119) -- 0:00:57
136000 -- (-414.846) (-413.526) (-419.437) [-418.897] * (-415.048) (-418.292) (-412.998) [-412.761] -- 0:00:57
136500 -- (-416.138) (-416.940) (-413.747) [-414.163] * (-414.741) (-415.245) (-412.465) [-415.395] -- 0:00:56
137000 -- (-416.674) [-412.484] (-414.145) (-412.321) * (-414.807) (-412.168) (-414.013) [-412.570] -- 0:00:56
137500 -- (-414.956) (-416.259) [-412.846] (-414.628) * (-413.755) (-414.501) [-412.860] (-415.230) -- 0:00:56
138000 -- (-413.108) (-415.031) [-412.816] (-415.831) * (-415.867) (-412.919) [-413.433] (-415.157) -- 0:00:56
138500 -- [-411.911] (-416.862) (-412.209) (-413.646) * (-417.318) (-412.134) (-420.750) [-413.393] -- 0:00:55
139000 -- (-412.774) (-416.809) [-414.305] (-416.702) * (-413.249) [-412.453] (-415.969) (-413.405) -- 0:00:55
139500 -- (-418.329) (-413.784) [-412.189] (-412.868) * [-412.739] (-411.982) (-412.390) (-413.846) -- 0:00:55
140000 -- (-414.386) [-411.768] (-413.578) (-416.202) * (-416.707) (-413.819) (-415.057) [-417.420] -- 0:00:55
Average standard deviation of split frequencies: 0.014588
140500 -- (-415.191) (-415.351) [-412.443] (-414.009) * (-412.861) (-418.130) [-414.476] (-416.368) -- 0:00:55
141000 -- (-413.532) (-414.654) [-415.697] (-414.105) * (-412.484) (-415.203) [-411.821] (-417.099) -- 0:00:54
141500 -- (-414.725) [-413.483] (-415.737) (-414.763) * (-413.530) (-416.214) [-413.083] (-415.091) -- 0:00:54
142000 -- [-413.927] (-414.902) (-421.680) (-413.247) * (-413.290) (-415.850) (-412.201) [-413.067] -- 0:00:54
142500 -- (-413.942) [-415.442] (-414.885) (-411.893) * (-413.428) (-414.360) [-412.973] (-419.686) -- 0:00:54
143000 -- (-413.930) (-413.821) (-415.873) [-413.138] * (-412.872) (-414.791) [-412.750] (-413.990) -- 0:00:53
143500 -- (-413.560) [-413.454] (-413.828) (-415.133) * (-412.791) (-416.018) [-413.922] (-412.758) -- 0:00:53
144000 -- [-413.823] (-414.276) (-412.936) (-414.679) * (-413.653) (-413.468) [-416.297] (-413.331) -- 0:00:53
144500 -- [-413.000] (-416.064) (-414.959) (-413.378) * (-416.020) (-414.064) [-414.673] (-414.463) -- 0:00:53
145000 -- (-412.168) (-414.720) (-418.352) [-412.684] * (-416.161) [-416.266] (-413.132) (-412.652) -- 0:00:53
Average standard deviation of split frequencies: 0.014625
145500 -- (-413.765) (-416.979) (-413.333) [-414.330] * [-416.832] (-412.907) (-415.555) (-415.068) -- 0:00:52
146000 -- [-412.202] (-413.657) (-412.400) (-415.698) * [-415.876] (-419.867) (-414.510) (-412.799) -- 0:00:52
146500 -- [-416.199] (-412.448) (-416.867) (-414.497) * [-413.158] (-414.029) (-412.794) (-413.732) -- 0:00:52
147000 -- (-417.985) [-415.388] (-412.054) (-417.184) * (-412.283) [-412.446] (-413.116) (-412.737) -- 0:00:52
147500 -- (-414.740) [-414.318] (-414.786) (-413.915) * (-413.223) (-413.285) [-413.305] (-414.511) -- 0:00:52
148000 -- [-413.055] (-412.225) (-415.692) (-414.764) * (-413.599) [-413.087] (-412.406) (-413.583) -- 0:00:51
148500 -- (-413.000) (-413.556) [-413.266] (-416.756) * [-412.784] (-412.457) (-413.893) (-413.282) -- 0:00:51
149000 -- (-412.688) [-414.633] (-414.401) (-412.700) * [-414.510] (-418.546) (-412.987) (-413.321) -- 0:00:57
149500 -- (-412.272) (-418.536) (-417.624) [-412.553] * (-414.594) (-420.594) [-413.511] (-412.439) -- 0:00:56
150000 -- (-412.583) (-420.925) (-414.581) [-412.758] * (-413.353) (-412.910) [-412.865] (-411.720) -- 0:00:56
Average standard deviation of split frequencies: 0.013732
150500 -- (-411.895) (-419.271) (-417.155) [-416.851] * [-414.443] (-412.257) (-415.779) (-412.483) -- 0:00:56
151000 -- [-412.420] (-420.645) (-412.759) (-416.658) * (-414.937) (-417.389) [-413.615] (-415.361) -- 0:00:56
151500 -- (-417.695) (-415.663) (-413.317) [-413.279] * [-412.905] (-413.078) (-413.233) (-412.634) -- 0:00:56
152000 -- (-413.113) (-419.392) [-415.682] (-414.970) * [-414.076] (-414.197) (-416.948) (-412.007) -- 0:00:55
152500 -- (-412.803) [-414.246] (-414.282) (-413.448) * (-416.103) [-416.337] (-415.513) (-413.255) -- 0:00:55
153000 -- [-414.520] (-413.250) (-413.097) (-413.898) * [-413.053] (-413.733) (-413.240) (-414.892) -- 0:00:55
153500 -- [-413.348] (-412.413) (-414.714) (-413.559) * [-412.514] (-414.142) (-413.147) (-413.689) -- 0:00:55
154000 -- [-414.971] (-414.720) (-415.476) (-413.658) * [-412.727] (-415.154) (-419.896) (-412.701) -- 0:00:54
154500 -- (-412.372) (-411.723) [-414.759] (-416.519) * (-413.185) [-412.420] (-412.198) (-412.985) -- 0:00:54
155000 -- (-412.745) (-411.835) [-413.781] (-413.737) * (-413.066) [-415.864] (-413.206) (-412.467) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
155500 -- (-413.017) (-413.545) [-412.352] (-413.616) * [-412.426] (-415.034) (-413.204) (-414.859) -- 0:00:54
156000 -- (-414.343) [-414.849] (-413.297) (-416.322) * (-411.995) [-415.258] (-414.521) (-413.055) -- 0:00:54
156500 -- (-415.477) (-414.404) (-414.266) [-412.416] * (-418.049) (-415.857) (-415.707) [-415.960] -- 0:00:53
157000 -- (-413.696) (-411.845) [-413.508] (-415.205) * [-412.362] (-415.088) (-414.221) (-413.190) -- 0:00:53
157500 -- (-413.437) (-416.075) [-413.079] (-415.818) * (-414.000) [-413.757] (-413.017) (-415.656) -- 0:00:53
158000 -- (-414.321) (-414.121) [-412.974] (-412.378) * (-418.858) (-412.671) [-413.078] (-413.404) -- 0:00:53
158500 -- [-413.278] (-416.387) (-415.344) (-418.653) * (-412.073) (-412.619) (-411.700) [-413.503] -- 0:00:53
159000 -- (-414.684) (-412.551) (-414.910) [-412.167] * (-413.858) (-415.955) [-413.197] (-412.231) -- 0:00:52
159500 -- (-414.139) (-412.552) [-417.390] (-412.946) * (-413.526) (-413.292) [-412.288] (-414.947) -- 0:00:52
160000 -- (-412.451) [-412.093] (-413.896) (-420.066) * [-415.485] (-414.127) (-414.574) (-414.999) -- 0:00:52
Average standard deviation of split frequencies: 0.011736
160500 -- (-414.076) (-413.887) [-412.786] (-411.953) * [-414.267] (-413.114) (-413.724) (-414.545) -- 0:00:52
161000 -- [-412.702] (-413.369) (-412.991) (-413.951) * (-415.947) (-413.145) [-415.793] (-413.655) -- 0:00:52
161500 -- (-411.974) (-413.466) (-412.626) [-413.580] * (-412.583) (-413.274) [-416.007] (-416.442) -- 0:00:51
162000 -- (-412.577) (-414.198) [-413.547] (-413.363) * (-412.307) (-416.351) [-414.736] (-416.407) -- 0:00:51
162500 -- [-415.254] (-413.827) (-416.407) (-413.842) * (-413.029) [-415.136] (-417.178) (-412.758) -- 0:00:51
163000 -- [-412.197] (-413.376) (-412.830) (-415.237) * (-417.446) (-415.066) (-413.938) [-413.651] -- 0:00:51
163500 -- (-413.973) (-413.065) (-416.271) [-415.565] * (-415.577) (-412.830) (-415.122) [-412.710] -- 0:00:51
164000 -- (-417.421) [-414.006] (-412.960) (-412.649) * [-413.944] (-412.542) (-412.031) (-412.147) -- 0:00:50
164500 -- (-413.540) (-412.499) [-415.914] (-412.178) * (-418.665) (-414.885) [-416.947] (-413.293) -- 0:00:50
165000 -- [-413.612] (-415.882) (-414.324) (-414.122) * (-416.186) (-413.709) (-414.013) [-412.356] -- 0:00:50
Average standard deviation of split frequencies: 0.013003
165500 -- (-413.001) (-417.597) [-411.975] (-413.246) * [-412.950] (-413.998) (-413.480) (-412.655) -- 0:00:50
166000 -- [-413.998] (-415.542) (-412.846) (-413.828) * (-412.985) [-419.341] (-413.574) (-414.236) -- 0:00:55
166500 -- (-415.481) (-413.114) (-414.177) [-413.965] * [-412.772] (-415.204) (-413.731) (-419.791) -- 0:00:55
167000 -- (-416.395) (-413.618) (-414.168) [-415.774] * (-414.088) (-413.733) [-412.813] (-416.938) -- 0:00:54
167500 -- (-413.358) (-411.769) (-415.248) [-413.809] * (-414.338) (-413.150) (-412.015) [-418.462] -- 0:00:54
168000 -- (-412.660) [-413.042] (-414.964) (-412.588) * [-413.648] (-418.021) (-411.953) (-412.574) -- 0:00:54
168500 -- (-416.791) (-412.613) (-412.369) [-412.453] * (-414.384) (-415.199) (-412.115) [-414.074] -- 0:00:54
169000 -- [-414.361] (-412.271) (-412.298) (-415.261) * (-416.509) [-414.500] (-413.432) (-414.919) -- 0:00:54
169500 -- [-413.237] (-413.817) (-416.706) (-416.994) * [-415.021] (-415.086) (-414.991) (-414.578) -- 0:00:53
170000 -- (-412.450) (-413.896) [-411.821] (-416.157) * (-413.320) (-412.153) (-412.395) [-413.188] -- 0:00:53
Average standard deviation of split frequencies: 0.013375
170500 -- (-412.435) (-416.693) (-411.950) [-412.603] * (-414.105) [-412.208] (-416.861) (-414.204) -- 0:00:53
171000 -- (-412.262) [-414.821] (-415.840) (-418.398) * (-414.133) [-413.083] (-414.746) (-412.776) -- 0:00:53
171500 -- (-411.971) (-413.438) (-413.144) [-415.025] * (-413.556) (-414.070) [-415.578] (-414.272) -- 0:00:53
172000 -- (-414.780) (-413.929) (-412.551) [-414.877] * [-414.721] (-412.445) (-415.239) (-414.895) -- 0:00:52
172500 -- (-413.725) (-413.491) [-413.319] (-416.327) * [-414.980] (-413.565) (-416.603) (-412.480) -- 0:00:52
173000 -- (-414.863) (-412.826) [-413.231] (-417.263) * (-414.970) (-413.983) [-412.638] (-415.801) -- 0:00:52
173500 -- (-415.001) (-414.187) [-413.265] (-413.325) * [-418.039] (-415.628) (-413.409) (-414.795) -- 0:00:52
174000 -- [-412.194] (-415.805) (-413.718) (-413.024) * (-415.013) (-413.547) (-413.999) [-413.498] -- 0:00:52
174500 -- (-413.433) (-413.862) [-413.703] (-412.872) * (-416.533) (-413.138) [-413.702] (-414.358) -- 0:00:52
175000 -- (-414.314) [-413.368] (-412.879) (-416.018) * (-413.800) (-412.150) (-414.511) [-415.236] -- 0:00:51
Average standard deviation of split frequencies: 0.010996
175500 -- (-414.593) [-412.322] (-413.647) (-415.261) * (-413.865) (-412.480) (-416.974) [-414.857] -- 0:00:51
176000 -- (-412.095) (-412.457) (-413.623) [-413.720] * (-413.961) (-417.800) (-412.366) [-413.238] -- 0:00:51
176500 -- (-412.342) (-411.991) (-412.108) [-413.231] * (-416.206) (-416.906) [-413.322] (-413.073) -- 0:00:51
177000 -- (-414.754) (-412.629) (-414.034) [-415.147] * (-413.172) [-413.223] (-412.298) (-414.231) -- 0:00:51
177500 -- (-414.036) (-417.537) (-413.124) [-413.087] * (-413.192) [-412.887] (-414.748) (-412.507) -- 0:00:50
178000 -- (-420.778) [-413.628] (-414.210) (-414.931) * (-412.340) (-413.832) (-414.189) [-413.356] -- 0:00:50
178500 -- [-417.593] (-414.318) (-416.837) (-416.724) * (-413.982) [-412.456] (-414.635) (-417.703) -- 0:00:50
179000 -- (-413.246) (-414.152) (-414.394) [-420.348] * (-414.110) (-414.982) [-413.611] (-415.205) -- 0:00:50
179500 -- [-416.021] (-412.088) (-415.535) (-415.029) * [-412.581] (-413.372) (-413.162) (-416.260) -- 0:00:50
180000 -- (-419.285) [-411.695] (-414.655) (-412.703) * (-415.376) (-413.087) [-411.946] (-417.424) -- 0:00:50
Average standard deviation of split frequencies: 0.011261
180500 -- (-416.093) [-413.245] (-414.736) (-416.210) * [-414.046] (-412.323) (-413.556) (-415.710) -- 0:00:49
181000 -- (-416.596) (-413.234) [-412.921] (-414.353) * (-413.606) (-413.188) [-414.786] (-413.575) -- 0:00:49
181500 -- (-412.221) [-413.369] (-412.998) (-416.854) * [-414.740] (-415.410) (-417.128) (-414.276) -- 0:00:49
182000 -- (-413.256) (-413.233) [-415.737] (-415.595) * [-413.422] (-417.144) (-414.402) (-413.681) -- 0:00:49
182500 -- [-412.624] (-419.658) (-413.628) (-415.782) * [-412.823] (-413.662) (-415.471) (-413.466) -- 0:00:49
183000 -- (-412.761) (-417.382) (-412.800) [-419.946] * (-414.183) (-412.420) [-412.800] (-413.672) -- 0:00:53
183500 -- [-413.752] (-413.788) (-415.139) (-415.058) * (-414.212) (-414.314) (-413.150) [-414.300] -- 0:00:53
184000 -- [-412.925] (-412.391) (-419.546) (-412.715) * (-413.800) (-417.497) (-413.034) [-415.347] -- 0:00:53
184500 -- (-413.911) (-413.862) (-420.713) [-415.191] * [-412.152] (-416.876) (-416.759) (-413.185) -- 0:00:53
185000 -- (-414.370) (-415.014) (-416.616) [-414.275] * (-413.249) (-412.449) (-418.279) [-415.433] -- 0:00:52
Average standard deviation of split frequencies: 0.011785
185500 -- [-415.101] (-418.483) (-414.207) (-413.736) * [-411.972] (-414.095) (-417.460) (-414.176) -- 0:00:52
186000 -- (-413.288) [-411.824] (-415.223) (-412.962) * (-415.338) [-412.023] (-413.785) (-414.163) -- 0:00:52
186500 -- (-414.611) (-411.519) (-414.931) [-412.521] * (-416.675) [-412.008] (-416.372) (-413.511) -- 0:00:52
187000 -- (-413.715) [-414.426] (-412.658) (-414.112) * (-412.473) (-414.532) (-412.852) [-412.720] -- 0:00:52
187500 -- [-412.374] (-413.460) (-417.236) (-414.735) * [-416.131] (-414.886) (-414.403) (-412.610) -- 0:00:52
188000 -- (-411.885) (-412.555) [-415.154] (-416.464) * (-413.520) (-416.503) [-415.473] (-415.281) -- 0:00:51
188500 -- (-413.300) (-412.236) (-415.287) [-415.888] * (-414.864) (-415.237) [-413.285] (-416.779) -- 0:00:51
189000 -- [-413.773] (-412.713) (-418.606) (-413.746) * (-419.482) (-413.672) [-415.228] (-413.614) -- 0:00:51
189500 -- (-412.514) (-412.205) (-412.533) [-412.952] * (-414.323) (-415.899) [-415.421] (-413.964) -- 0:00:51
190000 -- [-413.516] (-413.415) (-413.070) (-414.389) * (-411.987) (-414.246) (-415.074) [-412.795] -- 0:00:51
Average standard deviation of split frequencies: 0.010478
190500 -- (-414.408) [-415.766] (-413.635) (-415.430) * (-412.224) (-415.026) (-415.444) [-413.239] -- 0:00:50
191000 -- (-413.562) [-416.812] (-420.378) (-412.581) * (-412.573) (-413.780) [-416.832] (-414.816) -- 0:00:50
191500 -- (-416.457) [-413.537] (-413.214) (-411.496) * (-412.321) [-413.370] (-412.559) (-412.546) -- 0:00:50
192000 -- (-414.365) (-415.134) (-414.045) [-415.101] * [-412.837] (-413.621) (-414.136) (-414.323) -- 0:00:50
192500 -- (-413.009) (-416.600) [-416.677] (-413.395) * (-413.394) (-412.091) [-415.463] (-412.851) -- 0:00:50
193000 -- [-411.752] (-415.091) (-412.606) (-413.992) * (-415.393) [-413.529] (-420.338) (-411.764) -- 0:00:50
193500 -- (-412.613) (-413.135) (-417.113) [-414.655] * (-412.297) (-412.335) [-415.974] (-414.374) -- 0:00:50
194000 -- (-413.023) (-414.206) [-413.767] (-414.347) * [-412.171] (-419.213) (-412.476) (-415.400) -- 0:00:49
194500 -- (-412.795) (-414.986) (-413.548) [-412.500] * (-412.081) (-413.111) [-414.518] (-413.905) -- 0:00:49
195000 -- [-413.052] (-414.116) (-413.338) (-412.064) * (-413.225) [-412.081] (-418.014) (-412.839) -- 0:00:49
Average standard deviation of split frequencies: 0.010537
195500 -- (-414.504) (-414.818) (-415.794) [-411.862] * (-413.628) (-411.648) [-413.986] (-415.037) -- 0:00:49
196000 -- [-413.037] (-414.031) (-412.890) (-413.746) * [-417.064] (-413.763) (-415.551) (-414.096) -- 0:00:49
196500 -- (-413.387) (-414.307) [-412.910] (-412.629) * (-414.495) (-411.995) [-412.785] (-412.642) -- 0:00:49
197000 -- [-415.045] (-420.636) (-413.416) (-416.302) * (-415.699) [-412.560] (-412.908) (-414.513) -- 0:00:48
197500 -- (-413.231) (-416.703) (-413.503) [-415.731] * [-413.701] (-413.568) (-413.725) (-413.505) -- 0:00:48
198000 -- (-415.263) [-412.821] (-414.127) (-417.739) * (-412.790) [-413.599] (-413.341) (-415.892) -- 0:00:48
198500 -- (-416.451) (-417.265) [-412.547] (-414.064) * (-412.978) [-422.903] (-413.002) (-415.773) -- 0:00:48
199000 -- (-419.579) (-418.512) (-414.779) [-414.505] * (-413.248) (-416.649) (-412.923) [-413.172] -- 0:00:48
199500 -- (-416.413) (-415.757) [-412.365] (-416.230) * (-417.232) (-417.349) [-412.482] (-415.372) -- 0:00:48
200000 -- [-412.055] (-412.375) (-413.321) (-413.030) * (-416.877) (-415.480) [-413.800] (-415.179) -- 0:00:48
Average standard deviation of split frequencies: 0.011499
200500 -- (-412.378) [-414.754] (-417.374) (-412.294) * (-416.436) (-413.297) (-412.222) [-415.089] -- 0:00:51
201000 -- (-412.944) [-415.361] (-414.259) (-415.109) * (-412.640) (-412.192) (-413.638) [-416.404] -- 0:00:51
201500 -- (-415.800) (-413.686) (-415.578) [-416.014] * [-414.132] (-411.922) (-412.976) (-412.248) -- 0:00:51
202000 -- (-417.559) (-414.893) [-412.588] (-412.864) * [-413.163] (-416.641) (-416.950) (-417.628) -- 0:00:51
202500 -- (-414.409) [-412.885] (-414.645) (-413.000) * [-416.196] (-412.360) (-411.945) (-413.397) -- 0:00:51
203000 -- (-413.908) [-413.979] (-413.180) (-414.540) * [-413.137] (-413.935) (-412.535) (-420.052) -- 0:00:51
203500 -- (-413.163) (-420.601) (-413.242) [-413.613] * [-413.715] (-412.674) (-413.558) (-421.846) -- 0:00:50
204000 -- [-413.666] (-415.604) (-412.641) (-414.689) * (-413.238) (-414.764) (-414.570) [-412.298] -- 0:00:50
204500 -- [-412.910] (-417.762) (-412.711) (-413.355) * (-419.354) [-414.068] (-412.776) (-412.935) -- 0:00:50
205000 -- (-413.089) (-416.332) [-414.140] (-413.538) * [-416.580] (-413.776) (-414.491) (-415.421) -- 0:00:50
Average standard deviation of split frequencies: 0.011327
205500 -- (-415.290) (-413.873) (-413.143) [-413.920] * [-413.134] (-416.187) (-415.488) (-414.170) -- 0:00:50
206000 -- (-415.651) [-412.518] (-412.956) (-415.830) * (-412.017) (-414.253) (-414.226) [-415.094] -- 0:00:50
206500 -- (-412.552) [-416.354] (-415.960) (-417.116) * (-413.384) (-411.600) (-413.791) [-416.976] -- 0:00:49
207000 -- (-414.660) [-411.985] (-412.804) (-412.621) * (-412.797) (-417.655) (-412.747) [-415.892] -- 0:00:49
207500 -- (-413.722) (-415.805) (-413.079) [-416.729] * (-412.228) (-412.379) (-412.503) [-412.208] -- 0:00:49
208000 -- (-415.165) (-414.890) (-416.417) [-414.483] * [-412.755] (-413.343) (-412.542) (-414.456) -- 0:00:49
208500 -- [-413.039] (-413.432) (-413.437) (-413.123) * [-413.980] (-413.955) (-416.184) (-412.155) -- 0:00:49
209000 -- [-412.740] (-413.678) (-416.545) (-413.855) * [-414.481] (-414.701) (-415.265) (-412.582) -- 0:00:49
209500 -- (-412.980) (-413.012) [-412.249] (-411.879) * (-416.771) (-413.524) (-418.907) [-414.330] -- 0:00:49
210000 -- [-412.235] (-416.426) (-414.880) (-412.563) * (-414.815) (-413.131) (-417.445) [-413.932] -- 0:00:48
Average standard deviation of split frequencies: 0.011071
210500 -- [-413.038] (-416.428) (-415.454) (-414.859) * (-414.029) [-412.306] (-419.948) (-414.076) -- 0:00:48
211000 -- (-414.636) (-414.421) (-413.379) [-414.484] * (-412.678) [-411.909] (-414.465) (-414.534) -- 0:00:48
211500 -- (-413.858) [-412.985] (-412.592) (-412.253) * (-413.434) [-413.828] (-414.714) (-414.692) -- 0:00:48
212000 -- (-414.301) (-413.006) [-412.413] (-412.843) * (-414.986) [-413.269] (-416.376) (-414.332) -- 0:00:48
212500 -- (-412.255) (-415.824) (-413.764) [-412.926] * [-414.434] (-417.720) (-415.693) (-413.266) -- 0:00:48
213000 -- (-414.834) (-414.666) (-419.028) [-412.942] * (-414.497) (-414.415) (-417.998) [-414.178] -- 0:00:48
213500 -- (-419.604) (-417.814) [-412.932] (-416.522) * (-413.997) [-412.661] (-417.755) (-412.147) -- 0:00:47
214000 -- (-416.301) (-416.968) [-411.812] (-413.255) * (-414.510) (-415.155) [-414.813] (-415.041) -- 0:00:47
214500 -- (-415.959) [-412.692] (-412.283) (-413.045) * (-414.002) [-413.384] (-413.513) (-412.327) -- 0:00:47
215000 -- (-414.716) [-417.888] (-412.610) (-413.191) * (-413.586) [-416.362] (-412.825) (-413.074) -- 0:00:47
Average standard deviation of split frequencies: 0.010791
215500 -- (-412.652) (-413.541) (-414.484) [-412.950] * [-415.530] (-413.310) (-414.572) (-413.958) -- 0:00:47
216000 -- [-413.533] (-415.238) (-413.414) (-414.922) * (-413.737) [-411.856] (-414.607) (-413.318) -- 0:00:47
216500 -- (-412.358) (-415.639) [-412.502] (-414.318) * (-412.610) (-412.035) [-415.839] (-412.632) -- 0:00:47
217000 -- (-412.739) (-412.687) (-420.728) [-414.399] * (-412.556) (-413.159) [-411.906] (-417.118) -- 0:00:46
217500 -- (-414.495) [-413.446] (-417.036) (-412.562) * (-414.170) [-413.534] (-415.375) (-415.401) -- 0:00:50
218000 -- [-413.165] (-413.385) (-417.332) (-412.274) * (-417.643) [-411.705] (-415.741) (-413.743) -- 0:00:50
218500 -- [-412.625] (-413.705) (-416.800) (-411.577) * [-413.906] (-414.041) (-415.222) (-413.578) -- 0:00:50
219000 -- [-413.904] (-414.810) (-417.224) (-414.591) * (-413.393) (-415.124) [-414.912] (-417.177) -- 0:00:49
219500 -- (-412.221) [-413.974] (-415.392) (-412.162) * (-415.123) [-415.423] (-412.616) (-417.035) -- 0:00:49
220000 -- (-411.861) (-415.443) (-416.048) [-413.773] * (-415.902) (-412.862) (-414.156) [-412.631] -- 0:00:49
Average standard deviation of split frequencies: 0.010800
220500 -- (-412.145) (-415.028) (-414.871) [-415.371] * (-415.024) (-413.153) [-412.701] (-415.077) -- 0:00:49
221000 -- (-413.939) [-412.147] (-416.420) (-413.138) * (-412.814) (-413.701) (-417.981) [-416.361] -- 0:00:49
221500 -- (-413.114) [-412.256] (-417.168) (-413.150) * (-414.017) (-411.539) [-413.498] (-415.540) -- 0:00:49
222000 -- [-413.080] (-414.107) (-414.589) (-416.052) * (-413.869) [-414.163] (-413.150) (-413.899) -- 0:00:49
222500 -- (-414.995) [-413.147] (-417.404) (-412.610) * (-418.524) (-412.806) [-412.939] (-413.081) -- 0:00:48
223000 -- [-414.473] (-418.729) (-418.678) (-416.474) * [-413.541] (-412.389) (-414.878) (-414.064) -- 0:00:48
223500 -- (-413.351) (-413.872) [-414.514] (-416.159) * (-414.302) (-412.143) (-413.420) [-416.565] -- 0:00:48
224000 -- (-414.279) [-414.288] (-416.256) (-412.206) * (-414.345) [-413.019] (-416.146) (-413.104) -- 0:00:48
224500 -- (-419.183) (-412.731) (-418.933) [-413.007] * (-412.944) (-413.627) [-416.751] (-412.396) -- 0:00:48
225000 -- (-414.554) [-419.742] (-413.798) (-414.839) * (-418.499) [-415.299] (-413.684) (-412.373) -- 0:00:48
Average standard deviation of split frequencies: 0.012076
225500 -- (-413.289) (-418.139) [-413.491] (-414.196) * (-414.905) [-413.193] (-413.385) (-412.241) -- 0:00:48
226000 -- (-415.466) (-418.696) [-413.177] (-413.438) * [-414.280] (-413.674) (-413.308) (-413.755) -- 0:00:47
226500 -- (-412.093) [-412.570] (-414.670) (-414.868) * [-415.114] (-417.592) (-413.730) (-413.095) -- 0:00:47
227000 -- [-413.462] (-413.550) (-413.802) (-413.019) * [-415.354] (-414.097) (-414.451) (-414.348) -- 0:00:47
227500 -- [-415.753] (-414.432) (-415.518) (-412.553) * [-413.877] (-416.372) (-412.440) (-414.219) -- 0:00:47
228000 -- (-413.256) (-413.211) [-412.805] (-413.541) * [-415.075] (-414.695) (-412.395) (-416.672) -- 0:00:47
228500 -- (-414.428) (-413.949) (-412.398) [-412.461] * [-413.980] (-412.295) (-412.345) (-415.463) -- 0:00:47
229000 -- (-415.671) (-411.929) (-412.283) [-412.034] * (-417.653) (-414.191) (-413.775) [-412.223] -- 0:00:47
229500 -- (-415.458) [-413.015] (-416.613) (-412.418) * (-413.982) (-412.545) [-413.825] (-412.911) -- 0:00:47
230000 -- (-415.002) (-413.105) (-413.891) [-412.478] * [-413.838] (-415.854) (-413.054) (-413.934) -- 0:00:46
Average standard deviation of split frequencies: 0.012376
230500 -- (-414.493) [-413.258] (-414.776) (-412.864) * [-412.896] (-413.109) (-415.757) (-416.556) -- 0:00:46
231000 -- (-413.997) (-413.507) (-419.294) [-412.594] * [-412.793] (-413.911) (-413.032) (-413.950) -- 0:00:46
231500 -- (-417.114) (-413.000) (-415.173) [-412.654] * (-412.913) [-412.266] (-413.972) (-413.621) -- 0:00:46
232000 -- (-414.627) [-413.069] (-412.657) (-412.337) * (-412.567) [-411.941] (-416.255) (-412.725) -- 0:00:46
232500 -- (-413.230) (-415.751) [-412.841] (-413.453) * [-412.223] (-414.801) (-412.207) (-416.864) -- 0:00:46
233000 -- [-412.426] (-413.687) (-414.514) (-413.790) * [-415.119] (-419.178) (-412.666) (-415.449) -- 0:00:46
233500 -- (-415.669) (-414.607) (-415.816) [-412.606] * (-415.080) [-413.505] (-412.381) (-414.813) -- 0:00:45
234000 -- [-414.958] (-413.548) (-418.456) (-416.121) * (-413.110) (-412.917) (-412.511) [-414.009] -- 0:00:45
234500 -- (-414.673) (-413.296) (-419.177) [-417.814] * (-412.621) (-411.709) [-415.310] (-414.455) -- 0:00:48
235000 -- (-413.909) (-422.156) [-414.413] (-415.713) * (-411.934) (-415.037) [-413.017] (-412.239) -- 0:00:48
Average standard deviation of split frequencies: 0.011763
235500 -- [-417.794] (-416.549) (-414.799) (-411.837) * (-419.288) (-412.634) [-412.627] (-414.538) -- 0:00:48
236000 -- (-417.352) (-413.066) [-414.124] (-411.852) * (-413.836) [-416.739] (-413.993) (-412.297) -- 0:00:48
236500 -- [-414.069] (-413.629) (-412.843) (-415.390) * (-417.816) [-412.180] (-417.581) (-417.136) -- 0:00:48
237000 -- [-412.340] (-412.705) (-415.189) (-413.894) * (-413.874) [-412.714] (-412.956) (-412.988) -- 0:00:48
237500 -- (-414.240) (-413.441) (-422.080) [-412.076] * (-414.837) (-413.753) (-412.446) [-413.653] -- 0:00:48
238000 -- [-413.583] (-414.071) (-414.473) (-413.813) * (-414.295) [-413.423] (-412.114) (-416.366) -- 0:00:48
238500 -- (-415.058) [-412.118] (-416.055) (-413.148) * [-413.437] (-414.417) (-414.470) (-414.656) -- 0:00:47
239000 -- (-413.221) [-413.072] (-421.168) (-413.761) * (-416.626) [-413.794] (-416.316) (-411.774) -- 0:00:47
239500 -- (-412.508) (-413.599) (-420.543) [-414.478] * (-414.418) (-413.264) (-413.083) [-413.824] -- 0:00:47
240000 -- (-414.396) (-413.701) (-418.050) [-412.947] * (-413.741) (-414.470) (-415.105) [-412.400] -- 0:00:47
Average standard deviation of split frequencies: 0.013385
240500 -- (-415.482) (-413.755) (-412.063) [-413.167] * (-412.762) (-416.979) [-412.219] (-411.825) -- 0:00:47
241000 -- (-412.890) (-411.998) (-412.249) [-417.618] * (-418.488) (-417.285) [-415.004] (-414.007) -- 0:00:47
241500 -- (-414.682) (-412.795) (-413.705) [-415.503] * [-419.825] (-412.798) (-416.972) (-419.002) -- 0:00:47
242000 -- [-416.321] (-413.630) (-415.687) (-415.928) * (-414.177) (-413.232) (-413.864) [-418.643] -- 0:00:46
242500 -- (-418.754) [-412.111] (-412.560) (-413.897) * (-418.016) (-413.134) (-413.145) [-412.039] -- 0:00:46
243000 -- [-413.808] (-414.426) (-413.269) (-413.812) * (-415.369) [-414.798] (-414.263) (-414.490) -- 0:00:46
243500 -- (-412.682) (-414.595) (-414.631) [-413.024] * (-415.811) (-417.854) (-415.672) [-414.790] -- 0:00:46
244000 -- (-415.856) (-412.702) (-416.613) [-413.962] * (-412.471) [-413.884] (-416.128) (-416.105) -- 0:00:46
244500 -- (-411.983) (-414.666) [-411.565] (-413.793) * (-413.337) [-414.276] (-416.002) (-414.923) -- 0:00:46
245000 -- [-412.706] (-419.877) (-413.365) (-417.078) * (-411.769) (-413.303) [-411.712] (-415.028) -- 0:00:46
Average standard deviation of split frequencies: 0.013307
245500 -- (-413.477) [-414.811] (-415.234) (-412.918) * (-412.326) [-413.008] (-412.554) (-419.349) -- 0:00:46
246000 -- (-411.944) [-413.467] (-416.468) (-414.710) * (-412.221) (-415.057) (-413.623) [-413.026] -- 0:00:45
246500 -- [-412.276] (-414.686) (-417.355) (-418.087) * [-413.443] (-413.225) (-412.098) (-412.368) -- 0:00:45
247000 -- (-415.757) (-416.352) (-413.474) [-416.678] * (-415.689) (-414.906) [-413.349] (-412.778) -- 0:00:45
247500 -- (-415.715) (-413.394) [-415.905] (-415.694) * (-417.510) (-414.486) [-413.855] (-414.177) -- 0:00:45
248000 -- [-414.019] (-413.101) (-415.513) (-416.997) * (-415.706) (-412.831) [-414.064] (-412.341) -- 0:00:45
248500 -- (-414.242) (-414.122) (-413.484) [-415.260] * (-411.865) (-412.145) [-414.614] (-414.818) -- 0:00:45
249000 -- (-415.542) (-416.103) [-413.509] (-415.872) * (-417.064) (-413.869) (-412.982) [-414.250] -- 0:00:45
249500 -- (-414.598) (-415.927) [-414.100] (-418.511) * (-413.258) [-415.617] (-413.181) (-415.260) -- 0:00:45
250000 -- (-417.617) (-416.348) (-413.116) [-412.834] * (-414.995) [-414.695] (-413.418) (-414.599) -- 0:00:45
Average standard deviation of split frequencies: 0.011837
250500 -- (-414.214) (-412.619) (-415.562) [-413.111] * (-415.211) (-416.457) (-413.698) [-412.880] -- 0:00:44
251000 -- (-416.919) (-413.340) [-415.920] (-411.850) * [-413.888] (-416.572) (-411.933) (-413.000) -- 0:00:44
251500 -- (-415.007) (-414.323) (-416.269) [-415.431] * (-416.427) (-414.809) [-412.403] (-415.867) -- 0:00:47
252000 -- (-413.334) [-416.290] (-413.330) (-412.775) * (-412.860) (-412.475) [-411.850] (-413.295) -- 0:00:47
252500 -- (-417.322) (-414.756) [-414.200] (-413.873) * [-414.466] (-414.041) (-414.874) (-413.545) -- 0:00:47
253000 -- [-414.873] (-412.926) (-417.711) (-415.357) * [-419.609] (-414.662) (-413.668) (-412.581) -- 0:00:47
253500 -- (-412.830) (-414.684) (-412.499) [-414.111] * (-418.394) [-415.312] (-415.355) (-413.563) -- 0:00:47
254000 -- (-414.649) (-414.689) (-414.733) [-415.014] * [-416.955] (-415.277) (-412.507) (-415.718) -- 0:00:46
254500 -- (-414.919) (-417.788) (-413.843) [-415.476] * (-415.438) [-418.469] (-412.979) (-416.049) -- 0:00:46
255000 -- (-414.742) [-415.436] (-412.879) (-421.904) * (-417.533) [-412.864] (-413.097) (-414.441) -- 0:00:46
Average standard deviation of split frequencies: 0.014322
255500 -- (-418.365) (-413.916) [-412.252] (-413.819) * (-413.796) (-414.674) (-414.197) [-413.709] -- 0:00:46
256000 -- (-416.165) [-412.507] (-412.081) (-412.659) * (-412.678) (-411.912) (-413.584) [-415.808] -- 0:00:46
256500 -- (-414.229) (-413.980) (-413.192) [-412.886] * (-412.320) (-414.842) (-417.448) [-413.449] -- 0:00:46
257000 -- (-421.193) (-414.925) [-412.657] (-413.561) * (-414.089) [-416.260] (-415.284) (-417.597) -- 0:00:46
257500 -- [-419.080] (-413.028) (-417.324) (-415.456) * [-413.446] (-412.076) (-419.151) (-412.899) -- 0:00:46
258000 -- (-413.056) (-414.032) [-414.245] (-416.689) * (-414.577) (-413.319) (-416.418) [-413.914] -- 0:00:46
258500 -- (-413.104) (-412.505) [-418.042] (-415.834) * (-411.889) [-412.118] (-415.053) (-419.156) -- 0:00:45
259000 -- (-416.355) (-412.811) (-413.320) [-416.785] * (-416.741) [-413.907] (-414.123) (-421.392) -- 0:00:45
259500 -- (-414.828) (-413.691) [-415.082] (-415.184) * (-414.671) [-414.522] (-412.732) (-416.972) -- 0:00:45
260000 -- (-412.772) (-414.061) [-412.716] (-414.605) * [-416.255] (-412.419) (-415.264) (-413.625) -- 0:00:45
Average standard deviation of split frequencies: 0.015171
260500 -- [-416.589] (-412.076) (-414.464) (-415.538) * [-413.231] (-412.472) (-413.828) (-413.127) -- 0:00:45
261000 -- (-419.109) [-413.668] (-414.083) (-413.125) * (-412.178) [-411.929] (-413.467) (-419.864) -- 0:00:45
261500 -- (-415.821) (-414.285) (-416.978) [-416.249] * (-417.636) [-412.120] (-418.132) (-413.440) -- 0:00:45
262000 -- (-417.173) (-418.730) [-415.055] (-413.354) * (-412.988) [-414.085] (-416.723) (-415.311) -- 0:00:45
262500 -- (-417.716) (-416.273) [-414.152] (-417.009) * [-412.313] (-416.782) (-412.411) (-413.721) -- 0:00:44
263000 -- (-414.380) (-419.608) [-412.872] (-413.740) * (-414.870) [-414.264] (-413.207) (-411.857) -- 0:00:44
263500 -- (-411.875) (-414.387) [-411.918] (-416.837) * [-416.668] (-412.794) (-412.465) (-413.237) -- 0:00:44
264000 -- (-414.711) (-414.654) [-413.912] (-414.509) * (-416.158) [-413.037] (-412.172) (-413.266) -- 0:00:44
264500 -- (-416.188) (-421.764) [-411.615] (-415.595) * [-416.046] (-415.731) (-412.243) (-412.898) -- 0:00:44
265000 -- (-417.297) [-412.967] (-412.816) (-415.339) * [-418.011] (-417.034) (-412.738) (-414.546) -- 0:00:44
Average standard deviation of split frequencies: 0.013784
265500 -- [-412.662] (-419.202) (-413.280) (-414.441) * [-413.561] (-416.592) (-412.901) (-419.685) -- 0:00:44
266000 -- (-413.250) (-413.341) [-416.315] (-412.805) * (-415.585) [-413.783] (-414.453) (-415.282) -- 0:00:44
266500 -- [-413.751] (-411.893) (-413.351) (-412.793) * (-415.619) [-415.063] (-414.212) (-412.972) -- 0:00:44
267000 -- [-412.499] (-416.547) (-413.095) (-415.934) * (-415.326) (-412.557) (-414.386) [-415.602] -- 0:00:43
267500 -- (-414.324) [-414.982] (-412.204) (-414.659) * (-412.641) (-414.057) (-415.893) [-414.696] -- 0:00:43
268000 -- [-414.368] (-416.495) (-415.821) (-415.549) * (-413.000) (-412.788) [-414.559] (-416.567) -- 0:00:43
268500 -- [-411.696] (-414.335) (-413.852) (-416.287) * (-413.489) (-412.643) (-415.098) [-412.855] -- 0:00:46
269000 -- (-414.272) (-416.466) [-413.625] (-416.524) * (-411.914) (-414.201) (-414.338) [-414.145] -- 0:00:46
269500 -- (-415.284) (-413.083) (-415.394) [-414.089] * (-412.594) (-412.582) (-413.103) [-418.921] -- 0:00:46
270000 -- (-412.147) (-412.728) (-413.081) [-412.758] * [-414.129] (-413.810) (-412.042) (-413.528) -- 0:00:45
Average standard deviation of split frequencies: 0.014997
270500 -- (-413.639) (-413.303) (-414.318) [-417.760] * [-412.037] (-414.222) (-412.353) (-412.170) -- 0:00:45
271000 -- (-411.947) [-414.153] (-413.691) (-413.246) * (-412.666) (-413.803) [-414.392] (-414.861) -- 0:00:45
271500 -- (-412.165) (-414.172) [-415.949] (-412.158) * (-415.569) (-414.759) [-414.267] (-414.422) -- 0:00:45
272000 -- (-415.980) [-414.511] (-419.002) (-412.676) * [-415.407] (-413.663) (-413.034) (-413.882) -- 0:00:45
272500 -- [-415.037] (-415.034) (-416.431) (-414.408) * [-413.194] (-420.572) (-414.827) (-412.061) -- 0:00:45
273000 -- (-419.622) [-414.771] (-412.760) (-412.491) * (-414.116) (-415.392) [-412.227] (-414.552) -- 0:00:45
273500 -- (-418.877) [-415.227] (-413.029) (-416.358) * (-413.707) (-416.850) (-413.350) [-413.673] -- 0:00:45
274000 -- (-417.316) (-415.266) [-412.655] (-412.704) * (-412.460) (-414.230) (-415.266) [-412.299] -- 0:00:45
274500 -- (-415.245) (-415.381) [-412.242] (-415.917) * (-412.209) (-417.292) [-414.271] (-415.988) -- 0:00:44
275000 -- (-414.986) (-412.844) (-412.642) [-415.858] * (-412.372) [-414.516] (-413.305) (-416.472) -- 0:00:44
Average standard deviation of split frequencies: 0.014423
275500 -- (-413.430) [-414.645] (-415.323) (-416.607) * (-413.517) [-417.265] (-415.658) (-412.399) -- 0:00:44
276000 -- (-416.301) [-414.536] (-413.097) (-416.881) * (-412.858) (-414.797) (-413.114) [-415.455] -- 0:00:44
276500 -- (-413.380) (-414.359) [-415.157] (-413.390) * [-413.497] (-412.664) (-415.368) (-412.364) -- 0:00:44
277000 -- (-412.492) (-412.841) [-414.580] (-416.667) * (-412.590) [-413.258] (-411.728) (-414.665) -- 0:00:44
277500 -- [-412.854] (-416.854) (-413.779) (-412.948) * (-419.755) [-413.252] (-413.340) (-415.990) -- 0:00:44
278000 -- (-413.099) (-414.279) [-415.132] (-412.498) * (-413.446) (-417.098) [-414.116] (-416.581) -- 0:00:44
278500 -- (-415.448) [-413.280] (-416.871) (-413.524) * (-413.011) (-418.207) [-416.504] (-416.947) -- 0:00:44
279000 -- (-415.120) (-414.928) [-411.688] (-413.177) * (-411.975) (-412.151) (-415.115) [-413.776] -- 0:00:43
279500 -- (-414.618) (-413.080) (-412.535) [-415.658] * (-413.056) (-412.354) (-413.708) [-413.036] -- 0:00:43
280000 -- (-413.913) (-415.591) [-412.914] (-412.843) * (-416.454) (-413.212) [-414.345] (-412.919) -- 0:00:43
Average standard deviation of split frequencies: 0.013343
280500 -- (-414.533) [-414.813] (-413.292) (-416.546) * (-412.143) [-415.241] (-413.769) (-413.874) -- 0:00:43
281000 -- (-414.919) (-412.293) (-414.933) [-414.806] * (-414.187) [-413.849] (-412.608) (-413.377) -- 0:00:43
281500 -- (-413.839) (-411.994) [-415.263] (-413.051) * (-415.071) (-421.750) (-413.205) [-416.067] -- 0:00:43
282000 -- (-413.689) (-413.568) (-412.787) [-411.875] * (-412.776) [-415.009] (-413.408) (-414.395) -- 0:00:43
282500 -- (-414.260) (-415.209) [-416.627] (-414.474) * (-413.293) [-411.904] (-413.720) (-412.142) -- 0:00:43
283000 -- [-418.009] (-416.624) (-412.198) (-413.575) * (-415.312) (-415.558) [-415.593] (-413.744) -- 0:00:43
283500 -- (-421.214) (-412.091) (-413.036) [-415.594] * (-414.944) (-412.447) [-413.390] (-413.419) -- 0:00:42
284000 -- (-416.736) (-412.031) (-417.370) [-415.959] * (-413.828) (-413.163) [-412.348] (-414.731) -- 0:00:42
284500 -- [-412.779] (-414.666) (-414.957) (-413.082) * (-414.479) (-414.210) (-412.626) [-413.794] -- 0:00:42
285000 -- (-412.530) (-415.393) (-412.972) [-412.364] * (-412.193) (-418.351) (-414.024) [-413.064] -- 0:00:42
Average standard deviation of split frequencies: 0.013533
285500 -- (-412.021) (-417.373) (-418.938) [-412.738] * [-411.727] (-415.344) (-413.348) (-414.049) -- 0:00:45
286000 -- (-416.938) [-416.937] (-413.333) (-413.101) * (-414.655) [-415.784] (-416.129) (-413.252) -- 0:00:44
286500 -- [-412.263] (-412.335) (-415.270) (-413.929) * (-419.278) [-413.952] (-414.298) (-423.799) -- 0:00:44
287000 -- (-414.426) [-413.339] (-412.814) (-412.935) * (-418.617) [-415.854] (-415.677) (-415.516) -- 0:00:44
287500 -- (-413.423) (-413.329) (-414.877) [-413.497] * (-414.827) (-413.115) [-412.686] (-415.386) -- 0:00:44
288000 -- (-415.668) (-414.353) (-413.224) [-413.439] * [-414.089] (-414.299) (-413.876) (-415.046) -- 0:00:44
288500 -- [-411.786] (-415.927) (-413.708) (-413.463) * (-413.199) [-414.090] (-414.070) (-417.540) -- 0:00:44
289000 -- (-415.880) (-416.487) [-414.363] (-413.963) * (-414.186) (-415.720) [-412.955] (-414.197) -- 0:00:44
289500 -- [-416.646] (-413.475) (-412.817) (-412.852) * (-418.072) (-413.292) [-412.574] (-413.168) -- 0:00:44
290000 -- (-414.412) (-415.886) (-415.845) [-413.156] * (-413.940) (-412.686) [-414.092] (-412.315) -- 0:00:44
Average standard deviation of split frequencies: 0.014056
290500 -- (-412.458) [-412.480] (-413.232) (-414.782) * (-414.347) [-416.540] (-414.679) (-415.241) -- 0:00:43
291000 -- [-411.902] (-413.844) (-413.975) (-413.428) * (-415.497) (-413.344) [-412.363] (-414.348) -- 0:00:43
291500 -- (-414.824) (-413.704) (-412.415) [-413.325] * (-412.164) (-416.350) [-413.167] (-415.902) -- 0:00:43
292000 -- (-416.996) (-418.015) [-412.465] (-414.958) * (-412.625) (-419.228) [-412.048] (-412.818) -- 0:00:43
292500 -- (-418.919) [-418.788] (-413.993) (-416.562) * (-414.321) [-414.532] (-412.785) (-414.555) -- 0:00:43
293000 -- (-413.201) (-416.830) (-416.430) [-414.275] * (-413.807) [-412.669] (-412.332) (-412.129) -- 0:00:43
293500 -- (-412.696) [-414.145] (-413.113) (-413.668) * (-413.447) [-413.296] (-415.067) (-412.061) -- 0:00:43
294000 -- (-414.300) (-417.005) [-415.281] (-413.619) * (-413.828) (-413.606) (-412.884) [-416.661] -- 0:00:43
294500 -- (-413.990) (-418.239) (-412.022) [-413.892] * (-414.188) (-414.553) [-414.752] (-413.330) -- 0:00:43
295000 -- (-414.604) [-420.498] (-412.686) (-412.150) * [-411.709] (-412.788) (-413.020) (-412.765) -- 0:00:43
Average standard deviation of split frequencies: 0.014333
295500 -- [-414.558] (-414.891) (-414.619) (-414.482) * (-411.979) (-412.158) [-412.976] (-417.453) -- 0:00:42
296000 -- [-414.085] (-414.902) (-414.052) (-412.991) * (-413.122) (-415.144) (-416.121) [-413.633] -- 0:00:42
296500 -- [-417.930] (-414.038) (-414.283) (-412.508) * (-414.125) (-415.975) (-413.206) [-415.899] -- 0:00:42
297000 -- (-416.973) [-415.377] (-413.031) (-412.128) * [-413.286] (-416.680) (-413.051) (-413.639) -- 0:00:42
297500 -- [-413.269] (-414.425) (-412.519) (-413.053) * (-415.257) [-415.009] (-412.547) (-417.991) -- 0:00:42
298000 -- (-412.330) (-413.838) [-414.497] (-413.435) * (-416.449) (-414.534) [-414.653] (-417.924) -- 0:00:42
298500 -- (-414.304) [-413.651] (-412.655) (-417.147) * (-414.037) [-413.010] (-413.708) (-420.592) -- 0:00:42
299000 -- (-413.799) (-412.877) (-414.658) [-413.864] * (-414.922) [-412.793] (-412.384) (-415.354) -- 0:00:42
299500 -- (-415.485) (-413.048) (-413.226) [-413.880] * (-414.273) (-414.887) [-413.929] (-412.019) -- 0:00:42
300000 -- (-413.734) (-414.379) [-414.503] (-415.215) * [-413.003] (-415.930) (-412.848) (-413.059) -- 0:00:42
Average standard deviation of split frequencies: 0.013742
300500 -- [-415.958] (-414.957) (-413.195) (-415.049) * [-412.152] (-416.063) (-413.481) (-417.072) -- 0:00:41
301000 -- [-415.031] (-413.530) (-413.405) (-421.703) * (-412.337) (-415.908) [-415.311] (-413.121) -- 0:00:41
301500 -- (-412.296) (-413.578) (-414.808) [-414.410] * (-414.103) (-413.302) (-411.912) [-412.279] -- 0:00:41
302000 -- (-413.108) (-414.401) [-414.651] (-415.678) * (-413.118) (-416.259) [-414.500] (-414.057) -- 0:00:41
302500 -- (-414.430) (-414.002) (-415.217) [-415.496] * (-414.237) (-415.732) [-412.287] (-414.076) -- 0:00:43
303000 -- (-414.088) [-412.786] (-415.766) (-416.887) * (-413.373) (-413.112) [-412.799] (-413.459) -- 0:00:43
303500 -- (-414.216) [-414.102] (-416.290) (-414.594) * (-414.571) (-412.633) [-411.921] (-413.437) -- 0:00:43
304000 -- (-412.713) [-412.556] (-414.571) (-414.911) * (-414.899) (-412.316) (-412.343) [-413.052] -- 0:00:43
304500 -- [-415.284] (-412.682) (-413.270) (-415.374) * (-415.498) (-413.717) (-413.809) [-415.973] -- 0:00:43
305000 -- (-412.861) [-414.656] (-412.850) (-414.194) * (-414.400) (-413.068) [-412.830] (-412.694) -- 0:00:43
Average standard deviation of split frequencies: 0.014806
305500 -- (-413.932) (-413.986) (-414.123) [-413.194] * (-415.646) (-412.411) (-413.841) [-416.005] -- 0:00:43
306000 -- (-414.152) (-412.988) [-412.112] (-417.751) * (-415.671) (-413.683) (-414.043) [-414.607] -- 0:00:43
306500 -- [-412.547] (-417.261) (-412.298) (-413.399) * [-414.064] (-415.437) (-415.190) (-415.518) -- 0:00:42
307000 -- (-414.153) [-414.917] (-413.803) (-413.528) * (-417.640) (-412.698) (-415.173) [-413.588] -- 0:00:42
307500 -- (-413.241) [-414.939] (-416.420) (-411.803) * (-414.303) (-415.387) (-414.678) [-413.646] -- 0:00:42
308000 -- (-412.217) (-417.558) (-414.750) [-417.270] * (-414.065) (-411.580) [-414.661] (-414.084) -- 0:00:42
308500 -- (-416.060) (-412.339) (-419.226) [-415.509] * (-414.145) [-413.569] (-416.810) (-413.474) -- 0:00:42
309000 -- (-414.612) (-420.882) [-414.682] (-414.811) * (-412.761) (-415.801) (-416.915) [-416.666] -- 0:00:42
309500 -- (-413.389) (-414.735) [-412.406] (-412.486) * (-414.942) [-411.800] (-414.732) (-414.960) -- 0:00:42
310000 -- (-414.403) (-414.446) [-415.141] (-416.108) * (-414.950) (-414.969) (-413.579) [-415.120] -- 0:00:42
Average standard deviation of split frequencies: 0.013657
310500 -- (-415.540) (-412.694) [-415.905] (-414.816) * (-414.459) (-412.104) (-416.848) [-413.459] -- 0:00:42
311000 -- (-415.407) (-415.082) (-415.129) [-412.707] * [-414.174] (-416.658) (-416.216) (-413.953) -- 0:00:42
311500 -- (-415.775) (-413.312) [-414.017] (-414.502) * (-411.898) (-419.226) (-415.204) [-412.359] -- 0:00:41
312000 -- (-416.118) (-413.219) (-413.249) [-412.086] * (-413.804) (-416.071) (-412.943) [-412.130] -- 0:00:41
312500 -- (-413.718) (-413.733) [-415.079] (-414.812) * (-413.779) (-414.661) (-413.785) [-412.034] -- 0:00:41
313000 -- (-414.620) (-412.245) (-412.466) [-412.146] * [-417.894] (-413.813) (-412.821) (-414.975) -- 0:00:41
313500 -- (-413.599) (-413.723) [-412.800] (-412.239) * [-415.708] (-418.768) (-416.263) (-412.591) -- 0:00:41
314000 -- (-415.442) (-412.130) (-414.392) [-413.339] * [-413.189] (-413.118) (-414.546) (-415.499) -- 0:00:41
314500 -- [-414.211] (-411.928) (-420.606) (-414.005) * [-412.776] (-414.184) (-417.750) (-414.527) -- 0:00:41
315000 -- (-414.867) (-412.952) [-414.560] (-412.112) * [-415.262] (-417.795) (-413.563) (-414.160) -- 0:00:41
Average standard deviation of split frequencies: 0.013338
315500 -- [-415.833] (-414.545) (-416.116) (-416.347) * (-415.386) (-416.814) [-418.402] (-413.397) -- 0:00:41
316000 -- [-415.179] (-412.088) (-413.576) (-415.499) * (-417.911) [-412.778] (-415.681) (-413.465) -- 0:00:41
316500 -- [-412.103] (-416.212) (-412.542) (-416.058) * [-412.153] (-412.776) (-414.852) (-413.932) -- 0:00:41
317000 -- (-413.652) (-412.628) [-414.149] (-416.390) * (-413.723) [-415.040] (-415.319) (-411.969) -- 0:00:40
317500 -- [-412.738] (-416.991) (-413.330) (-416.046) * (-416.692) (-415.614) (-412.244) [-412.822] -- 0:00:40
318000 -- (-415.759) [-412.439] (-413.716) (-411.925) * (-413.799) [-411.958] (-412.130) (-414.556) -- 0:00:40
318500 -- [-411.676] (-414.465) (-416.498) (-413.007) * (-414.016) (-416.167) [-412.104] (-413.488) -- 0:00:40
319000 -- [-412.729] (-415.234) (-413.780) (-413.209) * [-411.787] (-414.328) (-415.852) (-413.543) -- 0:00:40
319500 -- (-411.775) (-412.247) [-411.773] (-413.886) * (-414.151) (-415.599) (-415.201) [-412.616] -- 0:00:42
320000 -- [-412.614] (-413.364) (-413.229) (-415.892) * (-415.212) (-413.440) [-413.833] (-412.972) -- 0:00:42
Average standard deviation of split frequencies: 0.013490
320500 -- (-415.093) [-411.950] (-414.281) (-418.023) * [-414.454] (-414.559) (-414.180) (-414.227) -- 0:00:42
321000 -- [-414.507] (-412.649) (-415.543) (-412.352) * (-412.231) [-412.984] (-412.907) (-413.720) -- 0:00:42
321500 -- (-412.471) [-415.061] (-413.497) (-414.359) * [-414.305] (-412.285) (-415.994) (-416.068) -- 0:00:42
322000 -- (-412.506) (-416.271) [-411.590] (-412.590) * [-415.701] (-411.629) (-415.976) (-413.261) -- 0:00:42
322500 -- (-412.624) (-414.548) (-412.945) [-411.880] * (-413.786) [-414.239] (-417.781) (-413.416) -- 0:00:42
323000 -- [-413.476] (-421.751) (-412.190) (-412.188) * (-412.717) (-415.616) (-415.781) [-416.361] -- 0:00:41
323500 -- (-415.383) (-412.552) (-415.272) [-413.899] * [-412.963] (-413.799) (-414.499) (-414.004) -- 0:00:41
324000 -- (-413.465) [-413.771] (-419.436) (-414.537) * (-412.834) [-414.963] (-416.983) (-420.877) -- 0:00:41
324500 -- (-413.196) [-416.897] (-414.293) (-416.753) * [-412.064] (-415.691) (-413.416) (-413.169) -- 0:00:41
325000 -- [-414.668] (-411.914) (-413.204) (-418.994) * (-414.178) [-412.800] (-413.318) (-413.707) -- 0:00:41
Average standard deviation of split frequencies: 0.013695
325500 -- [-419.407] (-414.318) (-413.419) (-413.827) * [-414.184] (-411.965) (-415.368) (-412.144) -- 0:00:41
326000 -- (-415.712) [-413.524] (-415.113) (-413.912) * (-412.791) (-413.289) [-412.919] (-415.046) -- 0:00:41
326500 -- (-413.629) [-414.730] (-414.340) (-412.496) * (-412.536) (-412.381) (-412.601) [-415.629] -- 0:00:41
327000 -- (-414.629) (-413.522) [-413.311] (-414.063) * [-414.648] (-414.998) (-414.667) (-414.762) -- 0:00:41
327500 -- (-414.369) (-418.379) (-415.251) [-415.435] * (-411.899) (-414.071) (-414.895) [-412.737] -- 0:00:41
328000 -- (-416.547) [-412.288] (-413.250) (-415.867) * [-414.810] (-416.310) (-417.246) (-414.666) -- 0:00:40
328500 -- (-415.757) (-412.924) [-416.483] (-413.836) * (-416.282) (-414.411) [-415.037] (-413.697) -- 0:00:40
329000 -- (-413.764) [-413.039] (-422.224) (-414.281) * (-417.375) (-414.881) (-412.363) [-417.235] -- 0:00:40
329500 -- (-414.744) (-413.345) (-416.303) [-414.768] * (-416.923) (-415.520) (-415.273) [-412.764] -- 0:00:40
330000 -- [-414.827] (-415.071) (-413.259) (-415.489) * (-412.891) (-413.957) (-414.223) [-412.195] -- 0:00:40
Average standard deviation of split frequencies: 0.014005
330500 -- (-415.582) (-417.427) [-412.252] (-415.892) * [-412.142] (-413.673) (-414.004) (-415.390) -- 0:00:40
331000 -- (-417.599) [-417.798] (-416.406) (-415.347) * (-416.824) (-416.333) (-414.072) [-416.176] -- 0:00:40
331500 -- [-413.345] (-414.514) (-413.309) (-418.440) * (-413.370) (-412.771) (-414.567) [-418.076] -- 0:00:40
332000 -- (-414.871) (-416.498) [-415.336] (-416.551) * (-414.746) (-423.178) [-412.431] (-413.877) -- 0:00:40
332500 -- [-414.318] (-415.749) (-414.171) (-419.044) * (-412.589) [-414.528] (-414.637) (-416.697) -- 0:00:40
333000 -- (-413.966) [-412.543] (-414.704) (-415.308) * [-413.967] (-416.797) (-416.889) (-414.268) -- 0:00:40
333500 -- (-413.631) (-415.957) [-412.585] (-412.114) * [-412.273] (-416.303) (-413.875) (-413.607) -- 0:00:39
334000 -- [-414.174] (-417.986) (-413.060) (-411.729) * (-413.123) (-414.506) (-412.346) [-413.982] -- 0:00:39
334500 -- (-416.971) [-413.443] (-413.107) (-413.431) * (-413.771) (-415.584) [-412.690] (-417.835) -- 0:00:39
335000 -- (-417.147) (-413.723) (-413.447) [-415.153] * (-414.170) (-415.786) (-412.174) [-414.104] -- 0:00:39
Average standard deviation of split frequencies: 0.015185
335500 -- (-411.986) (-415.649) [-416.618] (-413.628) * (-414.006) [-413.949] (-414.605) (-418.681) -- 0:00:39
336000 -- (-413.398) (-417.508) (-414.858) [-414.253] * (-411.974) [-414.001] (-411.919) (-413.175) -- 0:00:39
336500 -- (-418.565) (-417.937) (-413.441) [-413.876] * (-413.264) (-412.740) (-413.191) [-412.000] -- 0:00:41
337000 -- (-416.573) (-415.489) [-412.895] (-415.037) * (-413.276) (-413.454) [-413.893] (-412.003) -- 0:00:41
337500 -- [-412.304] (-417.174) (-414.691) (-413.512) * (-415.250) (-418.500) [-413.829] (-413.220) -- 0:00:41
338000 -- (-412.856) (-412.656) [-412.954] (-414.434) * (-415.564) [-412.156] (-413.952) (-412.047) -- 0:00:41
338500 -- [-413.960] (-412.790) (-411.936) (-412.824) * (-413.875) (-413.493) (-414.067) [-417.525] -- 0:00:41
339000 -- [-415.230] (-415.850) (-411.777) (-414.729) * (-412.888) [-412.359] (-412.927) (-415.775) -- 0:00:40
339500 -- (-418.489) [-415.053] (-412.413) (-413.005) * (-413.880) (-413.470) [-414.728] (-413.916) -- 0:00:40
340000 -- (-417.594) (-412.489) (-412.656) [-412.357] * [-418.917] (-413.972) (-417.483) (-412.528) -- 0:00:40
Average standard deviation of split frequencies: 0.013919
340500 -- (-413.937) (-414.581) [-412.303] (-412.749) * (-420.980) [-417.389] (-413.804) (-412.694) -- 0:00:40
341000 -- (-413.953) (-412.230) [-413.150] (-412.135) * (-414.124) [-412.275] (-414.661) (-412.899) -- 0:00:40
341500 -- (-412.959) (-412.479) [-412.132] (-413.546) * (-413.351) (-412.221) [-413.998] (-418.096) -- 0:00:40
342000 -- (-418.070) (-411.989) (-413.421) [-416.098] * (-414.483) [-413.715] (-412.858) (-414.055) -- 0:00:40
342500 -- [-415.060] (-412.686) (-414.022) (-412.855) * [-415.761] (-417.116) (-419.508) (-413.918) -- 0:00:40
343000 -- (-415.812) (-419.193) (-415.062) [-418.353] * (-413.232) (-413.898) [-415.681] (-412.282) -- 0:00:40
343500 -- (-415.823) [-416.004] (-413.237) (-418.039) * [-413.978] (-416.991) (-413.141) (-414.935) -- 0:00:40
344000 -- (-412.224) (-413.198) (-416.065) [-413.021] * [-412.660] (-413.375) (-413.333) (-414.403) -- 0:00:40
344500 -- (-412.338) [-412.907] (-419.520) (-414.304) * (-413.360) (-415.557) [-413.143] (-416.389) -- 0:00:39
345000 -- (-415.071) (-414.811) (-421.521) [-413.509] * (-415.921) (-416.994) [-414.339] (-414.557) -- 0:00:39
Average standard deviation of split frequencies: 0.013945
345500 -- [-412.311] (-419.028) (-413.275) (-417.695) * (-417.510) (-412.841) [-413.974] (-414.405) -- 0:00:39
346000 -- (-412.865) [-412.422] (-412.996) (-414.195) * (-412.161) (-413.333) [-418.121] (-414.755) -- 0:00:39
346500 -- (-412.492) [-412.117] (-414.565) (-413.056) * (-412.818) [-415.364] (-413.905) (-413.930) -- 0:00:39
347000 -- (-412.185) (-414.485) [-413.480] (-414.393) * (-412.646) (-415.666) [-411.894] (-414.478) -- 0:00:39
347500 -- (-414.688) (-412.226) (-414.092) [-412.077] * [-412.961] (-416.312) (-413.583) (-417.176) -- 0:00:39
348000 -- (-414.294) (-412.941) (-413.954) [-415.686] * (-412.858) (-415.010) (-418.748) [-412.683] -- 0:00:39
348500 -- [-415.906] (-413.699) (-419.205) (-416.612) * [-414.119] (-414.121) (-413.653) (-413.789) -- 0:00:39
349000 -- [-416.778] (-414.864) (-414.670) (-415.614) * (-416.029) (-413.586) (-414.077) [-412.902] -- 0:00:39
349500 -- (-415.695) [-413.297] (-415.864) (-414.919) * (-413.046) (-413.139) [-412.216] (-414.059) -- 0:00:39
350000 -- [-413.071] (-414.604) (-413.740) (-414.041) * (-415.613) [-412.581] (-414.793) (-413.509) -- 0:00:39
Average standard deviation of split frequencies: 0.014866
350500 -- (-413.508) (-412.651) (-414.640) [-416.084] * (-415.582) [-412.044] (-414.506) (-415.096) -- 0:00:38
351000 -- (-413.439) (-412.609) (-412.717) [-413.566] * (-413.244) (-415.064) (-413.246) [-412.802] -- 0:00:38
351500 -- [-414.772] (-414.368) (-414.196) (-418.375) * (-412.619) (-416.776) (-415.385) [-414.483] -- 0:00:38
352000 -- [-414.131] (-413.750) (-414.196) (-420.081) * (-413.576) (-415.327) (-416.302) [-412.946] -- 0:00:38
352500 -- [-414.601] (-418.379) (-414.837) (-414.715) * (-414.042) [-414.745] (-414.711) (-413.719) -- 0:00:38
353000 -- (-412.516) [-411.961] (-416.352) (-417.511) * [-412.305] (-412.927) (-413.892) (-416.273) -- 0:00:38
353500 -- [-412.560] (-415.751) (-411.650) (-412.323) * (-412.932) (-414.362) (-416.267) [-414.709] -- 0:00:38
354000 -- (-414.362) [-413.000] (-412.994) (-413.745) * (-418.133) [-412.973] (-413.687) (-417.383) -- 0:00:40
354500 -- (-412.909) (-414.419) [-413.379] (-413.762) * (-415.030) (-414.501) [-413.184] (-415.839) -- 0:00:40
355000 -- (-415.590) [-414.690] (-412.405) (-415.887) * (-413.410) (-415.211) (-413.202) [-418.324] -- 0:00:39
Average standard deviation of split frequencies: 0.013242
355500 -- (-418.087) (-414.980) [-412.762] (-412.249) * [-414.053] (-417.129) (-416.060) (-412.336) -- 0:00:39
356000 -- (-416.911) (-413.487) [-412.395] (-412.012) * (-413.496) [-414.366] (-414.604) (-415.696) -- 0:00:39
356500 -- (-414.625) (-414.601) [-411.895] (-413.268) * (-416.783) (-413.168) [-413.174] (-413.386) -- 0:00:39
357000 -- (-414.835) [-412.349] (-415.354) (-412.115) * (-414.159) (-411.765) (-413.919) [-413.531] -- 0:00:39
357500 -- (-413.864) (-414.501) [-415.019] (-413.731) * (-416.474) (-413.696) (-416.325) [-413.902] -- 0:00:39
358000 -- (-414.622) [-412.989] (-414.162) (-414.020) * (-412.489) (-412.874) (-413.380) [-413.633] -- 0:00:39
358500 -- (-414.179) (-415.286) (-414.557) [-413.181] * (-413.055) (-412.162) [-412.362] (-414.596) -- 0:00:39
359000 -- (-415.520) (-412.262) [-415.097] (-413.082) * (-413.358) (-414.931) [-415.414] (-414.825) -- 0:00:39
359500 -- (-415.376) (-414.276) [-412.214] (-413.063) * (-414.409) [-412.817] (-416.050) (-420.108) -- 0:00:39
360000 -- (-415.864) (-414.006) (-412.599) [-412.504] * (-412.623) [-412.737] (-414.015) (-417.775) -- 0:00:39
Average standard deviation of split frequencies: 0.013796
360500 -- [-412.961] (-414.353) (-411.610) (-413.034) * (-413.475) [-415.768] (-414.387) (-417.670) -- 0:00:39
361000 -- (-415.489) (-415.938) (-422.176) [-413.670] * (-419.004) [-418.123] (-412.402) (-416.604) -- 0:00:38
361500 -- (-416.113) (-414.021) (-418.481) [-412.001] * [-414.732] (-413.101) (-415.179) (-414.864) -- 0:00:38
362000 -- [-414.526] (-415.028) (-415.716) (-414.292) * (-416.002) [-412.230] (-415.681) (-414.714) -- 0:00:38
362500 -- (-414.414) [-413.662] (-414.064) (-414.584) * (-416.805) (-416.354) [-414.161] (-416.535) -- 0:00:38
363000 -- (-413.026) (-411.648) (-411.827) [-414.259] * (-412.529) (-413.958) (-417.824) [-412.175] -- 0:00:38
363500 -- [-413.497] (-411.743) (-411.877) (-415.488) * [-412.645] (-414.156) (-419.728) (-414.096) -- 0:00:38
364000 -- (-414.121) [-412.807] (-412.581) (-415.264) * (-413.614) [-415.238] (-412.341) (-416.032) -- 0:00:38
364500 -- (-413.163) (-413.405) [-416.136] (-414.440) * (-417.001) (-417.927) [-412.145] (-414.328) -- 0:00:38
365000 -- (-415.278) [-412.304] (-416.590) (-412.612) * [-415.393] (-416.769) (-413.203) (-413.986) -- 0:00:38
Average standard deviation of split frequencies: 0.013739
365500 -- (-413.936) [-416.087] (-415.205) (-411.854) * (-413.440) (-412.625) (-414.228) [-412.228] -- 0:00:38
366000 -- (-413.407) [-412.042] (-416.745) (-412.279) * (-413.853) (-413.819) [-416.682] (-413.238) -- 0:00:38
366500 -- (-413.912) (-412.973) [-416.622] (-412.385) * (-412.973) [-413.544] (-412.720) (-414.157) -- 0:00:38
367000 -- (-412.879) (-414.684) [-413.398] (-412.684) * (-413.226) (-414.423) [-415.518] (-415.468) -- 0:00:37
367500 -- (-413.195) (-412.843) (-413.184) [-412.231] * (-418.694) (-416.310) [-413.149] (-412.872) -- 0:00:37
368000 -- (-414.556) (-415.864) (-412.268) [-411.610] * [-418.176] (-415.595) (-414.027) (-412.560) -- 0:00:37
368500 -- (-412.148) [-411.756] (-413.473) (-416.370) * (-414.363) (-412.938) (-414.129) [-414.492] -- 0:00:37
369000 -- [-413.243] (-418.314) (-416.527) (-415.912) * (-414.538) [-415.072] (-415.133) (-416.901) -- 0:00:37
369500 -- (-414.017) (-417.221) (-412.825) [-414.612] * (-413.727) [-412.837] (-414.825) (-416.218) -- 0:00:37
370000 -- (-414.600) (-417.822) (-412.953) [-413.849] * [-413.510] (-413.860) (-411.885) (-416.157) -- 0:00:37
Average standard deviation of split frequencies: 0.013566
370500 -- (-419.399) (-417.512) [-414.625] (-412.363) * [-412.288] (-414.651) (-414.408) (-414.784) -- 0:00:37
371000 -- (-412.789) (-416.841) [-415.130] (-413.456) * (-412.863) (-416.052) [-413.075] (-413.214) -- 0:00:38
371500 -- (-412.833) (-413.677) (-413.722) [-415.283] * (-414.173) [-412.866] (-413.104) (-414.373) -- 0:00:38
372000 -- (-413.568) [-412.993] (-412.624) (-414.293) * (-422.383) (-414.989) (-420.868) [-413.362] -- 0:00:38
372500 -- [-413.996] (-413.196) (-418.126) (-414.602) * (-413.360) (-412.646) (-412.592) [-413.261] -- 0:00:38
373000 -- (-413.414) (-414.107) (-412.318) [-412.459] * (-413.170) (-412.775) [-415.631] (-412.953) -- 0:00:38
373500 -- (-412.600) [-413.034] (-412.653) (-412.631) * (-413.221) (-417.213) (-412.482) [-414.295] -- 0:00:38
374000 -- (-413.357) (-413.000) [-411.669] (-413.076) * (-413.799) (-412.570) (-415.577) [-414.672] -- 0:00:38
374500 -- (-413.481) [-413.336] (-412.580) (-414.156) * [-416.229] (-414.332) (-417.702) (-414.386) -- 0:00:38
375000 -- [-417.700] (-416.726) (-413.602) (-413.946) * (-413.637) (-412.863) (-414.346) [-416.117] -- 0:00:38
Average standard deviation of split frequencies: 0.014139
375500 -- (-415.441) [-412.800] (-422.956) (-413.201) * [-411.990] (-414.487) (-413.924) (-413.930) -- 0:00:38
376000 -- [-412.800] (-412.034) (-414.164) (-412.397) * [-412.951] (-414.941) (-413.068) (-413.295) -- 0:00:38
376500 -- (-413.924) (-411.946) (-412.017) [-413.226] * (-412.052) (-420.309) (-413.024) [-414.323] -- 0:00:38
377000 -- [-414.297] (-414.283) (-412.234) (-413.217) * (-413.979) [-415.140] (-412.833) (-413.492) -- 0:00:38
377500 -- (-413.897) [-412.850] (-412.931) (-412.182) * (-414.600) (-416.163) (-413.580) [-414.932] -- 0:00:37
378000 -- (-413.322) (-415.975) [-417.827] (-416.590) * (-415.889) (-415.091) (-415.074) [-413.010] -- 0:00:37
378500 -- (-414.743) [-412.396] (-413.255) (-423.831) * (-413.462) (-413.853) (-414.553) [-415.464] -- 0:00:37
379000 -- [-412.376] (-413.364) (-412.050) (-416.209) * [-414.274] (-413.429) (-415.513) (-419.439) -- 0:00:37
379500 -- (-417.031) [-413.810] (-412.877) (-411.724) * [-415.139] (-415.734) (-416.043) (-412.010) -- 0:00:37
380000 -- (-417.549) (-415.520) [-412.748] (-412.317) * (-416.798) (-414.578) [-412.947] (-415.011) -- 0:00:37
Average standard deviation of split frequencies: 0.013403
380500 -- [-411.726] (-412.787) (-413.591) (-413.528) * (-418.042) [-414.873] (-412.586) (-412.079) -- 0:00:37
381000 -- (-415.712) (-415.425) [-414.492] (-412.613) * [-413.192] (-415.298) (-412.120) (-416.832) -- 0:00:37
381500 -- [-416.183] (-416.232) (-417.245) (-412.491) * [-413.117] (-413.406) (-413.571) (-414.329) -- 0:00:37
382000 -- (-415.571) [-414.702] (-418.241) (-413.340) * (-415.810) (-413.057) (-412.166) [-414.296] -- 0:00:37
382500 -- (-417.906) [-411.803] (-412.955) (-412.689) * (-417.620) (-413.704) (-412.002) [-415.507] -- 0:00:37
383000 -- [-413.293] (-414.548) (-412.520) (-414.572) * (-415.662) (-413.521) [-412.935] (-416.130) -- 0:00:37
383500 -- (-413.435) (-416.893) [-412.897] (-412.572) * (-413.898) (-417.620) (-413.671) [-413.268] -- 0:00:36
384000 -- (-412.515) [-413.403] (-412.586) (-414.481) * (-415.751) (-412.511) [-413.705] (-413.938) -- 0:00:36
384500 -- (-416.780) (-413.362) [-414.645] (-414.321) * (-415.067) (-415.249) [-413.880] (-413.775) -- 0:00:36
385000 -- (-412.520) [-413.354] (-416.633) (-418.071) * (-413.638) (-414.229) [-413.478] (-413.569) -- 0:00:36
Average standard deviation of split frequencies: 0.013977
385500 -- [-412.026] (-413.393) (-411.996) (-419.447) * (-412.715) (-412.171) (-414.908) [-412.647] -- 0:00:36
386000 -- [-413.944] (-415.546) (-414.192) (-415.314) * (-418.702) (-412.698) (-412.977) [-413.012] -- 0:00:36
386500 -- [-415.751] (-413.178) (-412.546) (-415.886) * (-413.546) [-416.302] (-414.369) (-417.461) -- 0:00:36
387000 -- (-416.125) (-416.003) (-413.123) [-414.899] * (-414.094) [-412.648] (-419.526) (-414.223) -- 0:00:36
387500 -- (-415.432) (-414.513) (-412.040) [-412.259] * (-413.506) (-412.592) (-415.383) [-412.789] -- 0:00:36
388000 -- [-412.443] (-412.879) (-414.542) (-413.693) * (-413.711) (-418.874) (-414.378) [-412.598] -- 0:00:37
388500 -- (-412.162) (-412.799) (-413.494) [-413.818] * [-413.455] (-414.106) (-416.076) (-417.658) -- 0:00:37
389000 -- (-414.849) [-413.154] (-417.072) (-414.236) * [-414.544] (-412.867) (-412.983) (-415.098) -- 0:00:37
389500 -- (-415.342) (-414.077) [-413.439] (-414.262) * (-412.429) (-414.667) (-414.254) [-415.932] -- 0:00:37
390000 -- (-415.740) (-414.902) [-416.610] (-412.606) * (-413.470) [-412.837] (-415.270) (-417.900) -- 0:00:37
Average standard deviation of split frequencies: 0.014409
390500 -- (-413.889) (-413.363) (-415.482) [-412.300] * [-413.186] (-413.696) (-416.126) (-420.394) -- 0:00:37
391000 -- (-413.320) (-416.010) [-413.965] (-414.239) * (-412.140) [-417.111] (-413.707) (-418.000) -- 0:00:37
391500 -- [-413.535] (-414.831) (-417.373) (-413.805) * (-417.796) (-414.892) [-417.053] (-417.605) -- 0:00:37
392000 -- [-413.157] (-418.477) (-412.490) (-413.190) * (-413.376) [-412.343] (-416.553) (-414.267) -- 0:00:37
392500 -- [-412.385] (-416.136) (-413.241) (-415.094) * (-413.378) [-412.409] (-418.904) (-414.489) -- 0:00:37
393000 -- (-413.205) (-414.927) (-413.674) [-414.885] * (-413.175) [-416.499] (-414.728) (-412.300) -- 0:00:37
393500 -- [-416.915] (-413.171) (-415.200) (-412.538) * (-413.630) [-413.865] (-414.128) (-413.634) -- 0:00:36
394000 -- [-413.584] (-413.974) (-414.212) (-414.217) * (-415.800) [-417.139] (-412.860) (-413.249) -- 0:00:36
394500 -- (-413.852) [-412.292] (-414.746) (-413.890) * [-415.338] (-414.188) (-414.885) (-412.774) -- 0:00:36
395000 -- [-413.059] (-412.154) (-413.316) (-413.580) * (-414.318) [-413.683] (-413.666) (-416.169) -- 0:00:36
Average standard deviation of split frequencies: 0.014355
395500 -- (-415.307) [-415.012] (-414.377) (-413.941) * (-417.047) (-414.272) [-415.656] (-418.762) -- 0:00:36
396000 -- (-415.858) (-417.241) (-413.322) [-412.960] * [-412.179] (-414.001) (-415.701) (-416.651) -- 0:00:36
396500 -- (-417.372) (-413.450) (-411.874) [-414.724] * (-412.899) (-414.326) [-414.015] (-413.381) -- 0:00:36
397000 -- [-414.715] (-414.937) (-414.135) (-412.866) * [-413.209] (-413.753) (-412.603) (-417.713) -- 0:00:36
397500 -- (-412.912) [-413.080] (-412.632) (-413.022) * [-412.523] (-419.719) (-414.040) (-414.510) -- 0:00:36
398000 -- [-413.579] (-420.797) (-415.406) (-413.965) * (-413.759) (-422.085) (-417.359) [-415.056] -- 0:00:36
398500 -- (-412.717) (-417.311) [-413.579] (-413.930) * (-416.012) [-416.439] (-416.739) (-413.650) -- 0:00:36
399000 -- (-413.704) (-415.554) (-419.040) [-413.054] * (-413.661) (-414.322) [-416.019] (-416.637) -- 0:00:36
399500 -- (-413.069) (-414.441) [-413.711] (-414.998) * (-417.172) (-415.854) (-416.062) [-414.105] -- 0:00:36
400000 -- [-413.370] (-413.387) (-413.079) (-412.714) * (-416.011) [-416.127] (-412.309) (-413.545) -- 0:00:36
Average standard deviation of split frequencies: 0.014045
400500 -- [-411.798] (-413.700) (-415.764) (-414.500) * (-416.168) [-413.650] (-418.349) (-416.986) -- 0:00:35
401000 -- (-415.801) (-414.939) [-413.451] (-414.564) * [-412.876] (-414.610) (-415.591) (-414.609) -- 0:00:35
401500 -- (-413.436) (-413.895) (-412.988) [-413.503] * [-412.193] (-412.104) (-413.838) (-412.712) -- 0:00:35
402000 -- (-412.910) [-416.111] (-413.268) (-412.812) * (-411.842) (-412.105) [-414.815] (-413.332) -- 0:00:35
402500 -- (-414.403) (-415.124) [-411.881] (-415.595) * [-412.981] (-416.832) (-414.133) (-413.098) -- 0:00:35
403000 -- [-414.827] (-414.141) (-411.971) (-413.656) * [-412.500] (-417.121) (-414.421) (-412.742) -- 0:00:35
403500 -- (-413.399) (-413.603) (-412.289) [-412.141] * (-413.884) [-413.047] (-412.170) (-412.793) -- 0:00:35
404000 -- (-413.981) (-414.550) [-417.612] (-414.691) * [-414.490] (-414.170) (-412.945) (-415.561) -- 0:00:35
404500 -- (-413.252) [-412.943] (-416.658) (-415.826) * (-415.831) (-415.648) (-415.484) [-412.795] -- 0:00:35
405000 -- [-416.449] (-416.522) (-413.229) (-414.114) * (-412.660) (-412.624) [-412.982] (-415.318) -- 0:00:35
Average standard deviation of split frequencies: 0.013660
405500 -- (-417.377) [-416.158] (-414.745) (-419.734) * (-413.687) (-413.176) [-414.246] (-412.220) -- 0:00:36
406000 -- (-413.190) (-420.862) [-414.202] (-414.260) * (-415.058) [-413.218] (-411.982) (-412.559) -- 0:00:36
406500 -- [-414.395] (-413.914) (-415.732) (-413.386) * (-412.996) (-413.160) [-412.075] (-415.307) -- 0:00:36
407000 -- [-415.658] (-414.259) (-412.996) (-415.566) * (-420.029) (-413.705) (-415.258) [-413.514] -- 0:00:36
407500 -- (-413.209) [-412.998] (-416.348) (-414.859) * (-419.967) (-415.529) [-415.350] (-416.307) -- 0:00:36
408000 -- [-413.106] (-412.922) (-413.193) (-417.635) * (-412.176) (-413.927) (-414.116) [-415.146] -- 0:00:36
408500 -- (-415.120) [-412.893] (-415.526) (-420.544) * (-412.713) (-416.389) [-414.278] (-414.968) -- 0:00:36
409000 -- [-414.355] (-412.485) (-416.699) (-415.600) * (-413.461) [-413.589] (-413.756) (-413.286) -- 0:00:36
409500 -- (-414.657) (-413.755) [-413.744] (-412.856) * (-413.359) (-413.402) [-414.086] (-416.469) -- 0:00:36
410000 -- (-413.065) (-415.286) [-414.777] (-417.819) * (-415.758) (-416.549) [-414.638] (-416.187) -- 0:00:35
Average standard deviation of split frequencies: 0.012770
410500 -- (-414.240) [-417.082] (-413.525) (-416.809) * (-414.079) (-420.323) [-415.204] (-413.923) -- 0:00:35
411000 -- [-414.870] (-413.109) (-412.297) (-416.546) * (-414.182) (-422.835) (-414.791) [-412.804] -- 0:00:35
411500 -- (-413.674) (-413.549) (-412.880) [-412.725] * (-416.584) [-414.387] (-412.751) (-417.591) -- 0:00:35
412000 -- (-411.902) (-413.362) [-416.694] (-416.756) * (-412.534) [-414.362] (-418.925) (-415.649) -- 0:00:35
412500 -- (-414.522) [-415.589] (-415.562) (-418.311) * (-412.440) (-412.580) [-415.388] (-414.787) -- 0:00:35
413000 -- (-412.716) [-412.357] (-412.431) (-412.909) * [-412.200] (-412.422) (-413.043) (-413.963) -- 0:00:35
413500 -- [-416.511] (-412.922) (-412.197) (-413.225) * [-413.212] (-412.360) (-416.499) (-414.979) -- 0:00:35
414000 -- (-414.145) [-414.675] (-413.278) (-414.568) * (-413.461) (-413.094) [-415.115] (-415.141) -- 0:00:35
414500 -- (-412.045) [-413.487] (-411.940) (-412.610) * (-413.083) (-412.939) (-417.078) [-412.095] -- 0:00:35
415000 -- (-412.425) (-416.405) (-412.279) [-414.268] * (-413.080) [-412.834] (-413.393) (-415.074) -- 0:00:35
Average standard deviation of split frequencies: 0.012819
415500 -- (-412.629) (-416.650) (-411.961) [-412.165] * (-413.589) (-416.173) (-413.876) [-416.912] -- 0:00:35
416000 -- (-413.777) (-417.224) (-412.843) [-412.261] * (-417.082) (-417.479) (-412.138) [-413.434] -- 0:00:35
416500 -- (-414.297) (-415.587) (-415.345) [-412.725] * [-415.046] (-415.307) (-415.359) (-422.178) -- 0:00:35
417000 -- (-412.468) (-416.337) (-413.657) [-415.716] * (-414.148) (-413.686) [-414.206] (-421.479) -- 0:00:34
417500 -- (-411.844) (-421.178) (-413.401) [-413.292] * [-413.880] (-413.385) (-412.115) (-416.235) -- 0:00:34
418000 -- (-413.024) (-417.295) [-414.165] (-415.251) * [-414.161] (-412.575) (-412.145) (-414.639) -- 0:00:34
418500 -- [-414.646] (-412.515) (-413.433) (-417.798) * (-422.220) (-415.237) (-412.296) [-414.519] -- 0:00:34
419000 -- (-412.740) (-414.611) (-414.387) [-416.158] * (-422.059) (-413.172) [-414.936] (-414.018) -- 0:00:34
419500 -- (-413.060) (-413.542) [-414.669] (-413.875) * (-414.149) (-413.129) [-415.245] (-412.316) -- 0:00:34
420000 -- (-413.111) (-414.595) (-414.542) [-413.122] * (-414.208) (-416.001) (-415.469) [-415.386] -- 0:00:34
Average standard deviation of split frequencies: 0.012524
420500 -- (-413.510) (-414.544) (-415.741) [-412.724] * [-413.876] (-414.838) (-413.258) (-416.510) -- 0:00:34
421000 -- (-414.513) (-417.091) (-414.831) [-413.419] * (-414.506) [-413.663] (-416.427) (-413.462) -- 0:00:34
421500 -- [-414.583] (-415.663) (-417.778) (-413.725) * (-414.814) (-413.410) [-414.530] (-412.949) -- 0:00:34
422000 -- (-413.480) (-415.598) (-413.098) [-412.932] * (-414.014) (-413.335) (-415.656) [-413.305] -- 0:00:35
422500 -- (-411.768) [-412.746] (-414.454) (-418.082) * (-413.131) (-414.264) (-420.223) [-414.383] -- 0:00:35
423000 -- [-412.769] (-416.668) (-416.769) (-413.015) * (-412.810) (-412.710) [-415.941] (-415.434) -- 0:00:35
423500 -- (-415.719) (-415.855) (-416.128) [-414.530] * (-412.818) (-413.663) (-418.587) [-413.123] -- 0:00:35
424000 -- (-412.211) [-413.922] (-413.405) (-414.032) * (-413.113) (-413.766) (-414.727) [-412.294] -- 0:00:35
424500 -- (-412.731) (-414.280) [-411.971] (-413.099) * (-417.443) (-413.077) (-416.387) [-413.762] -- 0:00:35
425000 -- (-413.557) [-412.292] (-412.282) (-412.732) * (-416.950) [-414.981] (-411.837) (-413.745) -- 0:00:35
Average standard deviation of split frequencies: 0.013002
425500 -- (-414.730) (-412.185) (-415.301) [-413.421] * (-417.348) (-412.559) (-412.188) [-414.181] -- 0:00:35
426000 -- [-413.640] (-415.656) (-414.621) (-412.252) * (-417.063) [-412.475] (-415.387) (-414.502) -- 0:00:35
426500 -- (-412.834) (-415.501) [-414.573] (-412.243) * (-416.398) (-413.042) (-418.165) [-413.564] -- 0:00:34
427000 -- (-416.450) (-413.574) (-413.415) [-416.332] * (-415.266) (-412.854) (-418.221) [-412.593] -- 0:00:34
427500 -- (-417.459) (-414.938) (-414.921) [-415.303] * (-414.278) (-414.358) [-415.275] (-412.468) -- 0:00:34
428000 -- (-419.856) (-414.640) [-415.616] (-413.449) * (-413.705) [-412.259] (-417.244) (-412.606) -- 0:00:34
428500 -- (-419.206) [-414.859] (-415.797) (-412.268) * [-413.272] (-412.751) (-418.501) (-414.568) -- 0:00:34
429000 -- [-414.744] (-413.498) (-412.857) (-413.366) * (-413.582) (-414.800) (-414.525) [-414.539] -- 0:00:34
429500 -- [-413.709] (-412.547) (-415.562) (-412.933) * (-415.499) (-416.500) [-412.643] (-416.962) -- 0:00:34
430000 -- (-417.775) [-417.879] (-412.823) (-414.685) * (-415.325) (-414.109) [-413.152] (-413.670) -- 0:00:34
Average standard deviation of split frequencies: 0.012177
430500 -- (-412.868) (-418.578) [-411.871] (-422.193) * (-414.008) (-412.817) (-415.724) [-414.017] -- 0:00:34
431000 -- [-412.719] (-413.081) (-412.528) (-414.762) * [-417.408] (-419.228) (-413.488) (-417.411) -- 0:00:34
431500 -- [-415.303] (-414.507) (-414.398) (-416.451) * (-412.959) [-419.771] (-416.059) (-413.658) -- 0:00:34
432000 -- (-412.851) [-414.836] (-413.337) (-413.077) * (-412.930) [-415.342] (-415.356) (-416.030) -- 0:00:34
432500 -- (-414.269) (-413.554) [-411.956] (-413.296) * (-416.966) [-412.973] (-413.292) (-416.340) -- 0:00:34
433000 -- [-412.054] (-414.182) (-412.341) (-413.418) * (-414.794) [-411.606] (-414.592) (-413.564) -- 0:00:34
433500 -- (-412.444) [-413.971] (-412.825) (-414.860) * (-416.223) (-411.982) [-414.293] (-413.265) -- 0:00:33
434000 -- (-411.947) (-411.894) (-412.772) [-415.371] * [-415.185] (-411.671) (-414.835) (-414.861) -- 0:00:33
434500 -- (-413.715) [-411.941] (-412.455) (-413.448) * (-413.644) (-413.302) [-415.459] (-412.860) -- 0:00:33
435000 -- [-413.195] (-415.241) (-416.077) (-414.589) * (-414.678) (-412.815) [-414.568] (-412.782) -- 0:00:33
Average standard deviation of split frequencies: 0.012231
435500 -- (-412.976) (-414.704) (-412.751) [-415.432] * [-412.711] (-414.257) (-412.814) (-412.454) -- 0:00:33
436000 -- (-415.641) (-415.265) (-413.261) [-414.433] * (-412.517) [-415.394] (-412.953) (-414.469) -- 0:00:33
436500 -- (-412.027) (-417.621) (-412.839) [-412.877] * (-413.216) (-414.640) (-413.347) [-416.125] -- 0:00:33
437000 -- [-413.287] (-418.706) (-415.182) (-413.733) * (-415.094) (-417.423) [-412.471] (-414.081) -- 0:00:33
437500 -- (-414.945) [-418.899] (-412.244) (-412.668) * (-415.719) (-416.755) (-414.494) [-413.746] -- 0:00:33
438000 -- [-414.744] (-411.949) (-414.592) (-412.381) * [-420.234] (-412.383) (-412.904) (-414.405) -- 0:00:33
438500 -- [-412.448] (-413.402) (-413.710) (-413.254) * (-417.229) [-413.955] (-415.753) (-413.453) -- 0:00:33
439000 -- (-423.340) (-413.900) [-412.927] (-413.012) * (-413.516) [-413.736] (-418.600) (-418.767) -- 0:00:33
439500 -- (-413.329) [-413.734] (-413.297) (-413.338) * (-414.127) (-412.912) [-412.410] (-415.616) -- 0:00:34
440000 -- (-414.341) [-417.470] (-417.299) (-414.657) * (-417.336) [-413.350] (-414.549) (-418.298) -- 0:00:34
Average standard deviation of split frequencies: 0.011099
440500 -- (-414.554) (-413.430) [-413.844] (-413.055) * [-412.858] (-413.725) (-416.078) (-417.361) -- 0:00:34
441000 -- (-413.802) (-411.830) (-413.370) [-413.812] * [-414.748] (-414.132) (-414.565) (-414.298) -- 0:00:34
441500 -- [-412.118] (-412.389) (-413.093) (-414.633) * (-413.561) (-417.416) (-420.637) [-414.255] -- 0:00:34
442000 -- [-415.027] (-415.674) (-415.148) (-414.801) * [-414.277] (-412.804) (-421.010) (-413.290) -- 0:00:34
442500 -- (-412.512) (-412.930) [-414.919] (-412.548) * [-414.129] (-412.557) (-412.236) (-413.663) -- 0:00:34
443000 -- (-415.821) (-417.818) (-414.221) [-413.577] * (-415.113) (-415.488) (-415.436) [-412.050] -- 0:00:33
443500 -- (-416.490) (-415.071) [-412.512] (-413.897) * (-414.952) (-413.408) [-412.845] (-414.644) -- 0:00:33
444000 -- (-413.248) (-415.631) (-412.533) [-416.892] * [-412.869] (-413.662) (-412.936) (-412.828) -- 0:00:33
444500 -- [-412.793] (-413.828) (-414.876) (-416.982) * (-416.656) (-413.816) [-412.475] (-411.719) -- 0:00:33
445000 -- (-413.791) (-414.674) (-413.920) [-413.025] * [-413.960] (-413.538) (-413.167) (-416.700) -- 0:00:33
Average standard deviation of split frequencies: 0.010880
445500 -- [-416.361] (-413.353) (-412.995) (-412.576) * [-414.821] (-413.329) (-412.680) (-415.257) -- 0:00:33
446000 -- (-419.458) (-413.946) [-411.736] (-412.034) * [-414.956] (-414.816) (-412.231) (-415.048) -- 0:00:33
446500 -- (-416.291) (-411.994) (-415.133) [-415.191] * (-412.120) [-413.679] (-413.010) (-418.527) -- 0:00:33
447000 -- [-413.382] (-419.315) (-412.459) (-414.397) * (-413.920) (-412.796) [-412.268] (-414.119) -- 0:00:33
447500 -- [-412.138] (-412.372) (-413.402) (-412.340) * (-413.940) (-414.549) (-414.972) [-414.438] -- 0:00:33
448000 -- (-413.565) [-413.534] (-411.871) (-413.043) * (-414.164) (-414.151) [-413.581] (-413.503) -- 0:00:33
448500 -- [-413.583] (-414.066) (-414.377) (-413.739) * (-413.547) (-416.253) (-416.170) [-412.436] -- 0:00:33
449000 -- (-416.200) [-413.594] (-413.583) (-414.561) * (-414.784) (-413.225) [-413.191] (-414.947) -- 0:00:33
449500 -- [-413.999] (-416.224) (-414.077) (-414.629) * (-416.273) [-415.522] (-413.731) (-412.095) -- 0:00:33
450000 -- (-414.685) [-414.427] (-414.369) (-411.985) * (-412.371) (-413.159) (-413.852) [-413.951] -- 0:00:33
Average standard deviation of split frequencies: 0.011075
450500 -- [-411.991] (-415.582) (-413.368) (-412.840) * (-412.512) [-415.017] (-414.724) (-415.891) -- 0:00:32
451000 -- (-415.111) (-413.451) [-414.073] (-412.701) * [-413.880] (-415.516) (-414.136) (-414.577) -- 0:00:32
451500 -- (-413.812) (-412.753) (-414.926) [-412.718] * (-416.572) (-419.699) (-412.641) [-415.698] -- 0:00:32
452000 -- (-413.694) (-414.846) [-415.684] (-417.057) * [-416.387] (-415.878) (-412.866) (-413.902) -- 0:00:32
452500 -- (-414.361) [-414.994] (-413.756) (-415.475) * [-413.287] (-416.093) (-414.795) (-412.916) -- 0:00:32
453000 -- [-415.489] (-413.441) (-414.446) (-413.815) * (-412.335) (-414.414) [-413.147] (-412.078) -- 0:00:32
453500 -- [-413.394] (-412.026) (-415.213) (-416.674) * [-415.943] (-412.850) (-412.187) (-412.995) -- 0:00:32
454000 -- (-413.342) (-412.767) [-414.328] (-412.371) * (-413.965) (-412.169) [-414.988] (-412.247) -- 0:00:32
454500 -- (-412.498) (-415.713) (-414.117) [-412.864] * (-417.878) (-413.643) (-413.078) [-413.483] -- 0:00:32
455000 -- [-414.502] (-415.724) (-413.166) (-414.369) * (-415.791) (-413.229) (-412.672) [-413.684] -- 0:00:32
Average standard deviation of split frequencies: 0.011189
455500 -- (-413.791) (-412.196) [-413.149] (-414.629) * [-413.241] (-414.925) (-415.701) (-413.393) -- 0:00:32
456000 -- (-414.577) (-413.824) (-413.148) [-414.714] * (-413.533) (-413.098) (-416.291) [-413.641] -- 0:00:32
456500 -- (-413.227) (-415.670) [-412.324] (-412.539) * (-413.709) [-416.068] (-412.525) (-412.391) -- 0:00:33
457000 -- (-414.624) (-412.578) (-419.633) [-412.824] * (-415.190) [-412.881] (-413.557) (-412.288) -- 0:00:33
457500 -- (-414.188) [-415.896] (-414.821) (-415.773) * (-414.528) (-413.630) (-413.507) [-414.997] -- 0:00:33
458000 -- (-412.361) [-414.772] (-412.161) (-420.073) * (-414.178) [-414.170] (-412.575) (-414.848) -- 0:00:33
458500 -- (-412.319) (-412.785) [-413.187] (-412.290) * (-412.828) (-413.338) [-415.247] (-416.761) -- 0:00:33
459000 -- (-416.546) (-414.510) [-412.110] (-414.040) * [-414.529] (-412.048) (-414.040) (-413.077) -- 0:00:33
459500 -- (-413.821) (-412.347) (-413.407) [-412.973] * [-414.148] (-413.566) (-413.484) (-415.881) -- 0:00:32
460000 -- (-414.512) (-413.139) (-413.294) [-412.045] * (-414.029) (-411.987) [-414.442] (-414.356) -- 0:00:32
Average standard deviation of split frequencies: 0.010489
460500 -- (-414.808) (-416.178) [-414.773] (-415.733) * [-414.276] (-414.841) (-412.966) (-413.186) -- 0:00:32
461000 -- (-413.844) (-413.303) (-416.791) [-412.668] * (-413.156) [-415.810] (-418.828) (-412.712) -- 0:00:32
461500 -- (-415.032) [-412.749] (-413.935) (-412.997) * [-414.096] (-417.798) (-415.914) (-413.844) -- 0:00:32
462000 -- (-414.403) (-415.058) [-415.123] (-415.829) * (-421.787) (-414.755) [-413.990] (-413.151) -- 0:00:32
462500 -- (-413.082) [-414.561] (-418.873) (-415.259) * (-415.670) (-419.306) [-417.457] (-412.978) -- 0:00:32
463000 -- (-412.854) (-413.536) (-415.724) [-412.515] * (-415.260) (-418.310) (-413.457) [-413.259] -- 0:00:32
463500 -- (-413.316) [-413.891] (-416.183) (-412.393) * (-412.790) (-414.710) (-413.623) [-413.010] -- 0:00:32
464000 -- (-414.584) (-415.090) [-413.446] (-415.857) * [-416.495] (-415.154) (-413.066) (-412.812) -- 0:00:32
464500 -- [-414.472] (-416.355) (-413.793) (-412.672) * (-413.242) [-413.315] (-418.092) (-418.821) -- 0:00:32
465000 -- [-416.724] (-417.624) (-413.806) (-412.065) * [-416.142] (-413.150) (-416.519) (-418.022) -- 0:00:32
Average standard deviation of split frequencies: 0.010748
465500 -- [-415.472] (-412.460) (-415.788) (-413.869) * [-412.785] (-413.657) (-414.483) (-414.126) -- 0:00:32
466000 -- (-414.348) (-417.537) (-413.392) [-414.817] * (-414.028) (-415.526) [-415.546] (-413.283) -- 0:00:32
466500 -- (-414.650) [-413.824] (-415.863) (-413.679) * [-413.178] (-415.648) (-413.552) (-413.574) -- 0:00:32
467000 -- [-414.954] (-412.867) (-420.428) (-414.808) * (-414.122) (-416.891) [-415.683] (-412.193) -- 0:00:31
467500 -- (-412.318) (-414.779) [-417.301] (-415.139) * (-414.320) (-413.697) [-414.202] (-413.334) -- 0:00:31
468000 -- (-413.437) (-417.788) (-417.596) [-415.265] * (-419.044) (-412.087) (-413.944) [-413.119] -- 0:00:31
468500 -- (-414.139) (-413.173) (-412.361) [-413.598] * (-413.868) (-413.561) [-413.574] (-418.943) -- 0:00:31
469000 -- (-412.295) (-417.695) (-414.932) [-411.950] * [-412.478] (-412.677) (-413.998) (-414.149) -- 0:00:31
469500 -- (-414.491) (-419.886) [-412.603] (-412.657) * (-414.243) [-412.613] (-412.260) (-418.164) -- 0:00:31
470000 -- (-411.944) [-413.329] (-413.270) (-412.706) * (-413.190) (-416.905) [-412.516] (-412.908) -- 0:00:31
Average standard deviation of split frequencies: 0.010391
470500 -- (-413.294) (-416.867) (-412.866) [-413.642] * (-416.719) (-414.708) [-415.869] (-412.787) -- 0:00:31
471000 -- [-412.056] (-413.764) (-415.914) (-414.598) * [-419.417] (-413.582) (-412.032) (-416.907) -- 0:00:31
471500 -- (-413.850) [-413.583] (-420.964) (-415.427) * (-414.208) (-414.409) (-412.517) [-413.232] -- 0:00:31
472000 -- (-413.444) (-416.305) (-414.468) [-415.988] * (-415.418) (-419.059) (-412.916) [-413.992] -- 0:00:31
472500 -- (-412.911) (-413.873) [-413.772] (-416.580) * (-414.126) [-412.534] (-414.055) (-412.364) -- 0:00:31
473000 -- (-412.946) (-415.664) (-414.417) [-416.654] * (-412.010) (-414.860) (-415.782) [-412.516] -- 0:00:31
473500 -- (-413.637) [-412.542] (-411.728) (-417.866) * [-416.441] (-413.793) (-414.854) (-415.778) -- 0:00:32
474000 -- (-416.104) [-413.133] (-413.737) (-417.239) * (-412.412) (-413.987) (-416.653) [-417.885] -- 0:00:32
474500 -- [-414.175] (-414.281) (-418.953) (-413.170) * [-412.700] (-414.805) (-415.348) (-419.090) -- 0:00:32
475000 -- [-411.943] (-413.296) (-413.044) (-413.167) * (-415.957) (-414.382) [-413.376] (-411.851) -- 0:00:32
Average standard deviation of split frequencies: 0.009594
475500 -- (-412.806) (-414.950) (-417.388) [-412.095] * (-412.129) (-415.134) (-412.314) [-412.226] -- 0:00:31
476000 -- (-416.678) (-418.265) [-413.137] (-414.694) * (-414.195) (-411.960) [-415.559] (-412.836) -- 0:00:31
476500 -- (-415.067) (-414.646) (-413.011) [-415.682] * [-415.913] (-412.076) (-415.663) (-413.993) -- 0:00:31
477000 -- (-414.015) [-417.622] (-412.965) (-412.966) * (-415.111) (-412.827) [-416.693] (-413.271) -- 0:00:31
477500 -- [-413.616] (-417.574) (-413.726) (-417.507) * (-417.918) (-415.269) [-412.878] (-417.053) -- 0:00:31
478000 -- (-417.849) [-412.543] (-412.143) (-415.867) * [-412.201] (-413.790) (-412.422) (-414.265) -- 0:00:31
478500 -- (-416.469) (-412.655) [-413.370] (-414.908) * (-415.597) (-412.510) (-415.902) [-414.800] -- 0:00:31
479000 -- [-412.054] (-417.424) (-412.375) (-416.254) * (-414.066) (-413.078) [-412.339] (-413.548) -- 0:00:31
479500 -- (-412.431) [-412.899] (-413.908) (-412.644) * (-412.235) (-417.109) [-412.358] (-412.992) -- 0:00:31
480000 -- (-416.809) (-412.337) (-413.871) [-412.519] * [-414.047] (-417.265) (-413.435) (-413.675) -- 0:00:31
Average standard deviation of split frequencies: 0.009980
480500 -- (-413.193) (-415.736) (-413.265) [-418.163] * [-414.196] (-414.121) (-414.214) (-414.196) -- 0:00:31
481000 -- (-413.686) (-416.051) [-412.973] (-416.074) * (-415.152) (-413.980) [-414.605] (-415.707) -- 0:00:31
481500 -- (-413.417) (-412.088) [-414.249] (-412.413) * (-412.388) (-413.435) (-414.469) [-414.934] -- 0:00:31
482000 -- (-419.341) (-412.273) [-411.607] (-415.614) * (-416.840) (-412.980) (-412.791) [-412.649] -- 0:00:31
482500 -- [-414.868] (-412.647) (-414.710) (-412.610) * (-418.762) [-413.804] (-414.154) (-413.602) -- 0:00:31
483000 -- (-414.235) (-413.632) (-413.722) [-417.023] * (-418.657) (-412.855) (-414.790) [-414.424] -- 0:00:31
483500 -- (-412.899) [-414.722] (-412.827) (-414.590) * (-417.549) (-412.317) [-413.914] (-412.413) -- 0:00:30
484000 -- (-412.249) (-416.296) [-413.482] (-412.494) * (-411.866) [-412.900] (-413.792) (-417.187) -- 0:00:30
484500 -- [-415.559] (-414.676) (-415.273) (-415.903) * (-411.919) [-413.106] (-415.540) (-414.496) -- 0:00:30
485000 -- (-414.880) [-415.555] (-418.139) (-413.026) * (-415.161) (-414.521) [-413.185] (-414.420) -- 0:00:30
Average standard deviation of split frequencies: 0.009871
485500 -- (-414.226) (-412.866) (-413.628) [-415.518] * (-415.120) (-415.389) [-413.207] (-419.984) -- 0:00:30
486000 -- (-415.070) (-413.037) (-413.731) [-413.200] * (-416.346) [-414.575] (-412.868) (-415.808) -- 0:00:30
486500 -- (-416.172) (-415.831) (-412.516) [-415.290] * (-411.858) (-414.915) [-412.346] (-413.771) -- 0:00:30
487000 -- (-415.474) (-416.075) [-412.357] (-413.748) * (-413.980) (-412.801) [-412.084] (-415.040) -- 0:00:30
487500 -- (-412.842) (-413.508) (-417.489) [-412.082] * (-413.775) [-413.997] (-414.107) (-413.753) -- 0:00:30
488000 -- [-413.440] (-411.735) (-411.998) (-414.304) * (-413.591) (-415.134) [-412.528] (-412.044) -- 0:00:30
488500 -- (-413.325) (-412.359) (-412.506) [-417.019] * (-413.197) (-414.530) [-411.706] (-412.314) -- 0:00:30
489000 -- (-415.446) (-412.630) [-416.038] (-414.235) * [-414.139] (-414.531) (-412.953) (-413.369) -- 0:00:30
489500 -- (-415.245) (-412.791) [-413.103] (-412.849) * [-412.332] (-416.768) (-412.202) (-414.514) -- 0:00:30
490000 -- (-413.630) (-414.327) [-413.108] (-412.042) * [-413.009] (-414.535) (-411.733) (-413.502) -- 0:00:30
Average standard deviation of split frequencies: 0.009968
490500 -- [-414.989] (-412.891) (-412.987) (-414.538) * (-414.844) [-414.945] (-411.967) (-412.298) -- 0:00:31
491000 -- (-418.715) (-412.440) (-414.823) [-412.567] * (-416.172) (-415.835) (-416.467) [-412.749] -- 0:00:31
491500 -- (-412.639) (-412.356) [-413.687] (-411.736) * (-414.555) (-413.312) (-414.512) [-413.790] -- 0:00:31
492000 -- [-412.561] (-417.205) (-418.131) (-414.103) * (-415.752) [-414.023] (-412.792) (-412.370) -- 0:00:30
492500 -- (-413.038) [-413.827] (-414.717) (-417.049) * (-414.016) [-413.556] (-413.181) (-414.035) -- 0:00:30
493000 -- (-415.815) (-415.851) (-413.411) [-413.036] * (-419.378) (-414.014) [-413.648] (-414.711) -- 0:00:30
493500 -- (-414.441) (-415.647) (-415.294) [-413.185] * (-416.200) (-415.689) (-413.173) [-412.504] -- 0:00:30
494000 -- [-414.062] (-412.811) (-412.284) (-414.519) * (-413.268) (-412.943) [-413.432] (-414.315) -- 0:00:30
494500 -- (-416.700) (-414.846) (-416.215) [-414.426] * (-413.599) (-413.804) [-413.140] (-414.450) -- 0:00:30
495000 -- (-412.813) (-418.785) (-415.078) [-412.112] * (-414.171) (-414.061) [-413.359] (-413.747) -- 0:00:30
Average standard deviation of split frequencies: 0.009979
495500 -- (-414.464) (-419.547) [-415.747] (-412.466) * (-417.811) [-416.263] (-412.143) (-413.272) -- 0:00:30
496000 -- [-414.492] (-414.845) (-416.540) (-414.851) * (-415.556) (-412.930) (-412.613) [-412.145] -- 0:00:30
496500 -- (-413.161) (-414.619) [-414.131] (-417.675) * (-412.608) (-412.585) (-417.203) [-413.369] -- 0:00:30
497000 -- (-416.742) (-415.269) [-412.765] (-412.154) * [-413.597] (-413.206) (-415.327) (-415.532) -- 0:00:30
497500 -- [-412.864] (-418.333) (-412.346) (-416.685) * (-412.584) [-415.595] (-415.228) (-414.380) -- 0:00:30
498000 -- (-414.847) (-416.748) [-414.483] (-413.780) * (-413.555) (-413.877) (-413.193) [-414.970] -- 0:00:30
498500 -- (-418.193) (-412.366) [-412.568] (-414.065) * [-413.459] (-414.754) (-412.617) (-413.908) -- 0:00:30
499000 -- (-413.091) (-414.659) (-412.285) [-414.068] * (-415.172) [-412.752] (-412.341) (-412.607) -- 0:00:30
499500 -- [-412.514] (-415.513) (-419.401) (-415.217) * (-412.298) (-412.604) [-412.913] (-413.215) -- 0:00:30
500000 -- (-414.038) (-413.490) [-414.702] (-412.343) * [-412.567] (-412.371) (-415.689) (-415.119) -- 0:00:30
Average standard deviation of split frequencies: 0.010357
500500 -- (-414.542) [-413.210] (-415.082) (-413.308) * (-414.424) (-419.460) (-417.192) [-413.477] -- 0:00:29
501000 -- [-414.264] (-412.727) (-412.370) (-412.629) * (-412.903) (-416.740) (-416.875) [-416.210] -- 0:00:29
501500 -- (-415.261) (-418.705) (-414.806) [-413.663] * (-414.764) [-417.024] (-414.528) (-414.903) -- 0:00:29
502000 -- [-412.356] (-414.728) (-415.430) (-415.053) * [-414.511] (-415.785) (-413.180) (-415.480) -- 0:00:29
502500 -- (-412.339) (-414.834) (-419.161) [-414.700] * [-416.306] (-416.731) (-414.595) (-412.186) -- 0:00:29
503000 -- [-412.424] (-415.693) (-413.183) (-414.483) * (-413.315) [-415.588] (-414.395) (-412.971) -- 0:00:29
503500 -- [-415.515] (-413.963) (-413.095) (-411.863) * [-415.119] (-413.866) (-414.343) (-412.439) -- 0:00:29
504000 -- (-414.010) [-413.562] (-413.529) (-413.436) * (-417.257) (-413.706) [-411.865] (-413.609) -- 0:00:29
504500 -- (-415.544) [-414.547] (-415.424) (-412.134) * (-413.195) [-416.510] (-414.125) (-413.647) -- 0:00:29
505000 -- (-419.689) (-413.587) (-412.681) [-411.819] * [-412.246] (-418.710) (-414.004) (-417.079) -- 0:00:29
Average standard deviation of split frequencies: 0.010303
505500 -- (-416.946) (-414.240) (-413.024) [-412.640] * [-413.127] (-417.409) (-413.421) (-417.214) -- 0:00:29
506000 -- (-413.176) (-414.345) (-414.873) [-414.249] * (-415.388) (-414.863) [-412.519] (-415.306) -- 0:00:29
506500 -- (-414.827) (-417.064) [-412.888] (-414.084) * (-416.642) (-416.496) [-416.548] (-412.650) -- 0:00:29
507000 -- [-415.245] (-423.636) (-412.622) (-418.163) * (-414.855) [-414.261] (-418.158) (-413.148) -- 0:00:29
507500 -- (-414.260) (-418.454) [-413.679] (-414.841) * (-417.950) [-412.440] (-412.985) (-413.528) -- 0:00:30
508000 -- (-418.627) [-414.238] (-416.017) (-414.584) * (-415.544) (-412.238) (-413.201) [-414.775] -- 0:00:30
508500 -- (-417.189) (-412.586) [-417.331] (-414.772) * (-411.921) [-412.753] (-416.063) (-413.948) -- 0:00:29
509000 -- (-414.039) [-413.989] (-415.947) (-418.457) * (-414.160) (-417.972) [-412.519] (-412.307) -- 0:00:29
509500 -- (-415.565) [-412.542] (-414.825) (-419.226) * (-414.364) (-415.084) [-413.306] (-414.336) -- 0:00:29
510000 -- (-415.328) (-413.131) [-414.015] (-412.971) * (-412.991) [-414.588] (-414.151) (-412.406) -- 0:00:29
Average standard deviation of split frequencies: 0.010371
510500 -- (-414.577) [-413.828] (-416.403) (-414.617) * (-414.714) (-416.204) [-417.822] (-415.911) -- 0:00:29
511000 -- (-413.746) [-413.354] (-414.367) (-413.960) * (-411.777) (-418.162) (-417.626) [-413.759] -- 0:00:29
511500 -- [-413.282] (-414.871) (-414.157) (-415.008) * (-415.007) [-416.395] (-413.098) (-413.143) -- 0:00:29
512000 -- [-414.089] (-412.127) (-412.678) (-414.684) * (-414.418) (-414.637) (-413.382) [-411.900] -- 0:00:29
512500 -- (-413.202) (-413.124) [-412.495] (-414.484) * (-413.488) [-413.752] (-414.525) (-412.889) -- 0:00:29
513000 -- (-413.974) (-415.251) [-413.352] (-413.595) * (-415.195) (-412.875) (-411.626) [-414.684] -- 0:00:29
513500 -- (-413.806) [-412.678] (-415.102) (-412.738) * (-412.905) [-412.726] (-411.969) (-418.805) -- 0:00:29
514000 -- [-415.032] (-412.107) (-412.523) (-413.215) * (-412.878) (-414.662) (-412.710) [-414.289] -- 0:00:29
514500 -- (-414.142) [-413.641] (-412.929) (-412.873) * (-413.798) [-414.820] (-412.709) (-413.525) -- 0:00:29
515000 -- (-413.662) [-412.447] (-413.464) (-414.630) * [-414.443] (-416.624) (-412.812) (-418.373) -- 0:00:29
Average standard deviation of split frequencies: 0.010792
515500 -- (-412.584) (-412.717) [-413.530] (-412.841) * [-413.589] (-414.684) (-415.107) (-414.337) -- 0:00:29
516000 -- (-413.826) [-411.766] (-414.240) (-419.649) * (-414.218) [-414.105] (-413.491) (-417.523) -- 0:00:29
516500 -- (-414.471) (-415.963) [-413.404] (-420.688) * (-416.034) (-413.278) [-411.683] (-420.360) -- 0:00:29
517000 -- (-412.612) (-418.229) [-413.174] (-415.765) * (-415.327) (-424.887) (-411.831) [-414.473] -- 0:00:28
517500 -- (-416.587) (-413.476) [-416.707] (-412.513) * [-412.239] (-422.639) (-412.042) (-423.259) -- 0:00:28
518000 -- (-414.033) (-413.657) (-416.088) [-415.586] * (-413.156) (-417.886) (-412.009) [-413.088] -- 0:00:28
518500 -- [-414.460] (-412.571) (-413.313) (-413.560) * [-413.008] (-414.496) (-413.577) (-414.895) -- 0:00:28
519000 -- [-414.956] (-413.994) (-412.959) (-412.580) * (-418.673) (-413.651) [-413.936] (-413.087) -- 0:00:28
519500 -- [-414.006] (-415.076) (-412.644) (-417.428) * (-413.658) (-412.992) [-413.096] (-413.797) -- 0:00:28
520000 -- (-416.154) (-413.013) [-412.958] (-416.390) * (-415.517) [-413.901] (-413.897) (-416.602) -- 0:00:28
Average standard deviation of split frequencies: 0.011600
520500 -- (-414.552) (-416.792) (-417.968) [-415.554] * (-415.514) [-413.835] (-412.088) (-414.109) -- 0:00:28
521000 -- (-414.981) (-413.217) (-415.560) [-414.417] * [-414.177] (-418.049) (-412.717) (-414.668) -- 0:00:28
521500 -- (-414.259) (-413.757) (-416.010) [-414.205] * (-415.881) (-412.455) [-414.391] (-414.292) -- 0:00:28
522000 -- (-412.880) (-413.917) [-416.349] (-414.115) * (-413.225) (-416.601) [-413.566] (-415.664) -- 0:00:28
522500 -- (-413.798) [-414.775] (-415.265) (-417.050) * [-413.518] (-414.457) (-415.699) (-413.436) -- 0:00:28
523000 -- [-414.870] (-412.932) (-414.452) (-414.980) * (-413.756) [-411.905] (-415.737) (-415.676) -- 0:00:28
523500 -- (-415.427) [-412.386] (-412.647) (-416.306) * (-414.082) [-413.091] (-412.585) (-413.024) -- 0:00:28
524000 -- (-415.932) (-412.448) (-413.144) [-414.068] * (-413.766) (-413.918) (-412.922) [-418.052] -- 0:00:28
524500 -- (-412.350) [-412.924] (-412.648) (-413.491) * [-412.950] (-413.206) (-413.425) (-422.785) -- 0:00:29
525000 -- (-414.915) (-415.413) (-415.420) [-412.874] * (-417.633) (-411.597) (-416.014) [-414.577] -- 0:00:28
Average standard deviation of split frequencies: 0.011875
525500 -- [-418.268] (-414.460) (-412.465) (-411.972) * (-413.969) (-414.594) (-418.311) [-413.756] -- 0:00:28
526000 -- [-417.038] (-412.514) (-412.637) (-413.298) * (-413.195) [-414.703] (-413.244) (-415.493) -- 0:00:28
526500 -- (-417.200) [-415.423] (-414.277) (-413.301) * (-416.271) [-414.714] (-412.731) (-415.955) -- 0:00:28
527000 -- (-415.906) [-415.343] (-414.353) (-412.829) * (-413.587) (-416.259) (-420.009) [-412.077] -- 0:00:28
527500 -- (-412.428) [-422.358] (-414.975) (-413.701) * (-417.108) (-412.829) [-413.447] (-412.236) -- 0:00:28
528000 -- [-417.322] (-417.774) (-415.216) (-414.641) * (-412.849) [-415.033] (-413.692) (-412.514) -- 0:00:28
528500 -- (-414.189) [-414.255] (-413.425) (-415.650) * (-413.389) [-411.637] (-412.541) (-413.480) -- 0:00:28
529000 -- [-413.837] (-413.404) (-415.217) (-415.406) * (-413.574) (-415.953) [-413.527] (-416.320) -- 0:00:28
529500 -- (-413.532) [-412.850] (-413.713) (-413.366) * (-414.145) (-413.744) (-413.832) [-413.490] -- 0:00:28
530000 -- (-412.753) (-414.324) [-413.836] (-413.450) * [-416.374] (-415.314) (-418.474) (-414.109) -- 0:00:28
Average standard deviation of split frequencies: 0.010993
530500 -- (-412.234) (-413.540) (-418.105) [-417.092] * (-417.944) [-414.667] (-411.792) (-412.145) -- 0:00:28
531000 -- (-415.218) (-412.000) [-414.078] (-414.561) * (-413.801) (-413.859) (-413.200) [-412.320] -- 0:00:28
531500 -- [-414.629] (-414.211) (-414.224) (-415.539) * (-412.363) (-414.521) (-412.990) [-412.205] -- 0:00:28
532000 -- (-414.772) [-412.825] (-417.488) (-421.041) * [-415.743] (-415.358) (-412.961) (-415.420) -- 0:00:28
532500 -- [-414.166] (-412.649) (-414.674) (-417.875) * (-414.241) [-413.584] (-415.667) (-417.961) -- 0:00:28
533000 -- (-411.881) (-414.694) [-413.114] (-415.746) * (-413.091) (-414.159) (-416.154) [-417.129] -- 0:00:28
533500 -- (-412.000) (-413.393) (-413.877) [-413.025] * (-413.541) [-413.012] (-412.276) (-414.709) -- 0:00:27
534000 -- (-416.909) (-419.300) [-412.792] (-416.428) * (-412.049) (-415.191) [-414.165] (-415.236) -- 0:00:27
534500 -- (-416.237) [-412.599] (-412.780) (-414.530) * (-415.169) [-415.246] (-414.192) (-415.906) -- 0:00:27
535000 -- (-413.112) (-416.215) (-412.276) [-413.204] * [-412.832] (-413.340) (-415.488) (-413.599) -- 0:00:27
Average standard deviation of split frequencies: 0.011378
535500 -- (-412.355) [-413.711] (-412.735) (-414.194) * [-413.869] (-413.595) (-414.470) (-412.828) -- 0:00:27
536000 -- (-415.899) (-412.967) (-413.151) [-412.814] * (-417.642) (-414.722) (-413.996) [-412.185] -- 0:00:27
536500 -- [-416.002] (-414.627) (-413.500) (-414.727) * (-413.357) (-413.587) (-414.199) [-413.135] -- 0:00:27
537000 -- (-416.220) (-415.474) [-415.464] (-413.042) * (-413.356) (-413.156) [-413.735] (-411.905) -- 0:00:27
537500 -- [-414.445] (-412.655) (-418.702) (-414.155) * [-414.698] (-415.137) (-418.754) (-413.776) -- 0:00:27
538000 -- [-413.037] (-412.872) (-413.389) (-412.941) * (-413.505) (-413.479) (-415.763) [-411.993] -- 0:00:27
538500 -- (-412.639) (-413.712) [-413.314] (-412.886) * (-414.723) [-414.117] (-412.015) (-414.075) -- 0:00:27
539000 -- [-415.062] (-422.404) (-414.552) (-412.141) * (-412.625) [-413.550] (-411.952) (-421.161) -- 0:00:27
539500 -- (-414.436) [-412.725] (-414.592) (-413.964) * (-413.229) (-412.851) [-411.785] (-418.651) -- 0:00:27
540000 -- (-412.220) (-415.838) [-413.332] (-415.556) * (-414.574) (-416.044) (-414.664) [-416.423] -- 0:00:27
Average standard deviation of split frequencies: 0.010953
540500 -- (-413.545) (-417.382) [-418.668] (-413.456) * (-412.916) (-412.858) (-412.690) [-412.728] -- 0:00:27
541000 -- (-415.847) [-413.610] (-417.224) (-413.200) * (-413.683) (-414.981) (-412.479) [-412.835] -- 0:00:27
541500 -- (-416.046) (-414.563) (-416.309) [-416.074] * (-414.409) (-414.130) [-413.169] (-416.383) -- 0:00:27
542000 -- [-412.096] (-412.623) (-416.054) (-415.779) * (-413.983) [-414.476] (-416.342) (-412.868) -- 0:00:27
542500 -- (-412.024) (-413.916) [-416.092] (-415.300) * (-413.968) (-416.192) (-416.172) [-416.211] -- 0:00:27
543000 -- (-412.177) (-415.242) [-415.156] (-414.767) * (-412.415) [-414.700] (-421.187) (-417.813) -- 0:00:27
543500 -- (-415.920) [-416.808] (-413.099) (-413.434) * (-414.084) [-412.731] (-415.238) (-415.337) -- 0:00:27
544000 -- [-417.254] (-418.702) (-414.765) (-413.329) * (-411.842) [-412.365] (-417.561) (-413.046) -- 0:00:27
544500 -- (-413.696) (-415.401) [-414.510] (-414.725) * (-416.008) (-413.055) (-412.424) [-412.107] -- 0:00:27
545000 -- (-415.791) (-416.588) (-411.825) [-412.218] * (-416.334) [-413.657] (-417.066) (-412.325) -- 0:00:27
Average standard deviation of split frequencies: 0.011008
545500 -- (-412.608) (-413.927) [-411.760] (-414.680) * (-413.299) [-413.763] (-416.498) (-416.286) -- 0:00:27
546000 -- (-411.727) [-413.788] (-414.116) (-417.176) * [-418.936] (-417.129) (-417.208) (-413.344) -- 0:00:27
546500 -- [-412.273] (-413.647) (-413.876) (-417.331) * [-415.071] (-416.795) (-417.606) (-414.067) -- 0:00:27
547000 -- (-414.601) (-414.284) [-415.030] (-418.755) * [-414.583] (-415.953) (-412.857) (-412.754) -- 0:00:27
547500 -- [-418.414] (-415.840) (-414.644) (-417.690) * (-415.797) [-412.565] (-414.213) (-411.809) -- 0:00:27
548000 -- (-424.273) [-415.299] (-413.577) (-417.672) * (-418.459) [-412.702] (-414.594) (-416.881) -- 0:00:27
548500 -- [-415.354] (-412.563) (-412.434) (-412.102) * (-417.603) (-414.914) (-414.061) [-415.343] -- 0:00:27
549000 -- [-413.855] (-414.837) (-414.299) (-411.873) * (-416.924) [-412.313] (-414.247) (-414.229) -- 0:00:27
549500 -- (-413.422) (-416.282) [-412.392] (-413.608) * (-416.299) [-413.936] (-413.198) (-413.405) -- 0:00:27
550000 -- [-414.552] (-414.847) (-412.002) (-413.434) * (-417.043) [-414.793] (-414.678) (-412.995) -- 0:00:27
Average standard deviation of split frequencies: 0.010487
550500 -- (-412.523) [-413.199] (-412.653) (-413.418) * (-414.034) (-415.858) [-417.010] (-412.985) -- 0:00:26
551000 -- (-411.864) (-412.377) (-413.839) [-412.001] * [-414.811] (-416.600) (-412.036) (-420.820) -- 0:00:26
551500 -- (-415.351) [-411.876] (-412.422) (-413.603) * (-412.727) (-412.204) [-412.887] (-412.730) -- 0:00:26
552000 -- (-413.035) [-413.720] (-412.282) (-412.591) * [-415.530] (-414.146) (-413.770) (-416.605) -- 0:00:26
552500 -- (-412.849) (-417.249) (-415.113) [-414.172] * (-412.605) (-412.015) [-414.674] (-413.925) -- 0:00:26
553000 -- (-412.613) (-415.381) (-417.482) [-411.838] * (-414.261) (-413.458) (-412.874) [-412.905] -- 0:00:26
553500 -- (-412.910) (-415.611) (-417.795) [-415.016] * [-412.724] (-417.860) (-413.585) (-412.122) -- 0:00:26
554000 -- (-416.819) (-413.113) [-414.923] (-412.961) * (-412.107) [-414.632] (-413.616) (-413.346) -- 0:00:26
554500 -- (-413.278) (-412.433) [-413.299] (-414.293) * (-419.128) (-414.174) (-412.487) [-417.017] -- 0:00:26
555000 -- (-417.316) [-414.136] (-412.223) (-413.985) * [-413.422] (-411.813) (-414.450) (-415.152) -- 0:00:26
Average standard deviation of split frequencies: 0.010704
555500 -- [-415.630] (-415.245) (-415.082) (-412.279) * (-416.896) (-412.729) [-413.110] (-412.883) -- 0:00:26
556000 -- (-411.806) (-414.529) (-415.629) [-413.629] * [-413.185] (-413.065) (-413.441) (-413.096) -- 0:00:26
556500 -- (-416.618) (-413.073) [-414.116] (-413.420) * (-412.764) (-411.977) (-413.199) [-412.831] -- 0:00:26
557000 -- [-414.723] (-412.601) (-416.178) (-417.196) * (-413.404) [-418.744] (-412.814) (-416.999) -- 0:00:26
557500 -- (-415.720) (-412.791) [-416.199] (-413.089) * (-413.342) (-412.195) [-415.111] (-413.428) -- 0:00:26
558000 -- [-412.933] (-412.788) (-414.869) (-413.302) * (-412.860) [-415.259] (-414.972) (-414.034) -- 0:00:26
558500 -- (-416.445) (-415.733) (-412.772) [-416.359] * (-412.921) [-419.190] (-414.182) (-415.452) -- 0:00:26
559000 -- (-416.419) (-412.938) [-413.457] (-415.679) * [-417.449] (-413.129) (-413.401) (-413.675) -- 0:00:26
559500 -- (-413.572) (-413.064) [-413.897] (-418.998) * (-415.118) (-417.666) [-415.089] (-417.916) -- 0:00:26
560000 -- (-415.570) (-414.745) (-413.744) [-417.236] * [-414.546] (-414.687) (-413.840) (-414.268) -- 0:00:26
Average standard deviation of split frequencies: 0.010878
560500 -- (-414.392) [-413.445] (-413.107) (-414.422) * (-412.152) (-414.857) [-415.882] (-417.799) -- 0:00:26
561000 -- (-413.479) (-412.343) [-419.893] (-411.975) * (-412.284) (-413.075) [-413.382] (-417.040) -- 0:00:26
561500 -- (-414.422) [-413.135] (-416.854) (-413.081) * (-412.517) (-416.107) (-413.752) [-414.164] -- 0:00:26
562000 -- [-412.888] (-415.279) (-417.982) (-412.820) * (-413.682) (-419.622) [-412.481] (-414.900) -- 0:00:26
562500 -- (-413.996) (-414.523) (-419.460) [-413.521] * (-414.700) (-412.694) [-411.847] (-412.670) -- 0:00:26
563000 -- (-413.308) (-417.408) (-414.874) [-411.961] * (-415.878) (-413.051) (-412.448) [-413.142] -- 0:00:26
563500 -- [-412.516] (-414.337) (-416.211) (-414.119) * (-419.201) (-412.168) (-414.800) [-414.915] -- 0:00:26
564000 -- (-412.270) (-415.596) (-414.886) [-414.378] * (-416.915) (-412.257) (-412.681) [-412.839] -- 0:00:26
564500 -- (-415.453) (-413.610) (-412.453) [-412.405] * (-414.207) (-413.028) [-411.898] (-413.882) -- 0:00:26
565000 -- (-413.004) (-414.392) (-415.618) [-416.143] * (-416.122) (-413.562) (-415.295) [-415.201] -- 0:00:26
Average standard deviation of split frequencies: 0.009786
565500 -- [-412.780] (-413.502) (-415.150) (-420.251) * [-415.601] (-413.675) (-415.355) (-412.600) -- 0:00:26
566000 -- (-418.750) (-414.169) (-414.504) [-414.260] * (-413.147) (-411.938) (-411.950) [-413.139] -- 0:00:26
566500 -- (-412.865) [-412.485] (-413.915) (-414.712) * [-412.783] (-414.297) (-413.809) (-413.308) -- 0:00:26
567000 -- (-412.257) [-412.877] (-413.223) (-414.640) * (-414.094) (-412.945) (-415.852) [-415.524] -- 0:00:25
567500 -- (-414.969) (-411.763) (-413.696) [-413.077] * (-416.268) [-412.616] (-417.112) (-413.362) -- 0:00:25
568000 -- [-414.569] (-413.264) (-412.752) (-413.714) * (-413.814) [-412.846] (-416.777) (-414.522) -- 0:00:25
568500 -- (-412.537) (-414.718) (-412.719) [-413.784] * (-412.578) (-415.802) [-413.352] (-414.054) -- 0:00:25
569000 -- [-412.979] (-411.978) (-413.895) (-413.990) * (-413.602) [-414.543] (-411.934) (-417.371) -- 0:00:25
569500 -- (-412.872) (-412.766) [-412.523] (-415.614) * [-413.787] (-415.285) (-413.988) (-416.718) -- 0:00:25
570000 -- (-419.766) (-414.620) (-417.456) [-415.683] * (-414.131) [-413.756] (-416.679) (-412.965) -- 0:00:25
Average standard deviation of split frequencies: 0.010171
570500 -- (-412.894) [-412.171] (-415.246) (-415.290) * (-414.678) (-413.317) (-415.145) [-412.628] -- 0:00:25
571000 -- (-412.862) (-412.028) [-417.160] (-413.687) * (-412.211) [-413.097] (-413.109) (-415.298) -- 0:00:25
571500 -- (-419.543) (-411.810) [-412.761] (-413.580) * (-413.644) [-412.234] (-413.719) (-414.305) -- 0:00:25
572000 -- (-415.442) [-412.234] (-414.380) (-412.634) * (-418.131) [-414.605] (-412.780) (-413.722) -- 0:00:25
572500 -- [-413.656] (-415.896) (-412.634) (-412.006) * [-414.405] (-414.374) (-411.979) (-414.743) -- 0:00:25
573000 -- [-412.966] (-413.376) (-413.366) (-413.656) * (-417.407) (-412.566) [-412.614] (-420.722) -- 0:00:25
573500 -- (-413.588) [-416.086] (-413.730) (-412.187) * (-414.953) (-419.188) [-414.562] (-415.634) -- 0:00:25
574000 -- (-413.108) (-414.015) (-412.907) [-415.937] * (-413.594) [-412.590] (-411.977) (-416.072) -- 0:00:25
574500 -- [-417.469] (-413.682) (-413.837) (-413.542) * [-418.117] (-412.565) (-414.725) (-413.423) -- 0:00:25
575000 -- (-412.829) (-414.075) [-412.018] (-412.866) * (-423.201) (-415.472) (-412.061) [-412.264] -- 0:00:25
Average standard deviation of split frequencies: 0.009463
575500 -- (-412.536) (-412.389) (-413.984) [-413.140] * (-415.097) (-412.880) (-412.960) [-414.373] -- 0:00:25
576000 -- (-417.841) (-412.847) (-415.857) [-413.740] * (-420.634) [-413.219] (-414.515) (-413.847) -- 0:00:25
576500 -- (-413.283) (-412.672) (-414.152) [-413.238] * (-418.509) (-420.331) (-412.986) [-412.583] -- 0:00:25
577000 -- (-412.041) [-415.413] (-413.028) (-416.819) * (-412.325) [-416.102] (-412.310) (-412.896) -- 0:00:25
577500 -- [-413.292] (-413.661) (-412.891) (-412.795) * [-414.123] (-415.504) (-416.375) (-413.719) -- 0:00:25
578000 -- (-414.577) (-414.256) [-416.138] (-412.405) * [-412.615] (-413.869) (-412.556) (-413.135) -- 0:00:25
578500 -- [-413.956] (-413.189) (-414.839) (-412.530) * [-412.219] (-413.615) (-414.476) (-413.431) -- 0:00:25
579000 -- [-413.046] (-412.666) (-414.221) (-412.894) * (-412.612) (-412.809) (-415.718) [-416.904] -- 0:00:25
579500 -- (-412.451) (-416.929) [-412.385] (-413.926) * (-412.558) [-413.007] (-413.824) (-412.993) -- 0:00:25
580000 -- (-413.584) (-416.432) [-413.083] (-416.120) * (-416.729) (-413.008) (-417.536) [-416.838] -- 0:00:25
Average standard deviation of split frequencies: 0.008879
580500 -- (-412.050) [-422.056] (-412.768) (-412.049) * (-418.482) (-417.425) (-415.433) [-412.039] -- 0:00:25
581000 -- (-412.880) [-416.462] (-412.053) (-414.864) * (-417.407) (-416.083) [-415.223] (-413.217) -- 0:00:25
581500 -- [-414.353] (-413.667) (-413.013) (-413.312) * [-416.345] (-414.478) (-414.889) (-414.116) -- 0:00:25
582000 -- (-412.662) (-413.240) (-413.523) [-412.985] * (-415.834) (-415.636) [-412.445] (-415.474) -- 0:00:25
582500 -- (-412.142) (-414.623) (-416.847) [-416.341] * (-418.199) [-412.394] (-412.127) (-414.056) -- 0:00:25
583000 -- (-415.838) (-413.656) [-414.977] (-414.655) * (-414.894) (-417.087) (-416.384) [-413.102] -- 0:00:25
583500 -- (-419.235) [-415.936] (-417.108) (-416.170) * (-415.651) (-415.468) [-414.866] (-413.062) -- 0:00:24
584000 -- (-415.988) [-414.712] (-414.588) (-412.959) * (-417.148) [-412.010] (-412.182) (-412.278) -- 0:00:24
584500 -- [-413.662] (-413.811) (-419.813) (-414.738) * (-413.287) (-412.869) [-412.274] (-413.151) -- 0:00:24
585000 -- [-416.389] (-413.384) (-412.775) (-413.910) * (-411.940) [-413.786] (-414.213) (-416.924) -- 0:00:24
Average standard deviation of split frequencies: 0.008547
585500 -- [-413.366] (-415.346) (-413.114) (-412.494) * (-413.337) (-413.082) [-414.052] (-417.966) -- 0:00:24
586000 -- (-413.809) [-414.140] (-413.795) (-411.968) * (-415.261) (-414.196) [-413.022] (-412.733) -- 0:00:24
586500 -- (-415.833) (-415.125) [-413.528] (-412.335) * (-417.042) (-413.810) [-413.330] (-411.720) -- 0:00:24
587000 -- [-412.427] (-414.892) (-413.500) (-412.052) * (-415.608) (-414.447) [-412.735] (-415.768) -- 0:00:24
587500 -- [-414.021] (-416.099) (-413.438) (-416.072) * [-415.430] (-412.553) (-413.555) (-413.255) -- 0:00:24
588000 -- (-416.765) (-416.419) (-412.779) [-416.586] * (-413.087) (-411.618) (-415.178) [-413.218] -- 0:00:24
588500 -- (-413.384) [-413.301] (-414.919) (-417.786) * (-413.419) (-411.883) (-414.144) [-413.105] -- 0:00:24
589000 -- [-413.962] (-416.764) (-412.587) (-415.924) * [-415.191] (-414.870) (-413.033) (-414.026) -- 0:00:24
589500 -- (-414.430) (-416.886) (-412.883) [-413.647] * (-417.115) [-413.376] (-412.388) (-415.305) -- 0:00:24
590000 -- (-413.473) (-415.254) [-414.800] (-415.614) * [-416.637] (-412.966) (-413.065) (-412.602) -- 0:00:24
Average standard deviation of split frequencies: 0.008131
590500 -- (-412.794) [-413.580] (-414.655) (-414.872) * [-412.721] (-413.736) (-412.186) (-416.245) -- 0:00:24
591000 -- (-414.294) (-414.923) [-413.255] (-413.758) * (-414.132) (-415.108) (-414.061) [-413.102] -- 0:00:24
591500 -- (-413.862) (-413.871) [-414.485] (-414.258) * [-412.054] (-414.060) (-414.004) (-413.642) -- 0:00:24
592000 -- [-413.896] (-413.187) (-414.156) (-411.907) * [-414.766] (-415.004) (-413.307) (-414.201) -- 0:00:24
592500 -- (-416.836) [-416.203] (-415.746) (-416.935) * [-413.316] (-417.854) (-414.863) (-412.809) -- 0:00:24
593000 -- (-412.385) (-414.010) [-414.296] (-418.359) * (-414.989) (-416.705) (-411.917) [-412.088] -- 0:00:24
593500 -- (-415.497) [-413.140] (-416.360) (-413.377) * [-414.270] (-417.602) (-416.529) (-413.624) -- 0:00:24
594000 -- [-415.619] (-414.885) (-413.384) (-418.471) * [-413.391] (-412.765) (-415.420) (-413.768) -- 0:00:24
594500 -- (-414.571) (-414.341) [-413.343] (-413.950) * [-413.150] (-413.732) (-418.797) (-414.334) -- 0:00:24
595000 -- [-417.081] (-413.368) (-417.241) (-413.995) * (-417.387) [-414.527] (-415.123) (-416.383) -- 0:00:24
Average standard deviation of split frequencies: 0.008008
595500 -- [-413.120] (-414.638) (-413.185) (-414.348) * [-415.416] (-413.870) (-413.611) (-415.869) -- 0:00:24
596000 -- (-420.139) (-417.011) (-413.436) [-416.002] * (-414.718) (-413.029) [-413.416] (-415.056) -- 0:00:24
596500 -- (-412.938) [-419.938] (-413.548) (-415.155) * (-413.353) [-412.270] (-417.037) (-414.893) -- 0:00:24
597000 -- (-411.810) [-413.020] (-415.170) (-412.731) * (-412.747) (-415.536) [-416.616] (-413.929) -- 0:00:24
597500 -- (-412.987) (-416.455) (-420.801) [-414.897] * (-411.931) (-412.751) [-416.703] (-417.212) -- 0:00:24
598000 -- (-417.591) [-414.629] (-413.967) (-412.247) * (-413.650) (-414.231) [-412.860] (-412.662) -- 0:00:24
598500 -- (-413.381) (-416.207) (-412.983) [-413.867] * [-414.803] (-419.137) (-412.941) (-412.656) -- 0:00:24
599000 -- (-414.291) (-414.433) [-414.858] (-412.723) * (-412.838) (-414.651) (-413.823) [-414.489] -- 0:00:24
599500 -- [-414.295] (-417.912) (-415.106) (-413.834) * (-413.891) (-416.941) (-416.924) [-412.898] -- 0:00:24
600000 -- (-411.768) [-418.788] (-413.351) (-418.452) * [-413.883] (-412.433) (-415.581) (-418.278) -- 0:00:24
Average standard deviation of split frequencies: 0.007652
600500 -- (-414.513) (-413.820) [-412.465] (-422.861) * (-413.978) (-416.502) [-412.402] (-417.244) -- 0:00:23
601000 -- (-413.399) (-413.035) [-412.758] (-416.318) * (-417.334) (-414.853) [-416.601] (-417.424) -- 0:00:23
601500 -- (-412.091) [-412.701] (-418.948) (-411.849) * [-412.987] (-417.911) (-413.574) (-414.447) -- 0:00:23
602000 -- (-412.533) (-414.497) (-421.814) [-416.018] * (-414.230) (-413.830) [-413.451] (-411.846) -- 0:00:23
602500 -- (-418.893) (-414.979) (-413.749) [-412.667] * [-412.177] (-416.560) (-413.793) (-418.736) -- 0:00:23
603000 -- [-412.847] (-417.918) (-412.721) (-417.020) * (-412.105) [-413.654] (-412.019) (-413.563) -- 0:00:23
603500 -- (-414.196) [-414.610] (-412.204) (-412.319) * (-411.974) [-413.586] (-413.519) (-413.713) -- 0:00:23
604000 -- [-414.620] (-417.180) (-411.893) (-413.029) * (-413.735) [-413.278] (-416.274) (-415.783) -- 0:00:23
604500 -- (-414.333) (-413.615) (-414.689) [-412.954] * [-412.047] (-412.618) (-412.846) (-416.036) -- 0:00:23
605000 -- [-412.488] (-416.251) (-414.229) (-412.903) * [-414.191] (-412.618) (-413.731) (-418.040) -- 0:00:23
Average standard deviation of split frequencies: 0.007876
605500 -- (-412.928) (-420.912) [-414.429] (-413.881) * (-412.416) [-412.640] (-412.215) (-412.470) -- 0:00:23
606000 -- (-413.575) (-414.244) [-417.633] (-417.254) * (-414.906) (-414.382) (-415.419) [-412.234] -- 0:00:23
606500 -- (-413.286) (-414.703) [-413.477] (-415.500) * [-413.736] (-413.115) (-415.359) (-415.733) -- 0:00:23
607000 -- [-413.139] (-414.837) (-415.280) (-414.874) * [-414.247] (-414.193) (-412.705) (-416.467) -- 0:00:23
607500 -- [-412.351] (-413.592) (-417.223) (-411.930) * (-420.559) (-416.024) (-413.320) [-417.904] -- 0:00:23
608000 -- [-414.192] (-412.179) (-420.694) (-413.193) * (-415.374) (-416.102) (-412.829) [-413.403] -- 0:00:23
608500 -- (-415.888) [-412.537] (-415.049) (-413.894) * [-414.370] (-414.283) (-413.187) (-416.893) -- 0:00:23
609000 -- (-413.099) (-413.165) [-412.438] (-413.678) * (-413.652) (-412.315) [-414.242] (-412.245) -- 0:00:23
609500 -- (-416.212) [-414.445] (-415.791) (-415.108) * (-414.144) [-414.139] (-414.234) (-414.513) -- 0:00:23
610000 -- (-413.056) (-414.734) (-415.645) [-413.749] * (-415.365) [-412.012] (-415.805) (-414.476) -- 0:00:23
Average standard deviation of split frequencies: 0.007864
610500 -- (-414.368) (-417.643) (-413.886) [-412.629] * (-412.749) (-415.231) [-412.691] (-414.046) -- 0:00:23
611000 -- (-413.327) (-415.300) (-413.980) [-415.646] * [-413.280] (-413.826) (-415.725) (-413.970) -- 0:00:23
611500 -- (-414.057) [-412.153] (-413.891) (-415.985) * [-416.300] (-413.514) (-412.869) (-415.659) -- 0:00:23
612000 -- (-416.684) [-412.959] (-412.970) (-414.182) * [-414.617] (-414.641) (-416.374) (-412.553) -- 0:00:23
612500 -- [-414.607] (-412.483) (-414.128) (-411.753) * (-414.128) (-417.452) [-413.944] (-416.292) -- 0:00:23
613000 -- (-413.512) [-413.893] (-414.204) (-412.135) * (-417.229) [-418.047] (-414.037) (-416.742) -- 0:00:23
613500 -- [-415.613] (-414.629) (-414.107) (-412.450) * [-414.365] (-415.135) (-413.351) (-412.124) -- 0:00:23
614000 -- (-415.138) (-412.355) (-412.954) [-412.963] * (-413.165) (-412.588) [-416.240] (-412.593) -- 0:00:23
614500 -- (-417.468) (-412.497) (-412.869) [-413.185] * [-412.576] (-417.762) (-413.170) (-415.614) -- 0:00:23
615000 -- (-414.956) (-413.011) [-414.229] (-413.462) * [-413.274] (-414.039) (-414.774) (-414.309) -- 0:00:23
Average standard deviation of split frequencies: 0.008274
615500 -- (-419.214) [-416.903] (-421.577) (-413.352) * [-412.690] (-414.048) (-414.887) (-414.164) -- 0:00:23
616000 -- [-413.092] (-417.000) (-411.614) (-413.324) * [-415.635] (-414.406) (-417.595) (-413.737) -- 0:00:23
616500 -- (-417.167) (-417.617) (-415.479) [-413.448] * (-415.215) (-413.125) [-412.148] (-418.050) -- 0:00:23
617000 -- (-413.824) (-419.326) [-412.609] (-415.503) * (-414.235) (-414.408) [-412.961] (-413.002) -- 0:00:22
617500 -- (-414.910) (-413.600) (-413.418) [-417.565] * [-416.174] (-412.418) (-417.669) (-415.368) -- 0:00:22
618000 -- (-413.586) (-412.838) [-416.862] (-413.414) * [-416.116] (-412.769) (-412.973) (-412.887) -- 0:00:22
618500 -- (-418.063) [-412.838] (-414.804) (-413.711) * (-415.517) (-414.600) [-412.042] (-414.664) -- 0:00:22
619000 -- [-413.371] (-414.172) (-412.178) (-416.876) * [-416.056] (-413.057) (-412.434) (-414.746) -- 0:00:22
619500 -- [-415.543] (-413.476) (-418.384) (-412.968) * (-415.099) [-412.966] (-416.705) (-414.869) -- 0:00:22
620000 -- (-411.719) (-412.450) (-416.555) [-413.889] * (-413.290) (-413.835) [-415.677] (-413.139) -- 0:00:22
Average standard deviation of split frequencies: 0.008212
620500 -- (-419.482) [-413.622] (-413.395) (-413.359) * (-412.335) (-417.774) [-413.431] (-411.771) -- 0:00:22
621000 -- (-422.451) [-414.231] (-415.847) (-414.160) * [-413.766] (-416.934) (-412.748) (-415.942) -- 0:00:22
621500 -- [-412.988] (-417.733) (-416.568) (-415.179) * (-412.306) (-414.553) [-413.224] (-414.095) -- 0:00:22
622000 -- (-412.560) (-417.019) (-413.273) [-418.532] * [-413.845] (-417.288) (-411.860) (-414.533) -- 0:00:22
622500 -- (-415.125) (-412.379) (-413.206) [-411.791] * (-416.875) (-415.563) (-412.815) [-414.741] -- 0:00:22
623000 -- [-413.820] (-412.620) (-416.436) (-414.572) * (-412.723) (-414.933) (-412.678) [-415.263] -- 0:00:22
623500 -- (-412.806) [-413.367] (-414.059) (-415.157) * (-412.806) [-413.061] (-413.173) (-415.110) -- 0:00:22
624000 -- (-413.773) [-415.295] (-414.858) (-412.753) * [-414.424] (-415.440) (-413.513) (-416.940) -- 0:00:22
624500 -- [-412.257] (-413.679) (-412.109) (-412.048) * (-411.982) (-414.559) [-414.839] (-415.868) -- 0:00:22
625000 -- (-415.469) (-416.153) (-412.182) [-412.711] * (-412.157) [-413.812] (-415.155) (-416.585) -- 0:00:22
Average standard deviation of split frequencies: 0.008566
625500 -- (-415.476) [-414.005] (-412.461) (-412.292) * (-417.126) (-416.097) [-415.120] (-412.615) -- 0:00:22
626000 -- (-414.660) (-413.983) [-414.150] (-415.555) * (-414.565) (-413.308) (-413.379) [-412.311] -- 0:00:22
626500 -- (-414.713) [-414.071] (-414.699) (-414.713) * (-415.892) (-412.669) [-412.796] (-413.631) -- 0:00:22
627000 -- [-412.459] (-413.701) (-414.062) (-413.986) * [-413.045] (-413.336) (-415.300) (-414.752) -- 0:00:22
627500 -- (-413.600) (-415.748) (-412.282) [-412.368] * (-422.390) (-412.358) [-414.234] (-414.573) -- 0:00:22
628000 -- [-415.503] (-412.431) (-413.844) (-413.055) * (-417.548) (-413.568) (-416.642) [-415.342] -- 0:00:22
628500 -- (-412.923) (-414.965) [-419.415] (-414.399) * (-415.728) (-414.116) (-413.331) [-416.000] -- 0:00:22
629000 -- (-411.950) [-413.975] (-416.040) (-413.826) * [-414.085] (-412.998) (-413.150) (-413.103) -- 0:00:22
629500 -- (-417.128) [-413.468] (-416.948) (-418.874) * (-412.310) [-412.661] (-412.673) (-417.916) -- 0:00:22
630000 -- (-420.404) (-415.258) [-414.446] (-413.117) * (-411.933) (-416.494) [-413.357] (-414.004) -- 0:00:22
Average standard deviation of split frequencies: 0.008876
630500 -- [-414.670] (-412.967) (-413.349) (-412.445) * [-412.850] (-413.396) (-415.052) (-413.228) -- 0:00:22
631000 -- (-413.023) [-411.996] (-413.110) (-413.019) * [-414.523] (-414.673) (-414.851) (-417.644) -- 0:00:22
631500 -- (-416.647) (-413.105) [-413.112] (-413.771) * (-414.739) (-415.276) [-412.975] (-413.786) -- 0:00:22
632000 -- (-416.945) (-413.277) (-414.437) [-413.190] * (-412.925) (-414.274) (-416.831) [-414.748] -- 0:00:22
632500 -- (-414.493) (-416.727) [-415.981] (-412.392) * (-412.911) [-412.537] (-413.015) (-411.901) -- 0:00:22
633000 -- (-412.967) (-412.979) (-416.380) [-413.836] * (-412.494) (-412.636) (-416.854) [-414.017] -- 0:00:22
633500 -- (-416.240) (-413.404) [-412.685] (-414.976) * [-412.590] (-414.599) (-413.452) (-413.530) -- 0:00:21
634000 -- (-412.194) [-412.386] (-413.634) (-413.172) * (-413.040) [-414.560] (-417.031) (-414.388) -- 0:00:21
634500 -- (-412.526) [-413.583] (-413.898) (-415.900) * (-414.620) (-416.349) [-412.757] (-416.242) -- 0:00:21
635000 -- [-414.749] (-414.724) (-414.534) (-415.687) * [-412.444] (-416.752) (-413.393) (-415.021) -- 0:00:21
Average standard deviation of split frequencies: 0.009543
635500 -- [-412.334] (-414.256) (-414.703) (-412.226) * (-414.932) (-418.937) [-413.570] (-412.636) -- 0:00:21
636000 -- (-416.563) [-413.156] (-415.070) (-414.754) * [-414.422] (-413.024) (-413.248) (-419.659) -- 0:00:21
636500 -- (-416.648) (-416.503) [-413.915] (-412.524) * (-413.892) [-413.278] (-417.290) (-423.219) -- 0:00:21
637000 -- (-412.346) [-413.154] (-416.984) (-413.359) * (-414.023) (-415.453) [-416.103] (-419.802) -- 0:00:21
637500 -- [-412.061] (-415.911) (-416.271) (-415.403) * (-413.244) (-417.473) (-412.434) [-413.843] -- 0:00:21
638000 -- (-413.696) [-414.454] (-416.074) (-414.131) * [-412.548] (-417.573) (-413.329) (-415.912) -- 0:00:21
638500 -- (-414.546) [-416.066] (-412.805) (-413.182) * (-418.161) (-413.365) [-414.959] (-414.997) -- 0:00:21
639000 -- (-412.737) [-411.852] (-415.135) (-415.153) * (-413.849) [-414.618] (-413.131) (-419.146) -- 0:00:21
639500 -- (-414.634) [-412.924] (-414.144) (-414.225) * [-415.446] (-412.798) (-414.197) (-414.969) -- 0:00:21
640000 -- (-413.317) (-414.123) [-414.273] (-417.178) * (-412.815) (-414.161) (-413.431) [-412.953] -- 0:00:21
Average standard deviation of split frequencies: 0.010025
640500 -- [-412.067] (-414.027) (-416.072) (-411.918) * (-418.310) [-412.611] (-414.920) (-413.070) -- 0:00:21
641000 -- [-413.407] (-412.981) (-412.688) (-412.816) * (-414.793) [-412.435] (-413.262) (-412.965) -- 0:00:21
641500 -- [-416.921] (-414.023) (-412.845) (-413.652) * (-412.966) [-413.289] (-412.566) (-411.892) -- 0:00:21
642000 -- (-416.242) (-412.132) (-412.300) [-414.408] * (-414.542) [-415.309] (-413.640) (-414.798) -- 0:00:21
642500 -- (-417.152) (-412.818) [-413.463] (-415.117) * (-413.314) (-412.726) [-413.495] (-412.318) -- 0:00:21
643000 -- (-417.434) [-411.683] (-413.710) (-415.360) * (-414.650) (-417.278) [-414.997] (-413.860) -- 0:00:21
643500 -- [-414.900] (-411.867) (-416.019) (-415.872) * (-413.701) (-416.115) (-413.942) [-414.002] -- 0:00:21
644000 -- (-412.492) (-412.631) (-413.351) [-415.890] * [-412.864] (-417.809) (-413.820) (-414.901) -- 0:00:21
644500 -- (-413.786) [-414.082] (-411.969) (-412.911) * (-415.389) (-412.720) (-414.206) [-415.049] -- 0:00:21
645000 -- (-413.176) (-412.083) [-411.903] (-412.974) * [-416.835] (-412.677) (-413.476) (-413.519) -- 0:00:21
Average standard deviation of split frequencies: 0.010079
645500 -- (-413.214) [-414.811] (-411.874) (-413.373) * (-418.335) (-412.366) (-413.173) [-412.563] -- 0:00:21
646000 -- (-414.291) (-413.230) (-416.076) [-413.527] * (-413.751) (-417.536) (-414.833) [-412.100] -- 0:00:21
646500 -- (-413.167) (-414.404) (-417.586) [-414.092] * (-411.747) (-416.575) (-414.200) [-414.057] -- 0:00:21
647000 -- (-413.631) (-414.155) [-416.564] (-414.105) * (-413.512) [-414.147] (-414.098) (-413.477) -- 0:00:21
647500 -- [-414.266] (-413.008) (-412.671) (-414.157) * (-417.298) (-412.760) [-415.450] (-414.196) -- 0:00:21
648000 -- (-414.069) [-413.553] (-412.934) (-414.908) * [-415.319] (-412.709) (-416.965) (-418.952) -- 0:00:21
648500 -- (-414.025) (-412.681) (-415.029) [-414.508] * (-412.575) [-412.563] (-421.625) (-413.428) -- 0:00:21
649000 -- [-412.478] (-413.416) (-416.259) (-417.544) * (-412.982) [-413.428] (-420.695) (-415.015) -- 0:00:21
649500 -- [-411.973] (-413.209) (-415.398) (-414.322) * (-412.766) [-412.618] (-412.501) (-412.665) -- 0:00:21
650000 -- [-411.911] (-415.766) (-413.897) (-415.426) * [-411.905] (-415.282) (-413.615) (-412.841) -- 0:00:21
Average standard deviation of split frequencies: 0.009735
650500 -- (-413.003) [-412.424] (-414.102) (-417.181) * (-412.246) (-412.916) [-412.574] (-414.168) -- 0:00:20
651000 -- (-415.115) (-415.367) [-411.666] (-420.696) * (-413.157) (-416.325) [-414.019] (-412.613) -- 0:00:20
651500 -- (-413.956) [-413.226] (-412.837) (-414.189) * (-413.157) (-415.246) [-413.812] (-416.550) -- 0:00:20
652000 -- [-412.609] (-417.951) (-418.317) (-414.135) * (-412.813) (-417.226) [-413.051] (-412.578) -- 0:00:20
652500 -- (-415.662) (-414.015) (-416.248) [-416.454] * (-414.731) [-411.752] (-417.135) (-414.755) -- 0:00:20
653000 -- (-414.199) [-413.135] (-419.042) (-416.662) * [-415.472] (-413.460) (-413.810) (-416.703) -- 0:00:20
653500 -- (-414.132) (-419.173) (-415.714) [-415.281] * (-415.388) [-414.058] (-415.547) (-414.205) -- 0:00:20
654000 -- (-412.937) (-415.466) [-413.376] (-412.556) * (-416.086) (-413.592) (-414.177) [-413.141] -- 0:00:20
654500 -- (-414.835) (-415.612) [-413.211] (-412.710) * (-415.119) (-412.576) [-415.875] (-415.948) -- 0:00:20
655000 -- [-413.300] (-415.088) (-412.588) (-412.108) * (-413.219) (-414.005) [-412.898] (-416.942) -- 0:00:20
Average standard deviation of split frequencies: 0.010510
655500 -- (-415.063) [-413.600] (-415.255) (-416.303) * [-414.206] (-416.719) (-413.885) (-412.233) -- 0:00:20
656000 -- (-413.344) [-414.813] (-414.013) (-413.313) * (-412.502) [-413.943] (-414.775) (-413.719) -- 0:00:20
656500 -- [-411.585] (-416.912) (-412.303) (-414.320) * (-411.555) (-413.424) [-412.883] (-415.871) -- 0:00:20
657000 -- [-413.713] (-414.300) (-415.185) (-414.356) * (-413.216) [-413.185] (-418.496) (-413.895) -- 0:00:20
657500 -- [-413.820] (-412.992) (-415.228) (-412.460) * (-413.958) (-413.301) (-413.398) [-413.066] -- 0:00:20
658000 -- (-412.275) (-416.248) [-414.505] (-419.335) * (-413.228) [-412.975] (-414.582) (-412.310) -- 0:00:20
658500 -- (-413.922) (-416.222) (-414.059) [-413.867] * (-412.963) [-413.007] (-417.546) (-412.314) -- 0:00:20
659000 -- [-415.241] (-413.000) (-416.819) (-415.076) * (-412.605) [-413.722] (-416.790) (-413.789) -- 0:00:20
659500 -- [-412.457] (-414.411) (-413.665) (-418.583) * (-415.487) [-413.199] (-418.188) (-413.330) -- 0:00:20
660000 -- (-414.501) [-414.792] (-411.855) (-414.925) * (-414.328) (-417.830) [-420.038] (-412.433) -- 0:00:20
Average standard deviation of split frequencies: 0.011193
660500 -- (-412.582) [-413.324] (-415.299) (-412.371) * [-412.533] (-413.595) (-412.651) (-414.538) -- 0:00:20
661000 -- (-412.067) (-414.040) [-414.097] (-412.085) * (-411.603) (-414.005) [-413.414] (-415.413) -- 0:00:20
661500 -- (-414.170) [-415.470] (-411.776) (-416.474) * (-413.973) (-413.962) (-415.016) [-413.800] -- 0:00:20
662000 -- [-413.310] (-419.965) (-412.178) (-414.219) * [-414.343] (-417.071) (-412.936) (-415.987) -- 0:00:20
662500 -- [-412.780] (-414.646) (-412.385) (-413.936) * (-418.140) (-416.412) (-415.453) [-412.550] -- 0:00:20
663000 -- (-412.335) (-412.154) (-411.630) [-414.376] * (-414.798) (-415.293) [-412.544] (-414.495) -- 0:00:20
663500 -- (-415.229) (-412.803) (-413.390) [-414.279] * [-415.560] (-412.920) (-413.261) (-413.517) -- 0:00:20
664000 -- [-412.972] (-415.112) (-414.150) (-414.440) * [-416.004] (-414.388) (-413.942) (-413.343) -- 0:00:20
664500 -- (-413.771) [-412.004] (-415.244) (-413.071) * (-415.296) [-414.064] (-414.645) (-413.626) -- 0:00:20
665000 -- (-413.475) (-414.083) [-414.136] (-412.913) * (-417.429) (-414.094) [-414.082] (-413.704) -- 0:00:20
Average standard deviation of split frequencies: 0.010706
665500 -- (-414.932) (-413.305) [-416.181] (-414.336) * (-415.830) (-413.597) [-412.276] (-415.003) -- 0:00:20
666000 -- (-415.740) [-413.840] (-416.141) (-414.075) * (-423.486) [-413.427] (-412.318) (-415.619) -- 0:00:20
666500 -- (-417.759) (-416.672) [-415.183] (-412.282) * [-416.744] (-415.684) (-413.098) (-413.240) -- 0:00:20
667000 -- (-416.861) (-417.680) [-414.714] (-413.345) * [-413.864] (-414.520) (-414.861) (-415.501) -- 0:00:19
667500 -- (-414.282) (-414.252) (-415.382) [-418.918] * (-415.933) (-414.790) [-414.279] (-413.016) -- 0:00:19
668000 -- (-414.634) [-412.609] (-416.415) (-412.873) * (-414.929) (-413.915) (-414.320) [-415.408] -- 0:00:19
668500 -- (-412.902) (-416.713) (-415.745) [-413.571] * (-412.618) [-414.430] (-414.108) (-414.866) -- 0:00:19
669000 -- (-414.133) (-416.439) [-413.915] (-412.003) * [-413.528] (-414.006) (-412.940) (-414.180) -- 0:00:19
669500 -- [-414.164] (-413.677) (-419.104) (-413.516) * (-415.502) (-414.301) [-412.169] (-412.877) -- 0:00:19
670000 -- (-415.955) (-411.893) (-414.174) [-414.608] * (-417.568) (-414.554) [-413.545] (-415.665) -- 0:00:19
Average standard deviation of split frequencies: 0.011027
670500 -- (-415.518) (-412.648) [-412.432] (-415.258) * (-413.054) (-413.977) [-412.551] (-412.293) -- 0:00:19
671000 -- (-413.135) (-413.550) (-413.381) [-414.573] * [-412.303] (-413.960) (-412.538) (-412.951) -- 0:00:19
671500 -- [-414.032] (-412.884) (-413.920) (-413.487) * (-415.653) (-411.753) (-412.318) [-415.295] -- 0:00:19
672000 -- (-418.196) [-413.219] (-413.810) (-412.313) * (-416.310) (-412.879) [-412.572] (-417.234) -- 0:00:19
672500 -- (-413.765) (-412.947) (-419.960) [-416.704] * (-412.454) (-412.073) (-413.756) [-413.389] -- 0:00:19
673000 -- (-412.669) (-415.058) [-416.294] (-415.701) * (-417.097) (-412.514) [-412.866] (-413.281) -- 0:00:19
673500 -- (-412.540) (-413.171) [-415.185] (-414.460) * (-418.253) [-412.999] (-416.044) (-413.707) -- 0:00:19
674000 -- (-416.676) [-413.245] (-414.117) (-415.340) * (-421.179) (-414.154) (-414.299) [-413.452] -- 0:00:19
674500 -- (-414.726) (-413.051) (-412.783) [-414.220] * (-414.185) (-414.584) [-413.261] (-413.398) -- 0:00:19
675000 -- (-414.816) [-414.148] (-412.998) (-416.229) * (-413.434) [-414.433] (-414.282) (-412.598) -- 0:00:19
Average standard deviation of split frequencies: 0.010896
675500 -- (-413.710) (-412.728) [-414.559] (-415.207) * (-412.371) (-412.654) (-413.935) [-412.204] -- 0:00:19
676000 -- (-416.447) (-417.685) [-413.230] (-413.098) * (-412.442) (-414.210) [-416.633] (-412.202) -- 0:00:19
676500 -- [-414.582] (-418.698) (-418.953) (-414.354) * (-411.983) [-415.910] (-412.478) (-413.031) -- 0:00:19
677000 -- (-411.967) (-412.734) [-413.356] (-416.890) * [-412.737] (-415.213) (-412.052) (-413.644) -- 0:00:19
677500 -- (-414.789) [-415.149] (-414.996) (-413.156) * (-413.896) [-412.847] (-411.855) (-413.327) -- 0:00:19
678000 -- (-414.101) (-416.143) [-414.082] (-412.175) * (-414.074) (-411.975) (-412.736) [-416.201] -- 0:00:19
678500 -- (-412.699) (-414.730) (-413.716) [-412.867] * [-413.462] (-412.726) (-411.648) (-415.154) -- 0:00:19
679000 -- (-413.832) (-419.066) [-414.923] (-414.537) * (-414.448) (-415.073) [-418.170] (-413.999) -- 0:00:19
679500 -- (-416.926) (-413.958) [-411.965] (-415.061) * (-415.532) [-413.588] (-421.020) (-414.543) -- 0:00:19
680000 -- (-415.118) [-413.513] (-412.479) (-413.422) * (-413.166) (-413.806) [-414.698] (-415.748) -- 0:00:19
Average standard deviation of split frequencies: 0.010908
680500 -- [-413.632] (-412.768) (-413.381) (-414.524) * (-412.653) [-416.167] (-412.425) (-418.588) -- 0:00:19
681000 -- [-413.883] (-413.196) (-413.882) (-415.243) * [-411.788] (-413.824) (-414.684) (-412.067) -- 0:00:19
681500 -- [-413.394] (-413.947) (-413.011) (-411.901) * (-413.836) (-418.100) [-413.159] (-412.149) -- 0:00:19
682000 -- (-411.995) (-416.268) (-414.323) [-411.909] * (-417.687) (-412.864) [-418.062] (-412.371) -- 0:00:19
682500 -- [-411.979] (-413.100) (-414.757) (-415.598) * (-414.792) (-412.597) (-413.657) [-416.269] -- 0:00:19
683000 -- [-414.333] (-412.544) (-414.190) (-414.739) * (-413.546) (-411.903) [-414.553] (-418.750) -- 0:00:19
683500 -- [-413.891] (-412.220) (-419.821) (-413.028) * (-412.579) (-412.273) (-413.682) [-415.476] -- 0:00:18
684000 -- [-413.920] (-411.536) (-412.123) (-416.079) * (-413.767) (-413.502) [-414.306] (-414.064) -- 0:00:18
684500 -- (-413.189) (-416.342) [-413.978] (-414.216) * (-416.667) (-418.468) (-415.323) [-419.969] -- 0:00:18
685000 -- [-413.698] (-415.617) (-415.290) (-413.172) * (-412.606) (-414.593) [-412.292] (-416.642) -- 0:00:18
Average standard deviation of split frequencies: 0.010952
685500 -- (-412.596) [-414.025] (-414.047) (-412.468) * (-417.785) (-415.414) [-412.622] (-416.181) -- 0:00:18
686000 -- (-411.624) (-411.876) [-415.684] (-415.900) * [-414.117] (-412.472) (-414.246) (-417.014) -- 0:00:18
686500 -- (-413.945) [-414.108] (-412.703) (-416.920) * (-416.678) (-412.235) [-412.895] (-416.444) -- 0:00:18
687000 -- (-413.867) (-411.775) [-414.700] (-415.947) * (-413.423) (-413.113) (-413.200) [-412.411] -- 0:00:18
687500 -- (-414.679) (-412.813) (-414.263) [-411.891] * (-414.331) (-413.106) (-412.234) [-414.285] -- 0:00:18
688000 -- (-417.616) (-414.733) (-414.976) [-412.949] * (-412.614) (-413.993) [-414.787] (-414.260) -- 0:00:18
688500 -- (-415.545) (-414.041) [-416.504] (-416.154) * (-412.874) (-414.635) (-415.263) [-413.380] -- 0:00:18
689000 -- (-413.904) [-412.371] (-415.205) (-414.091) * [-412.765] (-415.449) (-414.404) (-414.166) -- 0:00:18
689500 -- (-422.585) [-417.517] (-413.886) (-417.290) * (-413.361) (-414.336) (-416.450) [-413.711] -- 0:00:18
690000 -- (-414.499) (-415.371) (-412.848) [-412.387] * (-415.521) [-411.830] (-413.857) (-412.505) -- 0:00:18
Average standard deviation of split frequencies: 0.010793
690500 -- (-413.056) [-412.801] (-412.604) (-413.674) * (-413.732) [-413.531] (-413.283) (-414.851) -- 0:00:18
691000 -- (-413.370) (-413.030) [-413.731] (-412.841) * (-417.834) (-413.536) (-412.891) [-414.324] -- 0:00:18
691500 -- [-416.768] (-415.360) (-413.522) (-414.116) * (-415.709) (-416.939) [-412.659] (-412.306) -- 0:00:18
692000 -- (-413.433) (-412.572) (-414.246) [-414.187] * (-415.221) [-413.363] (-412.880) (-414.008) -- 0:00:18
692500 -- (-415.541) (-413.791) (-413.093) [-416.990] * [-416.307] (-413.434) (-414.441) (-412.675) -- 0:00:18
693000 -- (-414.183) (-413.185) (-415.613) [-411.846] * (-412.453) (-415.132) (-418.444) [-415.902] -- 0:00:18
693500 -- (-414.996) (-417.845) [-414.276] (-413.746) * [-414.307] (-415.355) (-412.514) (-415.237) -- 0:00:18
694000 -- (-414.473) (-416.917) [-412.611] (-414.107) * (-417.844) (-413.739) (-412.968) [-413.767] -- 0:00:18
694500 -- (-413.441) (-415.965) (-412.067) [-412.573] * (-413.330) (-413.841) (-412.925) [-413.985] -- 0:00:18
695000 -- (-414.342) (-413.245) [-413.947] (-412.910) * (-413.077) [-416.923] (-415.350) (-411.849) -- 0:00:18
Average standard deviation of split frequencies: 0.011049
695500 -- (-414.230) (-412.367) (-415.468) [-416.121] * (-416.920) [-413.070] (-414.255) (-413.971) -- 0:00:18
696000 -- (-412.232) (-415.155) (-417.353) [-413.085] * [-414.962] (-414.069) (-414.032) (-412.275) -- 0:00:18
696500 -- [-412.298] (-415.275) (-419.876) (-414.582) * (-413.058) (-416.622) [-412.739] (-412.657) -- 0:00:18
697000 -- (-413.194) (-413.229) [-412.967] (-414.205) * (-413.810) [-414.086] (-412.389) (-415.213) -- 0:00:18
697500 -- [-413.527] (-413.385) (-412.005) (-412.349) * (-416.954) [-413.554] (-413.190) (-413.233) -- 0:00:18
698000 -- (-413.634) [-414.098] (-415.514) (-414.296) * (-414.783) (-412.477) [-412.912] (-412.439) -- 0:00:18
698500 -- (-415.344) (-415.393) [-412.719] (-412.786) * (-417.216) (-412.486) (-416.136) [-412.639] -- 0:00:18
699000 -- (-413.308) [-414.094] (-412.507) (-413.845) * (-415.620) (-412.048) (-416.924) [-414.464] -- 0:00:18
699500 -- [-412.768] (-425.757) (-419.885) (-412.560) * (-414.573) [-411.908] (-421.099) (-413.789) -- 0:00:18
700000 -- (-414.307) (-420.973) [-412.855] (-412.902) * [-412.960] (-411.996) (-416.757) (-413.243) -- 0:00:18
Average standard deviation of split frequencies: 0.011017
700500 -- (-413.132) [-416.865] (-412.809) (-412.022) * (-413.132) (-412.192) [-414.390] (-415.831) -- 0:00:17
701000 -- (-415.346) (-412.170) [-415.976] (-413.851) * (-413.364) (-415.376) (-412.384) [-412.482] -- 0:00:17
701500 -- (-418.445) (-414.880) [-413.450] (-412.612) * (-415.190) [-413.418] (-413.580) (-413.059) -- 0:00:17
702000 -- (-411.746) [-416.071] (-413.587) (-413.464) * (-416.866) (-415.877) (-413.271) [-413.744] -- 0:00:17
702500 -- (-414.693) (-413.110) [-412.426] (-414.871) * (-412.564) (-415.072) (-412.411) [-413.085] -- 0:00:17
703000 -- (-413.620) (-414.416) [-412.344] (-413.386) * [-411.812] (-413.210) (-416.986) (-415.549) -- 0:00:17
703500 -- (-411.806) (-415.152) (-413.783) [-415.543] * [-412.834] (-412.077) (-416.981) (-415.092) -- 0:00:17
704000 -- (-417.798) (-418.215) [-414.869] (-413.393) * [-413.273] (-414.214) (-415.420) (-417.680) -- 0:00:17
704500 -- [-413.075] (-418.964) (-420.648) (-418.059) * (-417.009) (-421.194) (-415.075) [-412.443] -- 0:00:17
705000 -- [-414.698] (-413.906) (-413.374) (-415.201) * (-415.406) (-412.751) [-413.127] (-415.340) -- 0:00:17
Average standard deviation of split frequencies: 0.011351
705500 -- (-412.134) [-413.868] (-411.851) (-412.391) * (-413.917) (-412.784) (-412.912) [-413.106] -- 0:00:17
706000 -- (-412.469) [-415.082] (-411.703) (-414.021) * (-414.411) (-414.101) (-413.988) [-413.006] -- 0:00:17
706500 -- (-412.390) (-414.397) [-412.687] (-413.433) * [-412.943] (-419.258) (-417.762) (-414.798) -- 0:00:17
707000 -- (-415.927) [-412.550] (-413.991) (-413.422) * (-415.328) (-418.056) [-416.758] (-415.106) -- 0:00:17
707500 -- (-413.990) (-417.661) [-413.259] (-416.156) * (-416.709) (-415.632) [-414.740] (-412.762) -- 0:00:17
708000 -- (-415.170) [-412.814] (-412.396) (-416.697) * (-422.289) (-416.531) (-412.620) [-413.958] -- 0:00:17
708500 -- (-415.908) [-412.426] (-414.439) (-415.800) * [-414.096] (-413.549) (-412.049) (-419.230) -- 0:00:17
709000 -- (-414.691) (-411.948) (-415.847) [-413.044] * [-415.173] (-411.900) (-413.705) (-414.268) -- 0:00:17
709500 -- (-415.169) [-411.776] (-414.258) (-414.393) * [-412.692] (-413.639) (-411.871) (-412.750) -- 0:00:17
710000 -- [-413.341] (-414.907) (-413.919) (-412.317) * [-415.166] (-416.112) (-413.991) (-412.668) -- 0:00:17
Average standard deviation of split frequencies: 0.011028
710500 -- (-415.782) [-413.685] (-413.944) (-416.603) * (-416.235) (-414.079) [-414.033] (-415.381) -- 0:00:17
711000 -- (-420.014) (-413.561) [-412.476] (-413.107) * (-413.945) (-414.812) [-412.811] (-412.550) -- 0:00:17
711500 -- (-416.384) [-416.404] (-412.328) (-412.559) * (-414.199) (-413.175) [-413.018] (-413.468) -- 0:00:17
712000 -- (-413.117) (-412.760) (-412.964) [-413.176] * (-416.653) (-413.892) (-412.070) [-412.708] -- 0:00:17
712500 -- (-412.977) (-414.887) [-412.058] (-412.191) * (-419.326) (-412.668) (-412.844) [-412.373] -- 0:00:17
713000 -- (-413.272) (-414.368) (-412.115) [-412.267] * (-416.344) (-413.274) (-412.712) [-412.157] -- 0:00:17
713500 -- (-412.935) (-413.127) [-414.136] (-412.907) * (-412.592) (-414.232) (-413.489) [-412.636] -- 0:00:17
714000 -- (-412.585) (-415.865) [-413.665] (-416.620) * (-412.724) (-413.289) [-413.971] (-412.695) -- 0:00:17
714500 -- [-413.901] (-413.745) (-413.652) (-411.670) * [-414.854] (-415.962) (-412.969) (-417.799) -- 0:00:17
715000 -- [-414.246] (-412.491) (-413.835) (-412.477) * (-417.268) (-416.910) (-412.511) [-414.916] -- 0:00:17
Average standard deviation of split frequencies: 0.011275
715500 -- (-412.392) (-413.536) (-415.414) [-411.973] * (-413.324) (-414.580) [-413.274] (-419.035) -- 0:00:17
716000 -- [-416.353] (-412.789) (-413.778) (-415.656) * (-413.029) (-414.859) (-417.278) [-414.869] -- 0:00:17
716500 -- (-414.339) (-414.054) (-413.748) [-412.528] * (-414.391) (-414.468) [-414.349] (-416.248) -- 0:00:17
717000 -- (-413.744) (-415.281) (-415.705) [-412.309] * (-412.060) (-415.245) (-414.551) [-412.822] -- 0:00:16
717500 -- (-416.392) (-419.430) [-414.233] (-413.921) * (-417.016) (-413.773) (-412.622) [-412.687] -- 0:00:16
718000 -- (-413.099) [-412.797] (-414.838) (-416.029) * (-414.693) (-412.110) (-415.044) [-414.028] -- 0:00:16
718500 -- [-417.749] (-412.432) (-415.604) (-413.604) * [-416.148] (-413.383) (-413.203) (-415.997) -- 0:00:16
719000 -- [-416.632] (-413.082) (-413.551) (-412.074) * (-417.286) (-413.850) (-418.260) [-416.190] -- 0:00:16
719500 -- (-413.171) (-414.726) [-416.051] (-412.837) * (-412.330) [-412.048] (-420.919) (-413.807) -- 0:00:16
720000 -- (-413.313) (-413.039) [-415.200] (-415.027) * (-415.020) (-412.992) [-413.878] (-416.957) -- 0:00:16
Average standard deviation of split frequencies: 0.011079
720500 -- (-414.989) [-413.128] (-412.812) (-417.129) * [-411.877] (-414.367) (-414.106) (-414.012) -- 0:00:16
721000 -- [-414.144] (-412.242) (-413.980) (-415.265) * (-412.599) [-413.737] (-414.061) (-414.083) -- 0:00:16
721500 -- (-411.918) (-415.207) (-415.171) [-412.288] * (-413.802) (-416.805) (-414.344) [-415.228] -- 0:00:16
722000 -- (-412.863) [-413.521] (-413.625) (-413.827) * [-414.671] (-413.866) (-413.781) (-418.580) -- 0:00:16
722500 -- (-414.780) [-413.969] (-412.734) (-412.099) * (-418.874) (-414.822) (-413.615) [-413.674] -- 0:00:16
723000 -- [-418.480] (-415.312) (-412.755) (-413.320) * (-414.224) [-412.312] (-412.444) (-415.367) -- 0:00:16
723500 -- [-417.711] (-413.491) (-414.226) (-415.099) * [-415.289] (-415.990) (-413.208) (-413.313) -- 0:00:16
724000 -- (-414.728) (-413.787) (-415.021) [-413.407] * [-417.536] (-412.085) (-413.825) (-412.958) -- 0:00:16
724500 -- (-414.139) (-413.182) [-413.226] (-413.044) * (-412.253) (-411.796) (-413.522) [-413.484] -- 0:00:16
725000 -- [-413.701] (-416.370) (-412.205) (-412.541) * (-417.287) (-415.190) (-413.960) [-412.475] -- 0:00:16
Average standard deviation of split frequencies: 0.011160
725500 -- (-413.789) (-415.238) [-416.099] (-419.939) * (-416.132) (-414.724) (-412.121) [-413.473] -- 0:00:16
726000 -- (-415.617) (-413.849) (-413.583) [-415.710] * (-415.388) [-415.309] (-413.683) (-412.327) -- 0:00:16
726500 -- (-414.723) (-414.378) [-412.942] (-419.058) * (-413.055) [-412.899] (-413.877) (-411.986) -- 0:00:16
727000 -- (-413.293) (-416.948) [-412.159] (-414.864) * [-414.713] (-413.579) (-412.634) (-413.414) -- 0:00:16
727500 -- (-412.161) (-417.034) [-413.865] (-415.734) * [-413.075] (-414.894) (-413.911) (-414.294) -- 0:00:16
728000 -- (-412.448) (-413.747) (-412.658) [-413.378] * (-415.629) [-415.016] (-413.195) (-414.506) -- 0:00:16
728500 -- (-412.106) (-414.138) (-414.763) [-413.753] * (-414.777) [-413.139] (-413.817) (-411.978) -- 0:00:16
729000 -- (-412.160) [-413.849] (-418.531) (-413.120) * (-412.568) (-412.476) (-413.399) [-412.869] -- 0:00:16
729500 -- (-412.787) (-413.608) [-413.676] (-411.882) * (-413.421) [-413.558] (-412.234) (-412.712) -- 0:00:16
730000 -- (-412.669) (-414.272) [-415.842] (-413.678) * (-412.910) (-414.789) [-413.439] (-412.795) -- 0:00:16
Average standard deviation of split frequencies: 0.011170
730500 -- (-413.299) (-412.919) (-417.866) [-416.083] * [-413.264] (-414.951) (-413.180) (-414.127) -- 0:00:16
731000 -- (-414.798) [-412.824] (-417.311) (-413.737) * (-414.361) (-413.396) (-413.887) [-417.454] -- 0:00:16
731500 -- [-413.954] (-414.264) (-416.184) (-415.512) * [-413.960] (-412.897) (-413.373) (-413.601) -- 0:00:16
732000 -- [-413.939] (-420.343) (-415.447) (-416.916) * (-414.733) [-415.937] (-416.292) (-412.331) -- 0:00:16
732500 -- (-415.376) [-412.884] (-412.618) (-412.687) * (-416.544) (-414.084) (-415.723) [-415.762] -- 0:00:16
733000 -- (-415.418) (-421.923) [-414.587] (-413.593) * [-414.736] (-414.862) (-416.650) (-412.763) -- 0:00:16
733500 -- (-413.427) (-415.039) (-412.843) [-416.203] * (-415.612) (-412.275) [-415.705] (-413.627) -- 0:00:15
734000 -- (-415.906) (-412.852) (-412.965) [-416.531] * (-415.028) (-412.473) (-413.428) [-414.704] -- 0:00:15
734500 -- (-415.096) (-413.783) (-413.308) [-414.727] * (-416.929) [-413.120] (-415.447) (-415.203) -- 0:00:15
735000 -- [-414.357] (-412.229) (-412.021) (-413.260) * (-414.663) (-415.211) (-415.266) [-412.536] -- 0:00:15
Average standard deviation of split frequencies: 0.010738
735500 -- (-415.508) (-412.508) (-411.942) [-416.575] * (-413.270) (-413.847) (-414.062) [-414.346] -- 0:00:15
736000 -- [-414.196] (-417.641) (-412.612) (-413.453) * [-414.191] (-412.927) (-413.516) (-414.053) -- 0:00:15
736500 -- (-415.631) (-420.550) (-413.775) [-412.491] * (-417.488) [-412.355] (-412.673) (-414.124) -- 0:00:15
737000 -- (-415.395) (-413.666) (-413.178) [-414.647] * (-415.224) (-413.641) [-413.820] (-414.394) -- 0:00:15
737500 -- (-412.380) (-412.364) (-416.308) [-415.260] * (-418.541) (-412.521) [-412.070] (-412.100) -- 0:00:15
738000 -- [-414.958] (-416.043) (-412.542) (-414.631) * (-414.796) (-413.437) [-412.845] (-412.411) -- 0:00:15
738500 -- (-413.750) [-420.064] (-415.104) (-412.905) * (-413.102) (-415.095) [-412.286] (-414.319) -- 0:00:15
739000 -- (-411.597) [-412.899] (-413.040) (-414.361) * (-414.263) (-414.983) [-414.021] (-413.538) -- 0:00:15
739500 -- [-412.823] (-418.475) (-412.891) (-413.552) * [-416.041] (-418.922) (-413.068) (-412.658) -- 0:00:15
740000 -- (-412.796) (-415.447) [-412.142] (-412.219) * [-414.465] (-414.781) (-414.561) (-412.741) -- 0:00:15
Average standard deviation of split frequencies: 0.011615
740500 -- (-418.792) (-416.961) [-413.552] (-412.831) * (-419.279) (-416.507) (-413.559) [-416.861] -- 0:00:15
741000 -- [-413.586] (-419.166) (-415.201) (-414.861) * (-418.008) [-413.563] (-414.571) (-416.505) -- 0:00:15
741500 -- (-412.483) [-413.751] (-415.052) (-412.934) * (-416.601) (-414.052) [-413.102] (-414.029) -- 0:00:15
742000 -- (-415.608) (-414.372) (-413.953) [-414.034] * (-412.959) (-413.140) (-415.178) [-412.014] -- 0:00:15
742500 -- (-415.731) (-415.499) [-413.186] (-415.082) * (-413.566) (-412.727) (-413.934) [-414.908] -- 0:00:15
743000 -- (-412.586) (-415.378) [-414.296] (-416.809) * (-412.824) [-413.567] (-413.690) (-417.622) -- 0:00:15
743500 -- (-414.723) (-417.266) (-413.364) [-413.533] * (-412.052) (-413.666) (-414.355) [-418.383] -- 0:00:15
744000 -- [-414.103] (-413.713) (-413.592) (-414.043) * (-412.666) (-414.726) [-415.175] (-413.996) -- 0:00:15
744500 -- (-413.259) (-416.150) (-413.142) [-413.676] * (-412.882) (-412.963) (-415.120) [-414.712] -- 0:00:15
745000 -- (-412.946) (-415.862) (-412.509) [-412.650] * (-413.453) (-412.884) (-412.696) [-414.486] -- 0:00:15
Average standard deviation of split frequencies: 0.011560
745500 -- (-413.592) [-414.319] (-413.930) (-412.335) * (-415.176) (-412.045) [-413.259] (-414.662) -- 0:00:15
746000 -- [-415.154] (-413.426) (-417.155) (-413.287) * (-413.886) [-413.646] (-414.341) (-414.117) -- 0:00:15
746500 -- (-417.489) (-414.870) (-413.406) [-413.094] * [-413.390] (-412.452) (-412.426) (-414.716) -- 0:00:15
747000 -- [-413.571] (-413.749) (-412.277) (-413.607) * [-413.073] (-413.365) (-414.203) (-414.502) -- 0:00:15
747500 -- [-413.352] (-414.203) (-411.906) (-414.434) * (-412.981) [-412.828] (-414.790) (-415.736) -- 0:00:15
748000 -- [-412.752] (-414.870) (-417.611) (-417.957) * (-412.448) [-416.582] (-413.958) (-413.423) -- 0:00:15
748500 -- (-412.516) (-416.504) (-413.525) [-413.213] * [-412.279] (-414.024) (-413.541) (-414.754) -- 0:00:15
749000 -- (-413.991) [-411.782] (-414.479) (-414.519) * (-413.783) (-413.627) (-415.268) [-414.518] -- 0:00:15
749500 -- (-414.070) (-413.358) (-411.908) [-416.490] * (-413.062) (-411.665) (-413.669) [-414.408] -- 0:00:15
750000 -- (-413.901) (-414.175) (-412.511) [-413.361] * (-416.348) (-412.471) [-412.511] (-414.987) -- 0:00:15
Average standard deviation of split frequencies: 0.011784
750500 -- [-413.888] (-418.394) (-412.842) (-415.192) * (-412.853) (-414.190) [-416.429] (-411.952) -- 0:00:14
751000 -- [-412.780] (-416.244) (-414.099) (-413.759) * (-412.872) [-412.409] (-413.160) (-412.853) -- 0:00:14
751500 -- (-413.135) [-414.936] (-412.649) (-413.868) * (-413.164) (-419.785) [-412.658] (-414.045) -- 0:00:14
752000 -- (-415.880) (-419.148) (-414.363) [-414.747] * [-412.650] (-413.620) (-414.496) (-412.626) -- 0:00:14
752500 -- (-412.785) (-415.816) (-413.284) [-413.084] * [-415.876] (-414.399) (-413.442) (-412.768) -- 0:00:14
753000 -- (-412.750) (-417.025) (-413.636) [-413.094] * (-412.439) (-413.925) [-413.144] (-417.199) -- 0:00:14
753500 -- (-412.832) [-413.125] (-414.899) (-419.903) * (-413.152) (-415.598) [-412.754] (-413.987) -- 0:00:14
754000 -- (-411.675) [-412.250] (-416.063) (-412.034) * [-414.369] (-412.386) (-412.890) (-417.248) -- 0:00:14
754500 -- (-412.483) [-412.681] (-417.061) (-412.191) * [-414.729] (-412.534) (-415.513) (-418.812) -- 0:00:14
755000 -- (-415.409) (-417.503) [-418.576] (-413.391) * (-414.622) (-412.104) [-414.589] (-412.888) -- 0:00:14
Average standard deviation of split frequencies: 0.011811
755500 -- [-416.185] (-414.418) (-412.768) (-414.024) * (-412.560) (-412.816) [-412.426] (-414.496) -- 0:00:14
756000 -- (-414.246) (-418.940) (-412.598) [-412.487] * (-412.195) (-412.812) (-415.523) [-415.777] -- 0:00:14
756500 -- (-417.194) (-413.543) [-417.545] (-414.245) * (-412.145) [-414.704] (-414.819) (-412.936) -- 0:00:14
757000 -- (-415.894) [-415.238] (-414.631) (-412.465) * (-414.631) (-414.809) (-414.135) [-412.858] -- 0:00:14
757500 -- [-417.893] (-416.788) (-415.213) (-413.489) * (-415.217) [-414.585] (-412.667) (-412.181) -- 0:00:14
758000 -- [-413.214] (-414.473) (-413.520) (-413.728) * (-414.511) (-414.680) [-415.781] (-414.528) -- 0:00:14
758500 -- (-413.604) (-415.545) (-413.847) [-414.863] * (-414.473) (-413.862) (-413.516) [-412.560] -- 0:00:14
759000 -- (-413.293) (-413.257) [-411.774] (-414.356) * (-414.429) (-413.407) (-416.085) [-413.678] -- 0:00:14
759500 -- (-412.337) [-413.694] (-416.828) (-413.063) * (-413.095) (-414.362) (-414.162) [-420.172] -- 0:00:14
760000 -- (-412.806) [-413.663] (-419.572) (-414.446) * (-412.013) (-415.638) (-413.421) [-415.024] -- 0:00:14
Average standard deviation of split frequencies: 0.011852
760500 -- (-412.934) (-413.311) (-418.322) [-414.649] * (-414.343) (-413.827) [-412.631] (-416.842) -- 0:00:14
761000 -- [-415.473] (-413.877) (-414.169) (-413.508) * (-413.267) (-415.957) (-413.313) [-416.291] -- 0:00:14
761500 -- (-413.745) (-412.355) [-411.984] (-413.773) * [-413.306] (-415.170) (-414.113) (-413.892) -- 0:00:14
762000 -- (-413.592) [-413.445] (-415.496) (-415.517) * [-413.641] (-412.846) (-415.174) (-415.307) -- 0:00:14
762500 -- (-415.610) (-417.957) (-413.596) [-413.508] * [-413.940] (-415.534) (-414.496) (-413.097) -- 0:00:14
763000 -- (-414.444) (-413.760) (-413.200) [-413.438] * (-416.432) [-414.024] (-413.690) (-413.520) -- 0:00:14
763500 -- (-413.029) (-411.932) (-412.978) [-413.791] * (-413.607) (-413.353) (-413.192) [-414.792] -- 0:00:14
764000 -- (-412.080) (-413.028) (-413.525) [-413.620] * [-414.517] (-413.027) (-413.932) (-414.962) -- 0:00:14
764500 -- (-412.235) (-413.092) (-413.588) [-413.127] * [-417.443] (-412.884) (-412.735) (-414.287) -- 0:00:14
765000 -- (-412.527) [-413.795] (-416.009) (-414.682) * (-412.785) (-413.990) [-414.289] (-419.115) -- 0:00:14
Average standard deviation of split frequencies: 0.011476
765500 -- (-414.883) [-413.918] (-418.902) (-414.327) * [-413.377] (-413.608) (-417.955) (-415.678) -- 0:00:14
766000 -- [-411.893] (-414.476) (-415.956) (-413.345) * [-412.992] (-414.834) (-414.471) (-415.687) -- 0:00:14
766500 -- (-413.519) (-416.395) (-413.158) [-412.969] * [-414.539] (-417.831) (-413.765) (-414.306) -- 0:00:14
767000 -- [-414.915] (-413.751) (-413.051) (-411.782) * (-415.248) (-416.377) [-414.847] (-412.560) -- 0:00:13
767500 -- [-414.587] (-414.250) (-413.726) (-412.499) * [-416.660] (-414.285) (-415.804) (-416.011) -- 0:00:13
768000 -- (-414.603) (-414.812) (-412.538) [-415.240] * (-413.108) (-414.523) (-414.573) [-414.099] -- 0:00:13
768500 -- (-412.724) (-412.526) (-419.228) [-420.213] * [-412.141] (-412.219) (-413.952) (-413.763) -- 0:00:13
769000 -- (-413.605) [-416.798] (-415.469) (-417.330) * (-412.871) (-417.081) [-415.806] (-414.155) -- 0:00:13
769500 -- (-413.591) (-413.873) [-413.527] (-414.463) * (-413.469) (-414.722) [-414.549] (-413.096) -- 0:00:13
770000 -- (-414.944) [-412.623] (-413.253) (-412.588) * (-414.907) [-416.954] (-413.894) (-412.637) -- 0:00:13
Average standard deviation of split frequencies: 0.011851
770500 -- (-416.633) (-414.560) [-415.362] (-413.697) * (-413.945) (-413.938) [-413.388] (-414.101) -- 0:00:13
771000 -- (-413.007) [-413.958] (-414.406) (-413.347) * (-413.754) (-413.852) (-412.240) [-413.733] -- 0:00:13
771500 -- [-413.672] (-416.193) (-413.110) (-412.854) * (-414.783) (-413.666) (-413.599) [-412.148] -- 0:00:13
772000 -- [-411.950] (-412.273) (-415.829) (-417.008) * (-413.927) (-413.261) (-413.824) [-413.828] -- 0:00:13
772500 -- [-413.652] (-412.914) (-417.882) (-417.190) * (-415.662) (-413.233) [-414.018] (-416.464) -- 0:00:13
773000 -- (-413.460) (-420.041) [-412.905] (-415.141) * (-413.965) (-414.824) [-415.348] (-413.974) -- 0:00:13
773500 -- (-412.332) (-413.222) [-413.679] (-415.587) * [-414.821] (-416.004) (-413.531) (-412.384) -- 0:00:13
774000 -- (-412.895) (-413.595) (-413.250) [-414.024] * [-413.082] (-418.234) (-413.112) (-413.720) -- 0:00:13
774500 -- (-414.354) (-414.800) [-412.395] (-411.957) * (-414.904) (-412.569) [-415.453] (-412.482) -- 0:00:13
775000 -- (-419.565) (-415.070) [-414.412] (-414.863) * (-414.932) [-415.511] (-415.450) (-412.971) -- 0:00:13
Average standard deviation of split frequencies: 0.011352
775500 -- (-416.099) [-414.979] (-418.152) (-412.199) * [-413.007] (-415.016) (-411.774) (-413.818) -- 0:00:13
776000 -- (-414.987) (-414.976) (-412.918) [-412.245] * (-418.240) [-412.853] (-413.560) (-418.280) -- 0:00:13
776500 -- (-411.554) (-413.316) (-417.015) [-412.650] * (-415.254) (-416.744) [-413.407] (-414.534) -- 0:00:13
777000 -- (-412.347) (-412.340) [-413.087] (-416.239) * (-415.680) (-412.831) (-414.303) [-414.036] -- 0:00:13
777500 -- (-414.960) (-414.341) (-414.517) [-416.858] * (-418.521) (-412.810) [-412.008] (-419.137) -- 0:00:13
778000 -- (-413.603) (-423.937) [-420.765] (-420.951) * [-415.611] (-411.869) (-412.087) (-416.454) -- 0:00:13
778500 -- [-412.857] (-413.054) (-414.127) (-415.829) * (-413.060) [-412.720] (-414.201) (-414.138) -- 0:00:13
779000 -- (-412.761) [-412.177] (-413.967) (-412.968) * (-412.482) [-412.984] (-412.592) (-413.441) -- 0:00:13
779500 -- (-413.104) (-412.823) (-415.725) [-413.611] * [-413.845] (-412.287) (-414.290) (-412.638) -- 0:00:13
780000 -- [-413.416] (-412.853) (-414.277) (-412.393) * (-412.726) [-412.543] (-414.270) (-415.834) -- 0:00:13
Average standard deviation of split frequencies: 0.011209
780500 -- (-414.328) (-416.069) (-413.719) [-414.524] * [-420.198] (-414.288) (-414.075) (-416.758) -- 0:00:13
781000 -- (-418.630) (-416.252) (-415.487) [-414.964] * [-413.501] (-414.471) (-414.087) (-412.695) -- 0:00:13
781500 -- (-416.336) [-415.341] (-412.751) (-414.219) * (-412.814) [-415.122] (-420.169) (-412.840) -- 0:00:13
782000 -- (-414.054) (-414.119) (-413.237) [-414.818] * (-412.880) (-413.969) (-416.093) [-416.668] -- 0:00:13
782500 -- (-416.999) (-417.751) (-414.375) [-414.222] * (-414.285) [-412.790] (-413.414) (-418.701) -- 0:00:13
783000 -- (-413.899) (-412.386) (-413.487) [-414.354] * (-412.520) [-412.941] (-413.297) (-414.590) -- 0:00:13
783500 -- (-417.338) [-415.974] (-416.778) (-413.502) * (-412.214) (-416.238) (-417.656) [-412.510] -- 0:00:12
784000 -- (-412.350) (-415.121) [-415.068] (-412.741) * (-414.733) [-413.977] (-415.390) (-414.495) -- 0:00:12
784500 -- (-416.056) (-413.303) [-414.226] (-414.361) * [-412.166] (-415.012) (-414.265) (-414.538) -- 0:00:12
785000 -- (-412.531) (-413.401) [-412.800] (-415.190) * (-414.311) [-413.987] (-413.140) (-412.517) -- 0:00:12
Average standard deviation of split frequencies: 0.011283
785500 -- (-413.192) (-413.525) (-414.915) [-413.295] * (-414.134) (-425.735) (-414.420) [-413.116] -- 0:00:12
786000 -- (-412.221) (-415.577) [-412.745] (-414.792) * (-413.022) (-424.947) [-413.244] (-415.767) -- 0:00:12
786500 -- (-415.677) (-412.578) [-414.476] (-413.845) * (-412.048) (-412.345) (-413.790) [-413.543] -- 0:00:12
787000 -- (-412.886) (-415.088) [-414.632] (-415.379) * (-414.354) [-413.213] (-413.979) (-416.391) -- 0:00:12
787500 -- (-417.279) [-413.120] (-414.192) (-413.574) * [-417.018] (-416.198) (-413.788) (-415.748) -- 0:00:12
788000 -- (-415.455) (-412.413) (-415.991) [-414.220] * (-414.666) [-415.806] (-413.877) (-412.698) -- 0:00:12
788500 -- (-412.617) (-412.138) [-413.445] (-416.646) * (-415.814) [-412.742] (-415.865) (-411.890) -- 0:00:12
789000 -- (-411.647) (-413.364) [-412.331] (-413.319) * (-412.660) (-414.030) [-412.638] (-415.489) -- 0:00:12
789500 -- (-413.711) [-412.451] (-412.334) (-414.571) * (-415.728) (-419.130) [-412.199] (-413.310) -- 0:00:12
790000 -- (-416.264) (-412.200) (-415.852) [-412.442] * [-411.978] (-413.003) (-412.720) (-413.724) -- 0:00:12
Average standard deviation of split frequencies: 0.011067
790500 -- (-414.416) (-413.690) (-414.937) [-412.817] * (-412.798) (-411.817) [-412.923] (-414.129) -- 0:00:12
791000 -- (-417.551) (-412.815) (-414.295) [-414.499] * [-413.176] (-413.946) (-415.085) (-415.559) -- 0:00:12
791500 -- [-412.728] (-414.439) (-413.273) (-414.540) * [-415.173] (-415.241) (-417.399) (-415.157) -- 0:00:12
792000 -- (-415.992) (-414.634) (-414.201) [-412.924] * (-414.403) [-414.055] (-418.527) (-414.148) -- 0:00:12
792500 -- [-413.360] (-413.609) (-415.401) (-417.288) * (-413.858) 