--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:18:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0028/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.38 -828.35
2 -825.42 -828.56
--------------------------------------
TOTAL -825.40 -828.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901604 0.088183 0.396747 1.500094 0.868948 1409.32 1455.16 1.002
r(A<->C){all} 0.171104 0.021076 0.000518 0.461898 0.131141 205.47 257.64 1.000
r(A<->G){all} 0.164637 0.020718 0.000059 0.459948 0.124544 136.36 186.17 1.005
r(A<->T){all} 0.161592 0.019414 0.000052 0.449335 0.121403 134.20 193.38 1.000
r(C<->G){all} 0.172399 0.021348 0.000011 0.465222 0.134683 208.29 245.02 1.000
r(C<->T){all} 0.166758 0.020073 0.000129 0.442985 0.126408 140.97 216.17 1.000
r(G<->T){all} 0.163510 0.019377 0.000043 0.434731 0.126592 246.98 248.48 1.001
pi(A){all} 0.180132 0.000233 0.151356 0.210085 0.179543 1483.92 1492.46 1.000
pi(C){all} 0.252540 0.000301 0.218274 0.287209 0.251898 1419.45 1460.23 1.000
pi(G){all} 0.341257 0.000365 0.300246 0.374221 0.341106 1229.98 1239.71 1.000
pi(T){all} 0.226071 0.000287 0.193696 0.260033 0.225589 1317.24 1409.12 1.000
alpha{1,2} 0.422840 0.237587 0.000144 1.390076 0.248059 1349.01 1356.67 1.000
alpha{3} 0.468720 0.252501 0.000185 1.393501 0.309036 1153.43 1220.59 1.000
pinvar{all} 0.997365 0.000010 0.991328 0.999999 0.998384 1066.75 1199.47 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -793.856499
Model 2: PositiveSelection -793.856358
Model 0: one-ratio -793.856644
Model 7: beta -793.856358
Model 8: beta&w>1 -793.856506
Model 0 vs 1 2.899999999499414E-4
Model 2 vs 1 2.8199999997013947E-4
Model 8 vs 7 2.9599999993479287E-4
>C1
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C2
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C3
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C4
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C5
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C6
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=203
C1 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C2 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C3 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C4 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C5 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C6 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
*************************************************
C1 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C2 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C3 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C4 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C5 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C6 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
**************************************************
C1 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C2 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C3 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C4 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C5 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C6 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
**************************************************
C1 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C2 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C3 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C4 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C5 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C6 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
**************************************************
C1 RNo
C2 RNo
C3 RNo
C4 RNo
C5 RN-
C6 RN-
**
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 202 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 202 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6124]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6124]--->[6124]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.471 Mb, Max= 30.737 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C2 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C3 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C4 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C5 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C6 VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
**************************************************
C1 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C2 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C3 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C4 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C5 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C6 LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
**************************************************
C1 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C2 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C3 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C4 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C5 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C6 ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
**************************************************
C1 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C2 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C3 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C4 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C5 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C6 GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
**************************************************
C1 N
C2 N
C3 N
C4 N
C5 N
C6 N
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C2 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C3 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C4 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C5 GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C6 GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
***********************************************
C1 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C2 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C3 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C4 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C5 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C6 GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
**************************************************
C1 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C2 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C3 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C4 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C5 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C6 CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
**************************************************
C1 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C2 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C3 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C4 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C5 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C6 ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
**************************************************
C1 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C2 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C3 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C4 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C5 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C6 GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
**************************************************
C1 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C2 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C3 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C4 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C5 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C6 GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
**************************************************
C1 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C2 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C3 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C4 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C5 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C6 GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
**************************************************
C1 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C2 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C3 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C4 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C5 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C6 GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
**************************************************
C1 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C2 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C3 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C4 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C5 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C6 ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
**************************************************
C1 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C2 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C3 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C4 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C5 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C6 AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
**************************************************
C1 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C2 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C3 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C4 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C5 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C6 TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
**************************************************
C1 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C2 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C3 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C4 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C5 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C6 GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
**************************************************
C1 CGGAAC---
C2 CGGAAC---
C3 CGGAAC---
C4 CGGAAC---
C5 CGGAAC---
C6 CGGAAC---
******
>C1
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C2
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C3
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C4
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C5
GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C6
GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C1
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C2
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C3
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C4
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C5
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C6
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 609 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788996
Setting output file names to "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1820691627
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0234010496
Seed = 1032634463
Swapseed = 1579788996
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 6 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1355.030149 -- -24.965149
Chain 2 -- -1354.540462 -- -24.965149
Chain 3 -- -1354.540463 -- -24.965149
Chain 4 -- -1355.030228 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1355.030149 -- -24.965149
Chain 2 -- -1354.792118 -- -24.965149
Chain 3 -- -1354.792118 -- -24.965149
Chain 4 -- -1354.274669 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1355.030] (-1354.540) (-1354.540) (-1355.030) * [-1355.030] (-1354.792) (-1354.792) (-1354.275)
500 -- (-846.834) [-835.297] (-835.803) (-837.852) * (-839.126) [-835.681] (-841.840) (-839.066) -- 0:00:00
1000 -- (-845.234) (-840.883) (-841.571) [-828.987] * (-830.489) (-842.249) (-834.143) [-828.075] -- 0:00:00
1500 -- (-838.391) (-836.877) [-837.765] (-839.048) * [-833.476] (-837.029) (-832.022) (-843.382) -- 0:00:00
2000 -- (-833.344) [-837.393] (-830.683) (-835.724) * [-834.250] (-833.070) (-837.491) (-834.494) -- 0:00:00
2500 -- [-830.336] (-834.715) (-833.079) (-841.305) * [-830.771] (-838.395) (-833.515) (-835.547) -- 0:00:00
3000 -- (-832.402) (-833.385) [-842.762] (-834.221) * [-833.890] (-833.814) (-836.969) (-837.782) -- 0:05:32
3500 -- (-836.201) (-833.149) (-833.902) [-831.366] * [-830.327] (-832.487) (-831.048) (-835.253) -- 0:04:44
4000 -- (-842.252) [-831.517] (-831.864) (-838.959) * (-828.054) [-832.233] (-840.988) (-831.934) -- 0:04:09
4500 -- (-845.714) (-840.417) [-832.704] (-831.537) * (-835.196) (-839.527) (-835.051) [-833.177] -- 0:03:41
5000 -- (-829.154) (-838.100) (-842.669) [-831.226] * (-836.100) (-834.522) (-835.631) [-832.637] -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- [-834.490] (-832.669) (-834.998) (-829.094) * (-836.749) (-838.547) (-834.567) [-837.461] -- 0:03:00
6000 -- (-837.597) (-834.370) (-838.793) [-828.534] * (-836.582) (-834.696) [-833.873] (-832.400) -- 0:02:45
6500 -- (-832.487) (-831.640) (-839.323) [-838.538] * [-834.077] (-837.770) (-837.877) (-836.021) -- 0:02:32
7000 -- (-838.046) (-833.940) [-833.171] (-839.829) * (-836.460) (-837.210) (-837.619) [-840.578] -- 0:02:21
7500 -- (-836.343) [-833.941] (-835.955) (-833.503) * (-838.826) (-836.548) [-833.532] (-830.215) -- 0:02:12
8000 -- [-838.239] (-833.738) (-836.985) (-837.954) * (-842.115) (-836.796) (-836.529) [-835.634] -- 0:02:04
8500 -- (-827.163) [-832.387] (-831.996) (-843.813) * (-834.977) (-833.095) (-832.808) [-834.323] -- 0:01:56
9000 -- (-829.635) (-847.616) [-837.735] (-831.014) * (-833.501) [-835.186] (-841.095) (-828.315) -- 0:01:50
9500 -- (-843.664) (-828.757) (-838.259) [-835.576] * (-831.801) (-837.986) [-835.455] (-839.520) -- 0:01:44
10000 -- (-834.859) (-828.596) (-830.096) [-833.408] * (-839.449) (-837.435) [-835.651] (-839.828) -- 0:01:39
Average standard deviation of split frequencies: 0.081759
10500 -- [-836.428] (-837.850) (-848.003) (-837.770) * (-838.036) [-838.044] (-833.509) (-835.958) -- 0:01:34
11000 -- [-832.647] (-834.730) (-830.259) (-831.939) * (-838.735) (-830.778) [-838.829] (-841.188) -- 0:01:29
11500 -- (-838.456) (-832.876) [-830.252] (-853.535) * (-837.269) (-840.080) [-834.217] (-825.634) -- 0:01:25
12000 -- (-828.938) [-830.209] (-832.778) (-842.286) * (-833.486) (-840.883) (-833.492) [-825.984] -- 0:01:22
12500 -- (-837.999) (-841.438) (-834.932) [-839.001] * [-836.291] (-844.927) (-841.525) (-825.443) -- 0:01:19
13000 -- [-836.616] (-832.956) (-840.795) (-840.426) * (-837.807) (-836.173) [-838.530] (-827.298) -- 0:01:15
13500 -- [-829.521] (-834.986) (-839.960) (-836.312) * (-837.209) (-839.616) [-831.258] (-828.195) -- 0:01:13
14000 -- [-836.759] (-833.632) (-839.679) (-836.866) * [-828.539] (-847.389) (-835.645) (-826.347) -- 0:01:10
14500 -- (-839.413) [-840.442] (-837.985) (-836.118) * (-837.638) [-836.548] (-838.019) (-825.493) -- 0:01:07
15000 -- (-835.100) [-830.360] (-829.422) (-835.674) * (-842.855) (-837.976) (-825.864) [-827.191] -- 0:01:05
Average standard deviation of split frequencies: 0.057289
15500 -- (-833.257) (-832.852) [-840.644] (-836.254) * (-836.026) (-836.049) [-827.850] (-827.016) -- 0:01:03
16000 -- [-832.355] (-836.556) (-839.421) (-835.869) * (-835.104) [-835.866] (-826.639) (-829.149) -- 0:02:03
16500 -- [-833.941] (-838.217) (-840.688) (-836.596) * (-835.459) [-830.725] (-827.464) (-825.780) -- 0:01:59
17000 -- (-835.854) (-835.915) [-837.163] (-842.693) * (-834.810) (-843.128) [-826.240] (-826.657) -- 0:01:55
17500 -- (-836.912) (-842.884) (-833.335) [-833.919] * (-837.684) (-843.361) [-825.988] (-826.519) -- 0:01:52
18000 -- (-835.672) (-835.794) [-831.626] (-834.235) * (-839.212) (-836.456) [-827.012] (-825.035) -- 0:01:49
18500 -- [-836.991] (-838.126) (-838.369) (-840.311) * (-832.846) (-836.365) [-824.038] (-828.852) -- 0:01:46
19000 -- (-842.423) (-841.023) (-836.849) [-832.231] * (-835.281) (-837.452) (-824.370) [-833.750] -- 0:01:43
19500 -- [-833.461] (-832.053) (-837.765) (-838.690) * (-837.871) (-836.835) [-824.506] (-828.445) -- 0:01:40
20000 -- [-838.373] (-835.845) (-832.432) (-831.492) * (-836.656) (-836.390) [-826.966] (-824.412) -- 0:01:38
Average standard deviation of split frequencies: 0.052329
20500 -- [-838.451] (-836.816) (-838.378) (-835.601) * (-838.110) (-833.131) [-824.038] (-825.456) -- 0:01:35
21000 -- [-836.300] (-832.147) (-838.005) (-832.248) * (-843.164) (-841.484) [-825.089] (-828.214) -- 0:01:33
21500 -- (-835.531) [-832.634] (-834.086) (-837.834) * (-835.212) [-830.600] (-825.362) (-825.128) -- 0:01:31
22000 -- [-835.467] (-840.473) (-840.357) (-830.119) * [-839.880] (-841.371) (-826.586) (-825.049) -- 0:01:28
22500 -- (-835.534) (-836.750) (-832.875) [-831.899] * (-833.534) (-825.986) (-828.625) [-825.017] -- 0:01:26
23000 -- (-838.924) [-835.693] (-832.754) (-826.771) * [-834.896] (-829.677) (-825.294) (-824.546) -- 0:01:24
23500 -- (-832.443) (-837.254) [-832.537] (-830.283) * (-829.888) [-827.580] (-825.687) (-824.518) -- 0:01:23
24000 -- (-834.341) (-838.216) (-832.473) [-830.678] * (-833.741) (-825.457) (-825.073) [-826.011] -- 0:01:21
24500 -- (-837.523) [-829.345] (-838.136) (-837.656) * (-843.679) (-824.258) (-832.493) [-827.969] -- 0:01:19
25000 -- [-832.587] (-839.184) (-831.961) (-833.748) * [-828.557] (-824.481) (-834.371) (-826.278) -- 0:01:18
Average standard deviation of split frequencies: 0.041207
25500 -- [-834.496] (-838.507) (-832.415) (-843.755) * (-838.994) [-824.414] (-825.934) (-827.089) -- 0:01:16
26000 -- (-832.812) (-835.102) [-842.583] (-836.399) * [-835.872] (-824.712) (-826.129) (-824.679) -- 0:01:14
26500 -- (-834.385) (-837.841) [-832.705] (-833.499) * (-841.094) [-827.296] (-824.669) (-824.621) -- 0:01:13
27000 -- [-834.536] (-844.087) (-850.944) (-828.803) * [-831.599] (-828.035) (-829.050) (-826.440) -- 0:01:12
27500 -- (-842.326) (-839.467) [-834.944] (-835.862) * (-830.545) [-826.860] (-827.850) (-824.499) -- 0:01:10
28000 -- (-837.302) [-831.736] (-836.881) (-833.946) * (-837.169) (-825.190) (-825.566) [-829.532] -- 0:01:09
28500 -- (-830.446) (-845.996) [-834.132] (-834.670) * (-833.589) (-828.457) [-825.711] (-828.359) -- 0:01:42
29000 -- (-838.328) [-831.998] (-834.986) (-835.714) * (-835.445) (-828.628) (-825.692) [-828.208] -- 0:01:40
29500 -- (-833.851) [-831.622] (-832.084) (-837.258) * (-839.592) [-825.150] (-831.956) (-827.867) -- 0:01:38
30000 -- [-835.743] (-837.291) (-834.475) (-837.941) * (-831.189) [-825.706] (-824.969) (-832.391) -- 0:01:37
Average standard deviation of split frequencies: 0.036124
30500 -- (-841.505) (-836.624) [-832.841] (-829.589) * [-833.204] (-824.579) (-826.487) (-827.441) -- 0:01:35
31000 -- (-835.184) [-830.331] (-839.014) (-835.956) * [-836.222] (-825.714) (-825.038) (-825.953) -- 0:01:33
31500 -- (-834.267) (-832.598) [-835.346] (-833.341) * (-843.821) [-824.094] (-827.274) (-826.014) -- 0:01:32
32000 -- [-839.159] (-844.719) (-842.474) (-833.417) * (-837.082) (-827.267) (-827.186) [-826.102] -- 0:01:30
32500 -- (-833.765) (-842.302) [-835.191] (-840.312) * (-835.760) (-830.457) [-826.819] (-825.890) -- 0:01:29
33000 -- (-831.033) (-843.665) [-839.510] (-833.577) * [-834.643] (-829.456) (-825.336) (-825.135) -- 0:01:27
33500 -- (-831.248) (-826.853) [-838.845] (-830.898) * (-841.144) (-824.868) (-824.409) [-825.424] -- 0:01:26
34000 -- (-840.927) (-825.741) (-837.976) [-835.696] * (-840.210) [-825.863] (-826.824) (-831.231) -- 0:01:25
34500 -- [-836.345] (-824.567) (-837.410) (-840.369) * [-830.606] (-826.676) (-824.131) (-825.709) -- 0:01:23
35000 -- (-834.895) (-825.695) (-835.882) [-832.906] * [-829.617] (-828.410) (-826.754) (-826.648) -- 0:01:22
Average standard deviation of split frequencies: 0.040011
35500 -- (-832.668) [-830.113] (-837.193) (-839.539) * (-840.169) [-826.018] (-827.551) (-827.256) -- 0:01:21
36000 -- (-829.842) (-825.328) [-833.610] (-842.872) * (-836.738) (-827.424) (-825.105) [-828.065] -- 0:01:20
36500 -- [-834.827] (-825.194) (-839.179) (-838.570) * (-834.892) (-824.827) (-829.948) [-832.052] -- 0:01:19
37000 -- [-832.604] (-825.732) (-832.876) (-836.647) * (-840.798) [-826.271] (-824.772) (-832.922) -- 0:01:18
37500 -- (-844.202) (-826.526) (-835.928) [-835.563] * (-826.738) [-826.175] (-824.810) (-826.454) -- 0:01:17
38000 -- (-839.457) (-824.359) (-833.018) [-834.788] * (-824.951) [-827.670] (-824.181) (-825.667) -- 0:01:15
38500 -- [-829.935] (-826.300) (-836.307) (-833.992) * (-833.628) [-825.809] (-824.231) (-825.456) -- 0:01:14
39000 -- [-840.742] (-829.832) (-840.444) (-832.287) * (-830.576) (-827.103) (-827.101) [-826.887] -- 0:01:13
39500 -- (-832.411) [-824.413] (-837.554) (-835.762) * [-827.587] (-828.798) (-827.519) (-830.116) -- 0:01:12
40000 -- (-834.599) (-828.153) [-836.399] (-831.087) * [-830.436] (-825.188) (-825.692) (-831.347) -- 0:01:12
Average standard deviation of split frequencies: 0.032945
40500 -- (-837.206) [-824.784] (-843.219) (-829.486) * (-824.958) [-825.394] (-824.643) (-825.537) -- 0:01:11
41000 -- (-844.166) (-825.916) [-830.304] (-835.272) * (-825.156) [-830.014] (-827.891) (-825.520) -- 0:01:10
41500 -- (-833.259) (-827.388) (-837.592) [-838.045] * (-824.521) (-827.701) [-826.833] (-824.806) -- 0:01:32
42000 -- [-830.810] (-825.057) (-836.807) (-841.735) * [-826.514] (-831.606) (-833.167) (-826.178) -- 0:01:31
42500 -- (-836.651) (-826.468) (-833.031) [-832.666] * [-828.817] (-827.522) (-830.158) (-825.826) -- 0:01:30
43000 -- (-835.013) (-825.150) [-832.660] (-835.906) * (-829.452) (-829.176) [-826.302] (-825.174) -- 0:01:29
43500 -- [-830.237] (-827.810) (-832.484) (-842.447) * (-829.307) [-831.007] (-826.088) (-828.413) -- 0:01:27
44000 -- (-839.375) [-825.173] (-833.710) (-836.302) * (-825.450) (-828.477) (-829.679) [-826.162] -- 0:01:26
44500 -- (-847.241) (-825.238) [-835.703] (-831.815) * (-826.460) (-826.281) [-824.675] (-827.008) -- 0:01:25
45000 -- (-839.429) (-827.227) [-831.002] (-836.116) * [-827.337] (-825.891) (-825.601) (-829.636) -- 0:01:24
Average standard deviation of split frequencies: 0.031720
45500 -- [-833.344] (-830.675) (-837.380) (-831.382) * (-825.502) (-825.727) [-825.155] (-825.784) -- 0:01:23
46000 -- [-834.789] (-827.722) (-836.134) (-839.509) * (-824.435) (-826.319) (-825.925) [-824.124] -- 0:01:22
46500 -- (-834.295) (-826.325) (-838.101) [-830.429] * (-825.595) (-826.241) [-826.577] (-824.052) -- 0:01:22
47000 -- [-834.839] (-826.589) (-837.238) (-848.328) * (-826.089) (-827.824) [-824.836] (-823.748) -- 0:01:21
47500 -- (-832.026) (-826.103) (-835.351) [-832.707] * (-824.883) [-827.756] (-824.000) (-825.829) -- 0:01:20
48000 -- (-831.103) (-825.256) (-832.565) [-833.232] * (-825.265) (-825.988) (-824.214) [-825.405] -- 0:01:19
48500 -- (-840.050) [-826.036] (-837.130) (-836.574) * (-825.309) (-826.128) [-825.466] (-824.833) -- 0:01:18
49000 -- [-836.514] (-826.419) (-842.722) (-835.260) * (-827.486) (-826.877) [-825.680] (-827.659) -- 0:01:17
49500 -- (-834.947) [-827.902] (-845.528) (-839.502) * [-829.658] (-825.496) (-825.034) (-826.399) -- 0:01:16
50000 -- (-841.235) (-829.470) (-844.638) [-833.476] * [-826.785] (-825.954) (-824.347) (-824.583) -- 0:01:16
Average standard deviation of split frequencies: 0.037681
50500 -- (-842.034) (-826.002) (-837.415) [-832.996] * [-824.374] (-826.488) (-824.477) (-831.046) -- 0:01:15
51000 -- (-842.561) (-824.513) (-835.911) [-835.893] * (-824.849) [-827.413] (-827.152) (-828.306) -- 0:01:14
51500 -- [-832.923] (-824.009) (-834.162) (-839.690) * (-824.655) (-824.580) [-824.342] (-827.484) -- 0:01:13
52000 -- (-835.826) (-826.556) (-835.485) [-833.713] * (-825.983) (-826.165) [-825.908] (-824.325) -- 0:01:12
52500 -- (-834.751) (-827.203) (-834.864) [-832.451] * (-825.198) [-828.595] (-826.282) (-824.406) -- 0:01:12
53000 -- (-834.800) (-826.374) [-828.752] (-835.587) * [-825.707] (-828.860) (-824.727) (-828.919) -- 0:01:11
53500 -- (-840.250) (-828.227) (-832.382) [-836.458] * [-825.512] (-826.144) (-827.129) (-832.486) -- 0:01:10
54000 -- (-831.591) [-824.701] (-837.049) (-834.678) * (-826.533) [-828.641] (-830.870) (-829.393) -- 0:01:10
54500 -- (-832.249) [-825.202] (-834.517) (-841.207) * (-825.764) (-826.181) (-826.659) [-826.272] -- 0:01:26
55000 -- (-835.262) [-826.656] (-833.540) (-834.768) * [-824.542] (-825.993) (-827.835) (-824.621) -- 0:01:25
Average standard deviation of split frequencies: 0.030127
55500 -- [-834.808] (-825.847) (-836.197) (-840.598) * [-829.930] (-825.300) (-825.663) (-829.752) -- 0:01:25
56000 -- (-840.056) (-827.726) [-830.232] (-845.217) * (-828.738) [-825.153] (-827.953) (-828.091) -- 0:01:24
56500 -- [-833.857] (-826.144) (-840.902) (-839.952) * (-827.516) (-825.894) [-829.068] (-829.301) -- 0:01:23
57000 -- (-834.156) [-829.191] (-837.592) (-836.027) * [-828.749] (-825.207) (-827.813) (-827.214) -- 0:01:22
57500 -- [-836.239] (-827.634) (-836.026) (-837.033) * (-824.548) (-829.551) (-825.853) [-825.135] -- 0:01:21
58000 -- [-830.377] (-825.461) (-836.609) (-837.499) * (-824.770) [-825.118] (-825.279) (-827.227) -- 0:01:21
58500 -- (-828.606) (-824.738) (-846.648) [-835.378] * [-825.278] (-830.949) (-827.046) (-824.484) -- 0:01:20
59000 -- (-835.457) [-825.422] (-835.151) (-842.796) * [-826.513] (-832.363) (-827.503) (-828.666) -- 0:01:19
59500 -- [-840.930] (-827.222) (-839.241) (-836.799) * (-826.974) [-824.068] (-828.490) (-826.806) -- 0:01:19
60000 -- [-835.119] (-827.233) (-831.389) (-836.291) * (-828.844) [-827.123] (-829.176) (-824.250) -- 0:01:18
Average standard deviation of split frequencies: 0.031900
60500 -- (-842.721) (-826.589) [-832.348] (-837.982) * (-826.534) (-826.039) (-830.143) [-826.190] -- 0:01:17
61000 -- (-836.072) [-829.503] (-833.347) (-839.210) * (-826.930) (-824.333) (-825.066) [-826.970] -- 0:01:16
61500 -- [-835.789] (-827.430) (-846.929) (-830.777) * (-826.420) (-825.439) (-826.173) [-825.719] -- 0:01:16
62000 -- (-839.470) (-827.632) [-838.804] (-838.537) * (-826.634) [-825.872] (-825.168) (-827.123) -- 0:01:15
62500 -- (-833.735) (-825.576) [-836.762] (-835.189) * (-826.436) (-828.572) [-825.933] (-826.627) -- 0:01:15
63000 -- [-830.550] (-824.762) (-831.866) (-845.999) * (-826.548) [-826.700] (-824.340) (-826.726) -- 0:01:14
63500 -- (-829.818) [-826.937] (-836.753) (-832.174) * (-826.871) (-826.151) [-825.070] (-825.425) -- 0:01:13
64000 -- [-834.045] (-827.418) (-836.686) (-836.077) * (-828.092) [-824.303] (-826.932) (-829.341) -- 0:01:13
64500 -- [-835.651] (-826.771) (-835.979) (-836.767) * (-824.847) (-824.591) (-827.153) [-826.231] -- 0:01:12
65000 -- [-831.004] (-825.886) (-830.028) (-834.805) * (-825.052) (-827.406) [-826.394] (-825.585) -- 0:01:11
Average standard deviation of split frequencies: 0.026529
65500 -- [-834.294] (-828.323) (-832.938) (-835.919) * [-826.232] (-828.790) (-827.422) (-825.536) -- 0:01:11
66000 -- [-831.805] (-826.847) (-834.478) (-835.066) * (-832.105) (-829.732) [-827.677] (-829.926) -- 0:01:10
66500 -- (-838.809) (-825.151) [-836.573] (-843.244) * (-826.843) (-826.941) [-826.282] (-823.996) -- 0:01:10
67000 -- (-841.688) [-825.842] (-842.480) (-831.497) * [-824.762] (-825.450) (-823.751) (-824.504) -- 0:01:09
67500 -- (-833.244) [-825.937] (-833.926) (-840.538) * (-827.874) [-827.209] (-825.315) (-823.799) -- 0:01:09
68000 -- (-836.439) (-823.949) [-834.073] (-832.656) * [-831.250] (-825.008) (-827.807) (-827.059) -- 0:01:08
68500 -- [-832.312] (-828.115) (-835.347) (-828.254) * (-825.395) (-824.810) [-825.759] (-824.074) -- 0:01:21
69000 -- (-840.851) (-827.017) (-834.270) [-832.101] * [-825.868] (-827.049) (-826.378) (-832.626) -- 0:01:20
69500 -- (-836.308) (-830.558) (-834.382) [-838.688] * (-829.370) (-825.845) (-831.101) [-826.625] -- 0:01:20
70000 -- (-835.724) (-826.029) [-836.969] (-836.772) * (-829.356) (-826.327) [-824.471] (-829.813) -- 0:01:19
Average standard deviation of split frequencies: 0.028685
70500 -- (-834.652) [-827.712] (-842.876) (-844.543) * (-827.494) (-825.173) (-826.373) [-825.419] -- 0:01:19
71000 -- [-834.700] (-826.704) (-842.962) (-836.157) * (-824.858) (-825.919) [-828.245] (-828.114) -- 0:01:18
71500 -- [-835.926] (-826.068) (-834.665) (-838.482) * (-826.675) (-826.804) (-825.023) [-826.951] -- 0:01:17
72000 -- (-829.991) (-826.177) [-837.841] (-832.515) * (-828.777) (-827.794) [-825.287] (-827.987) -- 0:01:17
72500 -- (-833.494) (-826.877) [-833.180] (-827.144) * [-824.955] (-828.615) (-825.477) (-827.127) -- 0:01:16
73000 -- [-836.475] (-824.513) (-846.610) (-831.528) * (-825.453) (-827.426) (-827.771) [-825.857] -- 0:01:16
73500 -- (-833.720) (-825.507) [-837.138] (-828.096) * (-824.480) (-827.624) (-826.211) [-826.289] -- 0:01:15
74000 -- (-834.253) (-825.728) (-835.129) [-828.515] * (-825.912) (-825.095) [-827.460] (-825.767) -- 0:01:15
74500 -- (-843.999) (-824.874) [-831.713] (-826.647) * (-825.071) (-828.583) (-824.731) [-826.773] -- 0:01:14
75000 -- (-838.677) (-824.089) [-836.237] (-827.578) * [-826.222] (-826.091) (-828.335) (-830.703) -- 0:01:14
Average standard deviation of split frequencies: 0.021399
75500 -- (-836.429) (-825.874) [-833.002] (-827.424) * (-826.362) [-826.237] (-825.681) (-825.073) -- 0:01:13
76000 -- (-832.280) (-828.832) [-837.190] (-827.077) * (-826.541) (-825.058) (-828.465) [-824.244] -- 0:01:12
76500 -- (-836.748) (-828.256) [-832.505] (-828.936) * (-826.215) (-825.220) (-827.942) [-825.709] -- 0:01:12
77000 -- (-833.285) (-826.913) [-834.875] (-826.808) * (-825.252) (-824.260) [-827.653] (-823.967) -- 0:01:11
77500 -- (-845.541) [-825.267] (-836.799) (-825.860) * (-826.422) (-824.402) [-828.457] (-827.319) -- 0:01:11
78000 -- (-837.316) [-826.200] (-832.646) (-828.025) * [-826.505] (-825.728) (-827.349) (-824.501) -- 0:01:10
78500 -- (-838.630) [-829.959] (-840.087) (-827.883) * (-825.448) [-826.405] (-827.923) (-824.773) -- 0:01:10
79000 -- (-836.820) [-829.410] (-833.902) (-826.251) * [-825.384] (-829.026) (-825.202) (-824.187) -- 0:01:09
79500 -- (-839.261) [-827.684] (-836.438) (-826.594) * (-824.293) (-829.014) (-825.686) [-826.323] -- 0:01:09
80000 -- (-850.993) [-825.798] (-844.272) (-826.219) * (-825.687) (-827.858) (-829.603) [-826.785] -- 0:01:09
Average standard deviation of split frequencies: 0.026297
80500 -- (-833.464) (-827.552) [-831.915] (-824.773) * (-826.206) [-824.598] (-825.410) (-828.612) -- 0:01:08
81000 -- (-828.128) (-830.681) (-832.345) [-827.106] * (-825.267) (-826.893) [-825.211] (-826.971) -- 0:01:08
81500 -- [-825.298] (-825.930) (-827.529) (-825.473) * (-825.268) [-830.498] (-826.109) (-830.198) -- 0:01:07
82000 -- (-829.020) (-825.091) (-829.169) [-825.606] * (-826.096) (-826.192) [-824.931] (-830.057) -- 0:01:07
82500 -- [-827.978] (-827.803) (-826.838) (-824.575) * [-824.670] (-825.828) (-825.230) (-825.103) -- 0:01:17
83000 -- (-825.879) (-827.042) (-824.189) [-824.621] * [-826.033] (-826.465) (-826.011) (-825.980) -- 0:01:17
83500 -- (-824.916) (-824.926) (-823.815) [-824.648] * (-824.562) [-829.329] (-824.422) (-828.969) -- 0:01:16
84000 -- (-826.193) [-825.269] (-824.397) (-824.533) * (-826.188) (-824.835) (-829.714) [-824.164] -- 0:01:16
84500 -- [-830.039] (-828.023) (-824.765) (-829.194) * (-825.033) (-828.735) [-824.811] (-824.940) -- 0:01:15
85000 -- (-830.773) (-825.856) [-823.887] (-827.406) * [-824.192] (-832.268) (-824.295) (-824.944) -- 0:01:15
Average standard deviation of split frequencies: 0.021926
85500 -- (-827.474) (-828.216) [-825.774] (-826.264) * (-826.109) (-831.698) (-827.447) [-825.290] -- 0:01:14
86000 -- [-826.599] (-827.333) (-824.337) (-824.973) * (-828.674) (-825.356) [-825.596] (-826.127) -- 0:01:14
86500 -- (-826.608) [-828.209] (-828.259) (-824.516) * (-824.245) (-825.080) [-826.207] (-826.575) -- 0:01:13
87000 -- (-824.836) (-825.870) [-826.389] (-826.542) * [-825.455] (-824.786) (-826.982) (-829.488) -- 0:01:13
87500 -- (-827.959) (-825.133) [-829.269] (-827.122) * [-825.808] (-824.760) (-827.815) (-825.115) -- 0:01:13
88000 -- (-824.647) (-827.607) (-827.544) [-825.825] * (-826.690) (-824.849) (-826.710) [-827.331] -- 0:01:12
88500 -- [-825.451] (-831.238) (-826.431) (-827.020) * (-824.859) (-825.714) (-824.522) [-827.288] -- 0:01:12
89000 -- [-826.159] (-830.151) (-824.749) (-828.495) * (-827.161) [-824.520] (-825.365) (-827.293) -- 0:01:11
89500 -- (-824.091) (-824.144) (-824.802) [-831.030] * (-827.330) (-826.817) (-824.577) [-824.201] -- 0:01:11
90000 -- (-824.485) (-825.163) [-825.372] (-825.196) * (-827.306) (-832.491) (-824.820) [-824.369] -- 0:01:10
Average standard deviation of split frequencies: 0.022617
90500 -- (-825.787) (-826.276) [-824.842] (-824.839) * (-829.090) [-829.740] (-825.540) (-825.321) -- 0:01:10
91000 -- (-824.920) (-825.415) (-827.181) [-825.641] * [-829.393] (-825.257) (-828.732) (-827.082) -- 0:01:09
91500 -- (-826.296) (-827.613) (-826.181) [-824.785] * (-824.270) [-824.648] (-828.807) (-824.303) -- 0:01:09
92000 -- [-826.063] (-825.973) (-827.810) (-824.963) * (-826.511) [-829.296] (-826.530) (-825.593) -- 0:01:09
92500 -- (-829.365) (-826.993) [-825.658] (-826.802) * (-825.165) (-827.246) [-825.214] (-825.840) -- 0:01:08
93000 -- (-827.519) (-827.339) (-825.695) [-825.908] * (-825.421) (-829.371) [-824.673] (-825.549) -- 0:01:08
93500 -- (-826.305) [-826.791] (-824.805) (-825.325) * (-825.628) (-829.368) (-832.947) [-827.511] -- 0:01:07
94000 -- (-826.253) (-829.796) (-825.396) [-825.221] * [-826.672] (-829.403) (-830.100) (-827.158) -- 0:01:07
94500 -- (-826.690) [-827.411] (-825.085) (-827.306) * (-826.772) (-824.089) [-824.144] (-827.099) -- 0:01:07
95000 -- (-825.482) (-825.536) [-824.468] (-831.960) * (-825.171) (-826.325) (-828.231) [-825.094] -- 0:01:06
Average standard deviation of split frequencies: 0.022343
95500 -- (-824.243) (-825.837) [-825.235] (-824.701) * [-824.412] (-826.166) (-826.915) (-826.426) -- 0:01:06
96000 -- (-824.088) (-825.174) [-825.752] (-828.822) * (-824.205) (-825.362) (-823.992) [-824.604] -- 0:01:05
96500 -- (-824.873) (-826.612) (-824.483) [-827.750] * [-824.588] (-827.606) (-829.524) (-826.002) -- 0:01:05
97000 -- [-826.391] (-826.420) (-829.549) (-828.936) * (-824.660) (-824.825) [-831.342] (-825.294) -- 0:01:14
97500 -- (-826.272) (-827.483) (-825.443) [-827.344] * (-825.738) (-824.938) [-828.620] (-823.720) -- 0:01:14
98000 -- (-826.461) (-826.726) [-824.716] (-825.405) * (-826.653) [-824.403] (-825.159) (-824.950) -- 0:01:13
98500 -- (-826.623) (-824.605) [-826.366] (-830.643) * (-826.683) [-825.588] (-824.572) (-824.301) -- 0:01:13
99000 -- (-826.739) [-824.504] (-827.841) (-832.141) * (-825.216) (-824.278) (-829.282) [-824.449] -- 0:01:12
99500 -- (-826.882) (-827.346) [-826.985] (-824.789) * (-825.092) (-825.843) [-825.461] (-827.327) -- 0:01:12
100000 -- (-827.440) [-824.824] (-826.555) (-824.651) * (-825.946) [-824.180] (-825.571) (-827.890) -- 0:01:12
Average standard deviation of split frequencies: 0.021935
100500 -- (-827.307) (-826.891) (-826.995) [-824.998] * (-825.539) (-826.117) (-824.890) [-826.800] -- 0:01:11
101000 -- (-834.745) [-825.836] (-826.008) (-825.833) * [-824.335] (-824.325) (-825.838) (-824.415) -- 0:01:11
101500 -- [-837.010] (-826.231) (-826.458) (-826.176) * (-823.959) (-824.591) [-827.662] (-827.050) -- 0:01:10
102000 -- [-831.120] (-826.362) (-826.029) (-824.259) * (-824.133) [-825.154] (-827.108) (-824.456) -- 0:01:10
102500 -- [-826.404] (-825.096) (-829.165) (-824.412) * (-826.378) (-825.868) (-825.067) [-830.343] -- 0:01:10
103000 -- (-828.784) [-824.570] (-825.822) (-824.381) * (-825.012) (-826.297) (-829.040) [-825.927] -- 0:01:09
103500 -- (-824.366) (-824.666) [-825.772] (-828.844) * (-830.189) (-828.921) [-824.847] (-828.867) -- 0:01:09
104000 -- (-824.353) (-825.190) [-825.098] (-825.339) * [-827.135] (-825.291) (-826.071) (-825.680) -- 0:01:08
104500 -- [-827.766] (-827.710) (-824.031) (-825.422) * [-825.261] (-825.445) (-829.381) (-828.014) -- 0:01:08
105000 -- (-826.190) [-825.439] (-825.915) (-824.837) * (-826.006) [-825.269] (-825.396) (-828.456) -- 0:01:08
Average standard deviation of split frequencies: 0.024237
105500 -- [-826.433] (-825.749) (-826.141) (-824.342) * [-827.416] (-826.914) (-828.213) (-829.311) -- 0:01:07
106000 -- (-830.970) (-825.771) (-824.405) [-825.393] * (-827.226) (-827.689) (-830.427) [-824.867] -- 0:01:07
106500 -- [-828.424] (-825.058) (-824.954) (-828.153) * (-827.289) (-824.538) [-827.852] (-826.746) -- 0:01:07
107000 -- (-824.655) [-825.139] (-824.738) (-826.046) * (-824.711) (-826.752) [-825.003] (-829.054) -- 0:01:06
107500 -- (-825.709) (-826.275) [-824.798] (-825.081) * (-825.742) [-824.863] (-826.103) (-830.024) -- 0:01:06
108000 -- (-827.637) [-825.994] (-825.074) (-828.201) * (-824.752) [-826.281] (-824.850) (-825.336) -- 0:01:06
108500 -- (-826.238) (-825.885) (-826.483) [-827.763] * [-823.748] (-826.168) (-824.778) (-826.905) -- 0:01:05
109000 -- (-824.328) (-826.969) (-827.969) [-826.704] * [-825.484] (-826.859) (-826.300) (-824.057) -- 0:01:05
109500 -- (-828.608) (-825.982) [-827.564] (-831.156) * (-823.845) (-830.619) (-826.222) [-827.792] -- 0:01:05
110000 -- [-826.264] (-828.708) (-826.016) (-826.960) * [-823.926] (-827.692) (-828.910) (-829.729) -- 0:01:04
Average standard deviation of split frequencies: 0.024375
110500 -- [-825.677] (-825.637) (-825.807) (-824.671) * [-824.385] (-829.240) (-830.177) (-825.776) -- 0:01:04
111000 -- [-828.850] (-826.762) (-825.782) (-828.292) * (-827.806) (-824.805) (-830.445) [-824.977] -- 0:01:12
111500 -- (-825.111) [-824.865] (-827.156) (-825.601) * [-826.204] (-824.394) (-834.207) (-825.337) -- 0:01:11
112000 -- [-824.218] (-825.878) (-831.463) (-826.087) * (-823.878) [-825.553] (-826.728) (-828.621) -- 0:01:11
112500 -- [-826.114] (-827.234) (-832.080) (-825.776) * [-824.187] (-826.831) (-827.346) (-827.368) -- 0:01:11
113000 -- (-829.412) (-824.651) (-828.340) [-825.110] * (-825.897) (-824.374) (-825.512) [-824.883] -- 0:01:10
113500 -- (-829.578) (-826.619) (-825.608) [-826.671] * (-834.778) (-825.196) [-826.464] (-824.448) -- 0:01:10
114000 -- (-824.952) [-825.054] (-824.697) (-826.214) * (-825.431) [-825.602] (-827.475) (-824.623) -- 0:01:09
114500 -- (-825.918) (-825.460) (-827.302) [-824.949] * (-830.733) [-824.072] (-827.825) (-826.405) -- 0:01:09
115000 -- (-826.989) (-825.376) (-826.551) [-827.498] * (-825.418) (-826.627) (-829.904) [-826.942] -- 0:01:09
Average standard deviation of split frequencies: 0.025880
115500 -- (-827.016) [-825.585] (-825.490) (-824.774) * (-828.334) (-826.125) (-826.885) [-828.175] -- 0:01:08
116000 -- (-824.434) [-825.156] (-826.735) (-827.688) * (-827.468) (-826.867) (-828.019) [-826.266] -- 0:01:08
116500 -- (-826.561) (-827.885) (-825.960) [-827.278] * (-824.796) [-828.600] (-826.511) (-825.440) -- 0:01:08
117000 -- (-827.362) (-824.722) [-825.957] (-824.898) * (-829.423) [-828.071] (-825.754) (-826.947) -- 0:01:07
117500 -- [-828.419] (-832.879) (-824.784) (-832.039) * (-829.146) (-826.488) [-826.167] (-826.123) -- 0:01:07
118000 -- (-825.525) [-826.070] (-827.331) (-828.984) * (-825.275) [-826.960] (-827.799) (-825.723) -- 0:01:07
118500 -- (-826.274) (-826.467) [-826.200] (-827.060) * (-825.156) (-825.726) [-825.531] (-827.533) -- 0:01:06
119000 -- [-824.812] (-824.328) (-825.465) (-827.959) * [-824.464] (-826.209) (-825.077) (-828.243) -- 0:01:06
119500 -- (-824.994) [-824.443] (-827.112) (-825.435) * [-825.728] (-826.600) (-825.184) (-829.125) -- 0:01:06
120000 -- (-825.908) (-824.572) [-827.210] (-833.589) * (-824.991) [-824.972] (-826.252) (-826.169) -- 0:01:06
Average standard deviation of split frequencies: 0.024057
120500 -- (-828.355) [-825.857] (-824.838) (-826.209) * (-826.797) (-826.238) [-827.935] (-827.628) -- 0:01:05
121000 -- [-827.872] (-829.018) (-824.802) (-827.457) * (-825.710) [-826.795] (-824.343) (-824.368) -- 0:01:05
121500 -- (-826.378) [-826.936] (-824.763) (-826.656) * (-825.100) (-828.232) (-825.470) [-824.348] -- 0:01:05
122000 -- (-830.686) (-826.489) [-825.105] (-828.050) * (-825.017) (-830.639) [-825.873] (-826.649) -- 0:01:04
122500 -- [-830.831] (-824.953) (-824.100) (-825.393) * (-826.057) (-828.233) [-824.181] (-825.327) -- 0:01:04
123000 -- (-830.180) (-830.828) (-828.574) [-825.831] * (-824.710) (-824.518) (-824.910) [-824.279] -- 0:01:04
123500 -- (-828.530) (-825.843) (-829.091) [-824.949] * (-824.071) (-831.116) [-826.348] (-823.899) -- 0:01:03
124000 -- (-826.939) (-825.818) [-827.935] (-825.210) * (-824.973) (-824.189) [-825.333] (-823.837) -- 0:01:03
124500 -- [-833.226] (-825.550) (-826.060) (-824.824) * [-826.143] (-826.119) (-828.713) (-824.618) -- 0:01:03
125000 -- [-825.657] (-826.389) (-826.733) (-829.033) * (-827.916) (-825.437) [-826.773] (-824.277) -- 0:01:03
Average standard deviation of split frequencies: 0.022448
125500 -- (-824.681) (-826.174) (-824.714) [-827.048] * (-829.154) (-825.270) [-826.623] (-824.377) -- 0:01:09
126000 -- (-831.124) (-825.851) [-824.954] (-827.303) * (-825.592) (-827.319) [-825.572] (-825.300) -- 0:01:09
126500 -- [-827.005] (-827.259) (-826.435) (-828.150) * [-827.990] (-826.090) (-827.217) (-826.503) -- 0:01:09
127000 -- [-825.877] (-825.485) (-824.937) (-827.554) * (-826.699) [-826.452] (-828.599) (-826.403) -- 0:01:08
127500 -- (-826.445) (-824.905) [-824.937] (-824.744) * (-828.898) [-827.658] (-825.692) (-825.703) -- 0:01:08
128000 -- (-832.163) (-825.529) (-826.359) [-824.658] * (-829.014) (-826.409) [-825.263] (-833.272) -- 0:01:08
128500 -- (-831.104) (-828.383) (-829.716) [-825.749] * (-829.396) (-826.387) [-824.276] (-825.412) -- 0:01:07
129000 -- (-831.286) [-824.121] (-827.668) (-826.435) * (-829.739) (-824.596) (-826.032) [-824.254] -- 0:01:07
129500 -- [-826.595] (-824.847) (-826.631) (-825.374) * (-831.409) (-824.571) [-825.785] (-826.690) -- 0:01:07
130000 -- (-827.108) (-828.762) (-824.438) [-824.869] * (-826.009) (-824.541) (-825.025) [-825.978] -- 0:01:06
Average standard deviation of split frequencies: 0.020644
130500 -- (-824.567) (-829.060) (-823.876) [-826.444] * [-826.304] (-824.635) (-826.107) (-829.352) -- 0:01:06
131000 -- (-824.177) [-824.827] (-825.544) (-828.334) * (-826.327) (-823.961) [-825.018] (-824.119) -- 0:01:06
131500 -- [-824.615] (-824.948) (-827.665) (-825.206) * [-826.774] (-828.357) (-825.399) (-831.978) -- 0:01:06
132000 -- (-826.696) [-825.520] (-825.602) (-824.983) * (-826.549) [-824.657] (-826.923) (-830.713) -- 0:01:05
132500 -- [-825.497] (-824.859) (-826.608) (-830.541) * (-827.768) (-827.549) [-826.666] (-829.373) -- 0:01:05
133000 -- [-824.134] (-827.259) (-825.756) (-826.155) * (-824.974) [-828.491] (-824.938) (-827.195) -- 0:01:05
133500 -- (-826.980) [-829.235] (-824.511) (-825.122) * [-827.161] (-826.238) (-824.837) (-824.864) -- 0:01:04
134000 -- [-826.990] (-830.002) (-825.816) (-826.003) * (-828.179) (-827.246) [-825.345] (-829.582) -- 0:01:04
134500 -- [-827.388] (-828.967) (-825.067) (-825.820) * (-827.024) (-827.255) [-824.801] (-827.141) -- 0:01:04
135000 -- (-825.947) (-825.452) [-824.248] (-827.287) * (-826.965) (-826.242) [-825.230] (-826.487) -- 0:01:04
Average standard deviation of split frequencies: 0.019257
135500 -- (-825.772) [-825.345] (-825.024) (-825.695) * (-825.753) (-826.236) [-828.003] (-826.122) -- 0:01:03
136000 -- (-826.495) (-825.241) [-824.318] (-827.417) * [-825.588] (-826.822) (-827.437) (-824.392) -- 0:01:03
136500 -- (-826.574) (-826.212) (-824.697) [-827.037] * (-825.961) (-825.170) (-827.178) [-826.553] -- 0:01:03
137000 -- [-829.033] (-824.830) (-824.535) (-826.511) * (-826.331) (-825.019) (-827.024) [-828.682] -- 0:01:02
137500 -- (-834.659) (-826.510) [-829.039] (-826.328) * [-826.400] (-823.912) (-829.190) (-824.600) -- 0:01:02
138000 -- (-830.664) (-825.745) [-824.504] (-827.018) * (-827.720) (-826.409) [-827.586] (-827.188) -- 0:01:02
138500 -- (-829.611) [-827.651] (-824.967) (-827.318) * [-825.590] (-824.260) (-828.400) (-825.654) -- 0:01:02
139000 -- (-827.490) (-830.940) [-824.977] (-826.921) * [-828.263] (-824.599) (-827.820) (-826.499) -- 0:01:01
139500 -- (-828.234) (-827.152) [-829.083] (-826.662) * [-824.763] (-824.653) (-825.548) (-827.816) -- 0:01:01
140000 -- (-827.537) (-826.477) [-824.828] (-829.528) * (-824.997) (-825.834) (-828.032) [-826.899] -- 0:01:07
Average standard deviation of split frequencies: 0.019516
140500 -- (-828.583) (-827.064) (-824.558) [-826.476] * (-828.481) [-827.967] (-824.824) (-830.925) -- 0:01:07
141000 -- [-828.273] (-826.195) (-825.809) (-828.537) * (-827.643) [-825.366] (-826.219) (-829.968) -- 0:01:07
141500 -- [-830.158] (-826.315) (-825.548) (-826.447) * (-831.193) (-827.323) (-824.529) [-826.495] -- 0:01:06
142000 -- [-825.078] (-826.456) (-824.546) (-826.913) * (-825.069) (-827.745) (-823.901) [-826.596] -- 0:01:06
142500 -- (-828.689) (-825.656) (-825.651) [-825.598] * (-825.646) (-827.388) [-825.979] (-825.136) -- 0:01:06
143000 -- [-827.518] (-826.277) (-825.598) (-825.277) * (-826.419) (-827.521) (-823.998) [-824.125] -- 0:01:05
143500 -- [-826.996] (-825.853) (-826.611) (-824.430) * [-826.553] (-826.253) (-827.450) (-826.878) -- 0:01:05
144000 -- [-825.476] (-824.590) (-826.775) (-825.190) * (-825.588) (-826.283) (-826.719) [-824.078] -- 0:01:05
144500 -- (-824.796) (-827.147) (-827.541) [-828.389] * [-824.656] (-829.361) (-825.977) (-828.756) -- 0:01:05
145000 -- (-825.705) (-829.681) (-825.356) [-826.890] * (-829.504) (-825.108) (-825.142) [-823.822] -- 0:01:04
Average standard deviation of split frequencies: 0.016682
145500 -- [-825.692] (-824.277) (-825.935) (-824.278) * [-827.917] (-828.592) (-825.176) (-824.405) -- 0:01:04
146000 -- (-826.921) (-826.026) (-827.790) [-824.514] * (-827.310) (-825.315) [-825.910] (-826.125) -- 0:01:04
146500 -- (-825.918) (-826.901) (-826.734) [-825.199] * [-825.554] (-825.263) (-828.726) (-825.849) -- 0:01:04
147000 -- (-825.672) [-824.671] (-827.158) (-828.860) * (-826.060) (-829.434) (-825.900) [-824.584] -- 0:01:03
147500 -- (-828.625) [-825.355] (-827.108) (-829.120) * [-828.437] (-829.937) (-826.383) (-825.138) -- 0:01:03
148000 -- (-828.077) (-828.045) [-827.135] (-830.195) * (-828.495) (-824.023) [-829.068] (-826.366) -- 0:01:03
148500 -- (-825.645) [-826.708] (-825.659) (-828.556) * (-826.677) (-823.968) [-825.677] (-825.197) -- 0:01:03
149000 -- (-826.305) (-827.009) [-824.492] (-827.058) * (-825.572) (-824.773) [-828.546] (-832.315) -- 0:01:02
149500 -- (-827.492) (-824.575) (-824.493) [-824.591] * (-825.344) [-825.157] (-827.402) (-828.006) -- 0:01:02
150000 -- (-826.194) (-825.247) (-828.701) [-824.720] * (-825.610) (-827.049) [-826.666] (-831.080) -- 0:01:02
Average standard deviation of split frequencies: 0.015992
150500 -- [-826.271] (-825.851) (-828.274) (-825.296) * (-825.670) (-825.874) (-825.333) [-823.946] -- 0:01:02
151000 -- (-828.511) (-824.007) [-826.935] (-824.367) * (-826.018) (-829.668) (-825.103) [-824.820] -- 0:01:01
151500 -- (-829.061) (-825.491) (-828.580) [-824.286] * (-826.080) (-827.745) [-825.229] (-824.481) -- 0:01:01
152000 -- (-825.272) (-825.881) [-828.634] (-825.375) * [-825.646] (-828.559) (-826.877) (-826.498) -- 0:01:01
152500 -- (-826.250) [-825.186] (-827.717) (-825.659) * (-830.988) (-828.251) (-824.727) [-824.699] -- 0:01:01
153000 -- (-826.791) (-827.002) (-827.399) [-824.796] * (-827.238) (-830.508) [-825.092] (-824.276) -- 0:01:00
153500 -- (-828.454) [-825.530] (-826.483) (-825.045) * (-825.849) [-830.327] (-829.831) (-827.431) -- 0:01:00
154000 -- (-829.681) (-824.501) (-826.651) [-825.717] * [-826.983] (-827.372) (-825.014) (-828.566) -- 0:01:05
154500 -- (-828.725) (-827.573) [-825.102] (-827.634) * [-824.338] (-825.369) (-831.317) (-828.566) -- 0:01:05
155000 -- [-826.450] (-825.197) (-827.305) (-827.934) * (-828.248) [-829.389] (-827.917) (-830.733) -- 0:01:05
Average standard deviation of split frequencies: 0.017177
155500 -- (-827.288) [-824.541] (-826.398) (-824.240) * (-825.053) [-826.195] (-826.668) (-829.745) -- 0:01:05
156000 -- (-829.358) (-825.640) [-826.757] (-829.022) * [-825.265] (-825.182) (-826.660) (-828.866) -- 0:01:04
156500 -- (-828.994) (-825.375) [-825.939] (-832.595) * [-825.135] (-828.223) (-824.215) (-826.086) -- 0:01:04
157000 -- (-831.181) (-825.117) (-829.594) [-827.577] * (-825.330) [-825.150] (-825.054) (-826.222) -- 0:01:04
157500 -- (-826.935) [-825.573] (-830.355) (-826.892) * [-825.504] (-824.348) (-825.033) (-826.429) -- 0:01:04
158000 -- (-826.416) [-824.474] (-828.010) (-824.930) * (-830.345) (-827.980) [-825.481] (-824.140) -- 0:01:03
158500 -- (-826.576) [-825.082] (-829.746) (-830.095) * (-824.517) (-828.096) (-827.785) [-824.469] -- 0:01:03
159000 -- (-827.140) (-828.797) (-828.337) [-827.135] * [-825.877] (-823.926) (-830.752) (-825.007) -- 0:01:03
159500 -- (-827.723) [-824.398] (-833.495) (-825.024) * (-826.014) (-826.681) [-825.348] (-826.343) -- 0:01:03
160000 -- (-830.506) (-824.379) [-825.645] (-825.598) * (-825.726) (-824.004) (-828.524) [-827.703] -- 0:01:02
Average standard deviation of split frequencies: 0.017115
160500 -- (-827.413) (-826.320) (-828.188) [-825.445] * [-825.233] (-825.250) (-829.666) (-824.836) -- 0:01:02
161000 -- [-826.105] (-827.314) (-830.082) (-827.699) * (-826.603) (-825.414) [-825.612] (-824.364) -- 0:01:02
161500 -- [-825.207] (-824.294) (-828.719) (-825.342) * [-830.462] (-825.318) (-828.163) (-825.963) -- 0:01:02
162000 -- (-824.850) (-825.706) [-827.119] (-825.985) * (-828.373) (-826.094) (-824.089) [-826.406] -- 0:01:02
162500 -- [-824.697] (-828.778) (-830.401) (-826.797) * (-826.399) (-825.095) [-825.223] (-825.789) -- 0:01:01
163000 -- (-829.007) [-825.726] (-828.750) (-825.825) * (-827.223) (-824.899) [-824.920] (-827.979) -- 0:01:01
163500 -- (-828.826) (-827.487) (-826.096) [-824.288] * (-824.264) [-824.164] (-828.392) (-824.304) -- 0:01:01
164000 -- (-827.886) (-826.130) [-826.771] (-825.105) * (-825.810) [-824.162] (-824.355) (-824.925) -- 0:01:01
164500 -- (-825.677) (-824.469) [-826.933] (-824.902) * (-826.470) [-828.374] (-828.289) (-824.220) -- 0:01:00
165000 -- [-825.198] (-824.782) (-825.591) (-825.194) * [-827.168] (-825.601) (-829.335) (-824.220) -- 0:01:00
Average standard deviation of split frequencies: 0.017039
165500 -- [-827.824] (-824.673) (-825.220) (-825.837) * (-827.737) (-828.225) [-826.732] (-828.272) -- 0:01:00
166000 -- [-825.311] (-826.856) (-824.422) (-831.794) * (-825.171) [-828.730] (-831.635) (-827.295) -- 0:01:00
166500 -- (-825.684) (-826.299) [-824.590] (-827.896) * (-824.754) (-825.735) (-826.301) [-825.695] -- 0:01:00
167000 -- (-825.714) (-825.221) [-825.411] (-829.284) * [-824.926] (-825.108) (-824.150) (-828.339) -- 0:00:59
167500 -- (-826.363) [-825.714] (-826.957) (-832.178) * (-824.886) (-826.423) [-826.555] (-827.136) -- 0:00:59
168000 -- [-824.961] (-825.836) (-825.353) (-826.450) * (-826.341) (-824.841) [-826.302] (-825.700) -- 0:01:04
168500 -- (-826.147) (-829.083) (-825.079) [-825.721] * (-826.906) [-825.388] (-830.516) (-824.745) -- 0:01:04
169000 -- (-824.755) [-828.102] (-826.484) (-825.627) * (-828.697) (-828.840) [-827.469] (-826.058) -- 0:01:03
169500 -- (-825.714) (-824.844) [-825.965] (-825.400) * [-826.314] (-829.613) (-827.538) (-826.690) -- 0:01:03
170000 -- [-826.191] (-825.454) (-826.672) (-824.729) * (-827.881) (-824.161) (-827.068) [-825.835] -- 0:01:03
Average standard deviation of split frequencies: 0.015959
170500 -- (-828.077) [-824.593] (-828.034) (-826.876) * [-826.193] (-825.261) (-827.589) (-830.130) -- 0:01:03
171000 -- [-829.805] (-824.746) (-827.585) (-825.066) * [-826.243] (-830.073) (-827.143) (-827.029) -- 0:01:03
171500 -- (-825.033) (-825.457) (-827.041) [-826.501] * (-826.581) (-826.351) [-826.392] (-825.369) -- 0:01:02
172000 -- (-827.933) (-825.317) [-827.579] (-828.821) * (-826.158) (-826.037) [-825.464] (-825.782) -- 0:01:02
172500 -- (-829.471) [-824.402] (-824.772) (-827.256) * (-824.531) [-824.474] (-824.974) (-824.100) -- 0:01:02
173000 -- (-826.763) (-824.662) [-825.534] (-828.622) * (-827.190) [-824.218] (-825.482) (-824.100) -- 0:01:02
173500 -- [-824.813] (-825.014) (-824.835) (-826.970) * (-826.358) [-824.277] (-828.397) (-824.624) -- 0:01:01
174000 -- [-825.155] (-824.563) (-824.993) (-825.002) * (-827.703) (-824.696) (-827.329) [-826.798] -- 0:01:01
174500 -- (-826.163) (-826.880) [-826.508] (-824.999) * (-825.574) [-827.353] (-828.709) (-827.773) -- 0:01:01
175000 -- (-827.055) [-825.987] (-829.797) (-824.689) * [-826.224] (-824.143) (-828.019) (-827.716) -- 0:01:01
Average standard deviation of split frequencies: 0.017112
175500 -- [-824.469] (-827.310) (-827.448) (-825.699) * (-825.536) (-831.318) [-825.788] (-828.566) -- 0:01:01
176000 -- [-824.181] (-829.600) (-826.584) (-823.660) * (-825.607) (-826.732) [-825.830] (-828.690) -- 0:01:00
176500 -- (-824.350) (-825.869) [-827.755] (-825.562) * (-824.635) [-832.339] (-825.864) (-828.572) -- 0:01:00
177000 -- (-825.596) [-826.236] (-825.458) (-826.364) * (-825.313) [-823.997] (-828.228) (-829.003) -- 0:01:00
177500 -- [-826.502] (-825.725) (-826.921) (-826.494) * (-824.824) (-823.899) [-827.002] (-824.713) -- 0:01:00
178000 -- [-825.897] (-824.991) (-827.759) (-826.793) * (-824.687) [-827.982] (-825.292) (-827.935) -- 0:01:00
178500 -- [-824.599] (-825.723) (-827.527) (-825.752) * (-825.854) (-826.552) (-825.173) [-826.514] -- 0:00:59
179000 -- [-824.576] (-826.100) (-828.162) (-825.619) * [-825.625] (-826.110) (-828.686) (-825.792) -- 0:00:59
179500 -- [-825.172] (-825.539) (-825.018) (-824.353) * (-826.977) (-824.613) (-832.532) [-825.726] -- 0:00:59
180000 -- (-824.775) [-825.036] (-825.037) (-824.867) * (-827.719) (-823.727) (-825.726) [-824.749] -- 0:00:59
Average standard deviation of split frequencies: 0.016479
180500 -- (-825.252) (-824.305) [-828.711] (-824.449) * [-827.843] (-826.160) (-825.287) (-828.336) -- 0:00:59
181000 -- (-828.684) (-825.900) (-823.868) [-825.982] * [-827.373] (-826.704) (-828.650) (-823.958) -- 0:00:58
181500 -- [-825.643] (-825.600) (-824.213) (-826.045) * (-824.584) (-828.897) [-827.541] (-823.948) -- 0:00:58
182000 -- (-829.723) [-825.789] (-824.184) (-826.017) * [-825.629] (-825.072) (-829.264) (-824.030) -- 0:00:58
182500 -- (-825.106) (-825.326) (-828.971) [-824.098] * (-826.613) (-824.919) (-831.579) [-825.997] -- 0:01:02
183000 -- (-826.287) (-824.739) [-825.969] (-826.358) * [-824.923] (-824.905) (-828.385) (-826.757) -- 0:01:02
183500 -- (-826.767) (-825.952) [-824.550] (-826.935) * (-824.350) [-825.451] (-828.092) (-826.148) -- 0:01:02
184000 -- (-827.545) (-826.804) [-827.351] (-824.654) * (-825.856) [-827.445] (-825.254) (-826.311) -- 0:01:02
184500 -- (-825.243) (-827.795) [-826.171] (-828.778) * [-825.488] (-825.109) (-825.329) (-827.836) -- 0:01:01
185000 -- (-826.153) (-825.329) [-826.178] (-829.704) * (-825.565) [-826.202] (-824.548) (-826.695) -- 0:01:01
Average standard deviation of split frequencies: 0.017107
185500 -- [-827.294] (-823.993) (-824.473) (-828.689) * (-825.925) [-827.619] (-828.220) (-825.407) -- 0:01:01
186000 -- (-827.453) [-824.522] (-824.453) (-828.419) * (-831.137) (-825.676) (-827.424) [-824.558] -- 0:01:01
186500 -- (-827.347) (-825.763) [-824.935] (-829.227) * (-830.809) (-824.708) (-825.472) [-824.060] -- 0:01:01
187000 -- (-825.157) (-824.169) (-824.049) [-825.399] * [-827.096] (-824.818) (-827.276) (-826.615) -- 0:01:00
187500 -- (-826.945) (-825.486) (-825.246) [-827.054] * (-825.078) (-829.544) (-828.652) [-826.957] -- 0:01:00
188000 -- [-827.748] (-823.999) (-831.785) (-827.651) * (-825.365) (-825.198) (-826.219) [-826.673] -- 0:01:00
188500 -- (-827.155) [-825.560] (-828.016) (-825.272) * (-825.858) (-825.950) [-826.480] (-832.495) -- 0:01:00
189000 -- (-828.839) [-825.340] (-829.991) (-826.012) * (-824.724) [-823.782] (-826.410) (-829.774) -- 0:01:00
189500 -- (-825.633) [-825.434] (-825.926) (-828.357) * (-828.994) (-827.748) [-825.116] (-824.657) -- 0:00:59
190000 -- (-825.758) (-827.007) [-826.492] (-823.905) * (-828.760) [-824.670] (-826.714) (-825.495) -- 0:00:59
Average standard deviation of split frequencies: 0.016071
190500 -- (-826.098) (-826.913) [-825.032] (-824.470) * (-824.178) [-826.188] (-827.363) (-829.105) -- 0:00:59
191000 -- (-824.334) (-829.644) [-825.908] (-826.629) * (-825.752) (-824.982) (-824.579) [-824.428] -- 0:00:59
191500 -- (-827.540) (-829.396) (-826.455) [-825.021] * [-824.786] (-826.294) (-824.014) (-824.280) -- 0:00:59
192000 -- [-825.815] (-826.012) (-825.132) (-823.971) * (-825.707) (-825.422) [-826.912] (-827.265) -- 0:00:58
192500 -- (-824.557) [-824.014] (-824.592) (-826.425) * (-827.274) (-827.301) (-826.738) [-828.065] -- 0:00:58
193000 -- (-823.995) [-825.443] (-825.218) (-824.458) * [-826.273] (-828.473) (-827.307) (-827.643) -- 0:00:58
193500 -- [-824.653] (-824.777) (-824.273) (-826.470) * (-828.011) (-827.952) [-827.136] (-827.884) -- 0:00:58
194000 -- [-824.695] (-827.316) (-830.361) (-825.494) * (-832.081) [-825.689] (-827.048) (-827.988) -- 0:01:02
194500 -- [-824.557] (-827.680) (-828.305) (-828.162) * (-828.419) (-825.702) [-827.551] (-828.309) -- 0:01:02
195000 -- [-825.777] (-824.336) (-825.218) (-824.973) * (-828.317) [-825.267] (-826.542) (-824.474) -- 0:01:01
Average standard deviation of split frequencies: 0.015500
195500 -- [-826.424] (-825.526) (-826.518) (-827.190) * (-828.133) [-826.442] (-827.868) (-824.383) -- 0:01:01
196000 -- [-826.060] (-826.678) (-824.488) (-828.974) * (-828.910) [-828.513] (-825.715) (-830.723) -- 0:01:01
196500 -- (-826.855) (-827.999) [-826.281] (-829.607) * [-829.121] (-826.564) (-825.629) (-826.775) -- 0:01:01
197000 -- (-827.579) (-830.507) [-828.271] (-825.982) * (-827.261) [-826.011] (-825.494) (-825.903) -- 0:01:01
197500 -- (-824.420) (-824.089) [-825.137] (-824.190) * (-825.030) [-825.670] (-827.440) (-827.567) -- 0:01:00
198000 -- [-826.268] (-828.580) (-826.387) (-824.188) * (-828.379) (-826.178) [-827.960] (-827.202) -- 0:01:00
198500 -- (-829.162) (-827.745) (-825.949) [-826.281] * (-828.890) (-825.773) [-831.326] (-833.654) -- 0:01:00
199000 -- (-827.731) [-826.375] (-825.716) (-828.333) * (-825.917) [-824.652] (-829.470) (-828.409) -- 0:01:00
199500 -- (-829.523) [-826.597] (-825.185) (-826.035) * (-825.207) (-827.574) [-827.064] (-825.143) -- 0:01:00
200000 -- (-833.551) (-826.774) [-825.200] (-826.586) * (-826.977) [-825.119] (-827.007) (-830.180) -- 0:00:59
Average standard deviation of split frequencies: 0.016314
200500 -- (-828.907) (-824.201) (-827.692) [-824.432] * [-825.164] (-827.266) (-824.939) (-829.749) -- 0:00:59
201000 -- [-825.262] (-824.240) (-828.461) (-825.863) * (-824.200) (-826.220) (-826.135) [-824.485] -- 0:00:59
201500 -- (-826.348) [-824.283] (-829.027) (-825.774) * [-826.070] (-825.411) (-824.958) (-824.280) -- 0:00:59
202000 -- (-835.643) [-824.707] (-826.504) (-824.191) * [-825.008] (-829.363) (-827.517) (-829.812) -- 0:00:59
202500 -- (-826.509) (-824.926) [-826.325] (-826.994) * [-824.225] (-828.548) (-826.553) (-829.824) -- 0:00:59
203000 -- (-828.124) (-829.495) (-828.716) [-825.142] * (-825.895) [-826.286] (-824.185) (-834.376) -- 0:00:58
203500 -- (-828.557) (-826.577) (-827.898) [-827.510] * [-825.550] (-827.598) (-825.785) (-827.878) -- 0:00:58
204000 -- [-829.919] (-825.955) (-824.970) (-827.381) * (-828.638) [-827.357] (-827.918) (-827.464) -- 0:00:58
204500 -- (-829.437) (-824.473) [-825.485] (-825.218) * [-829.902] (-828.217) (-827.292) (-827.399) -- 0:00:58
205000 -- [-825.927] (-834.661) (-825.158) (-826.044) * (-825.454) (-824.119) [-824.715] (-829.397) -- 0:00:58
Average standard deviation of split frequencies: 0.014620
205500 -- (-827.891) [-826.759] (-824.888) (-826.858) * (-826.293) (-827.961) [-824.366] (-825.482) -- 0:00:57
206000 -- (-830.102) (-827.230) [-826.322] (-825.050) * (-829.117) [-828.253] (-826.481) (-825.761) -- 0:00:57
206500 -- (-828.077) (-831.445) (-825.368) [-826.141] * (-826.152) (-825.695) (-824.344) [-824.741] -- 0:00:57
207000 -- (-826.922) [-832.610] (-826.357) (-825.639) * (-824.788) (-826.124) [-824.246] (-825.030) -- 0:00:57
207500 -- (-824.434) (-826.118) (-824.323) [-825.764] * (-824.884) (-827.305) (-824.448) [-827.005] -- 0:00:57
208000 -- [-823.922] (-825.241) (-827.957) (-825.011) * (-826.220) (-825.317) [-825.291] (-825.744) -- 0:01:00
208500 -- (-824.283) [-829.978] (-824.903) (-824.921) * (-826.106) (-826.354) (-827.544) [-826.449] -- 0:01:00
209000 -- (-826.101) (-830.499) (-826.663) [-826.251] * [-828.783] (-826.777) (-827.372) (-824.225) -- 0:01:00
209500 -- (-827.924) (-826.272) [-826.621] (-824.258) * (-827.660) (-825.354) (-825.979) [-824.220] -- 0:01:00
210000 -- (-826.816) (-826.439) (-824.780) [-824.514] * [-825.047] (-827.569) (-827.715) (-824.356) -- 0:01:00
Average standard deviation of split frequencies: 0.015166
210500 -- (-825.871) (-825.363) (-824.673) [-824.510] * (-825.761) (-826.184) [-828.324] (-826.418) -- 0:01:00
211000 -- (-826.088) (-825.393) (-824.411) [-825.144] * (-827.210) (-829.245) [-826.497] (-825.507) -- 0:00:59
211500 -- (-824.737) [-825.428] (-825.095) (-825.505) * (-827.497) [-825.660] (-825.554) (-827.555) -- 0:00:59
212000 -- [-824.147] (-825.425) (-825.705) (-824.737) * (-828.448) (-825.098) [-827.504] (-827.828) -- 0:00:59
212500 -- (-829.425) (-826.953) (-825.521) [-826.399] * (-826.394) (-832.026) [-826.283] (-827.286) -- 0:00:59
213000 -- (-825.254) [-827.746] (-826.745) (-827.371) * (-826.330) (-825.049) [-825.080] (-825.113) -- 0:00:59
213500 -- [-824.717] (-827.543) (-828.343) (-824.573) * (-825.016) (-824.379) (-828.394) [-824.963] -- 0:00:58
214000 -- (-825.540) [-825.212] (-824.838) (-825.684) * [-826.097] (-825.564) (-824.502) (-832.246) -- 0:00:58
214500 -- (-827.058) [-824.743] (-826.000) (-829.193) * (-825.435) (-825.327) (-824.943) [-825.245] -- 0:00:58
215000 -- (-827.815) (-825.537) (-826.725) [-824.962] * (-825.224) (-826.339) (-824.444) [-826.729] -- 0:00:58
Average standard deviation of split frequencies: 0.016853
215500 -- [-824.355] (-828.067) (-828.808) (-824.962) * (-825.823) (-826.762) (-826.015) [-825.089] -- 0:00:58
216000 -- [-824.653] (-830.418) (-826.636) (-828.683) * (-824.847) (-827.678) [-825.112] (-824.654) -- 0:00:58
216500 -- (-824.572) [-828.475] (-824.104) (-828.072) * [-824.370] (-827.452) (-823.894) (-825.289) -- 0:00:57
217000 -- (-827.403) [-824.875] (-826.057) (-828.340) * (-826.864) (-827.980) (-827.959) [-825.082] -- 0:00:57
217500 -- (-826.743) [-826.031] (-824.413) (-826.121) * [-828.471] (-825.218) (-827.950) (-826.101) -- 0:00:57
218000 -- (-825.460) (-826.940) (-824.867) [-826.422] * (-825.008) (-828.821) (-828.634) [-826.018] -- 0:00:57
218500 -- (-825.594) (-824.669) [-824.439] (-825.322) * (-828.651) (-830.612) (-826.250) [-824.352] -- 0:00:57
219000 -- (-825.726) (-828.162) [-824.891] (-824.722) * (-825.773) (-829.491) [-825.179] (-825.355) -- 0:00:57
219500 -- [-828.452] (-825.649) (-824.983) (-825.114) * (-826.242) (-828.959) (-826.330) [-826.789] -- 0:00:56
220000 -- (-826.950) (-825.514) [-824.903] (-824.114) * [-826.140] (-825.561) (-825.947) (-829.107) -- 0:00:56
Average standard deviation of split frequencies: 0.017446
220500 -- (-826.033) (-829.519) (-826.928) [-824.795] * (-826.362) (-830.494) [-824.967] (-831.593) -- 0:00:56
221000 -- (-828.616) [-825.400] (-824.815) (-825.309) * [-829.625] (-825.988) (-824.987) (-829.200) -- 0:00:56
221500 -- (-830.661) [-826.316] (-827.597) (-826.889) * (-829.938) (-824.100) [-825.665] (-828.668) -- 0:00:56
222000 -- [-825.573] (-826.053) (-829.761) (-825.739) * (-828.652) (-825.281) [-827.957] (-829.526) -- 0:00:59
222500 -- [-825.146] (-826.079) (-827.313) (-826.038) * [-826.615] (-831.910) (-825.229) (-825.908) -- 0:00:59
223000 -- [-824.579] (-825.803) (-831.287) (-828.054) * (-829.916) [-826.216] (-826.246) (-825.770) -- 0:00:59
223500 -- (-828.057) (-825.619) (-830.716) [-827.771] * (-829.655) (-826.592) [-825.831] (-829.511) -- 0:00:59
224000 -- [-825.803] (-825.336) (-827.920) (-827.599) * (-827.956) [-825.366] (-832.244) (-825.516) -- 0:00:58
224500 -- (-824.483) (-825.860) [-824.577] (-825.729) * (-828.476) (-825.348) (-824.835) [-827.108] -- 0:00:58
225000 -- [-825.461] (-825.119) (-827.599) (-824.422) * [-825.600] (-826.194) (-828.110) (-826.824) -- 0:00:58
Average standard deviation of split frequencies: 0.017498
225500 -- [-825.295] (-825.666) (-827.118) (-830.240) * (-826.473) [-825.716] (-827.039) (-827.185) -- 0:00:58
226000 -- [-826.356] (-828.040) (-827.296) (-832.539) * [-824.191] (-825.511) (-825.293) (-826.325) -- 0:00:58
226500 -- [-825.063] (-828.746) (-825.489) (-829.708) * [-824.869] (-824.814) (-825.330) (-827.755) -- 0:00:58
227000 -- [-825.226] (-826.135) (-828.725) (-828.023) * (-829.569) (-826.478) (-827.290) [-831.321] -- 0:00:57
227500 -- [-824.883] (-826.601) (-827.832) (-829.591) * (-828.611) (-825.976) (-827.796) [-825.103] -- 0:00:57
228000 -- (-824.296) [-827.103] (-825.093) (-833.823) * (-827.586) [-827.337] (-831.365) (-829.220) -- 0:00:57
228500 -- [-825.960] (-829.015) (-828.318) (-830.329) * (-826.821) [-827.373] (-824.687) (-824.877) -- 0:00:57
229000 -- [-823.986] (-832.083) (-829.461) (-824.855) * [-827.025] (-824.490) (-825.277) (-824.180) -- 0:00:57
229500 -- (-825.777) [-831.716] (-827.077) (-825.177) * [-825.642] (-825.928) (-826.570) (-826.143) -- 0:00:57
230000 -- (-828.783) (-824.504) (-828.482) [-824.282] * [-826.035] (-824.985) (-829.239) (-829.738) -- 0:00:56
Average standard deviation of split frequencies: 0.018166
230500 -- (-826.540) (-825.188) (-826.685) [-827.850] * (-826.473) (-826.908) [-824.586] (-825.650) -- 0:00:56
231000 -- (-824.939) [-825.463] (-826.581) (-830.357) * [-826.394] (-825.475) (-824.821) (-826.054) -- 0:00:56
231500 -- (-825.175) (-824.526) (-829.949) [-825.362] * (-825.789) [-826.579] (-824.736) (-826.034) -- 0:00:56
232000 -- (-827.305) (-826.787) (-826.903) [-828.051] * (-825.051) (-826.756) [-824.943] (-827.009) -- 0:00:56
232500 -- (-827.709) (-827.249) [-824.875] (-825.975) * (-824.928) (-826.138) (-829.030) [-828.140] -- 0:00:56
233000 -- [-827.609] (-828.491) (-824.711) (-825.212) * [-824.884] (-826.078) (-826.992) (-826.036) -- 0:00:55
233500 -- (-827.020) (-830.196) [-824.476] (-825.649) * (-825.953) (-826.588) [-826.034] (-824.507) -- 0:00:55
234000 -- (-824.337) (-829.151) [-824.812] (-827.591) * (-826.666) [-824.174] (-825.807) (-825.829) -- 0:00:55
234500 -- (-826.108) (-826.507) [-824.293] (-828.385) * (-826.898) (-827.751) [-824.946] (-827.004) -- 0:00:55
235000 -- [-827.035] (-824.958) (-823.947) (-827.631) * (-824.857) (-830.495) [-826.328] (-824.372) -- 0:00:55
Average standard deviation of split frequencies: 0.018532
235500 -- [-824.278] (-826.204) (-824.644) (-824.862) * [-825.488] (-826.992) (-827.921) (-824.042) -- 0:00:55
236000 -- [-824.958] (-824.800) (-826.512) (-828.357) * (-828.794) (-826.870) [-826.456] (-829.915) -- 0:00:58
236500 -- (-824.298) (-826.436) [-826.279] (-827.219) * (-827.415) (-826.320) [-825.346] (-825.552) -- 0:00:58
237000 -- (-824.299) (-825.979) [-828.526] (-828.481) * [-828.741] (-826.280) (-825.817) (-827.434) -- 0:00:57
237500 -- (-825.133) [-824.996] (-824.643) (-826.977) * (-828.006) (-826.269) [-825.709] (-825.135) -- 0:00:57
238000 -- (-827.126) [-825.397] (-825.925) (-828.422) * (-826.989) [-828.326] (-825.022) (-827.119) -- 0:00:57
238500 -- (-825.489) (-829.684) [-825.057] (-825.709) * (-825.541) (-825.016) [-825.967] (-826.703) -- 0:00:57
239000 -- (-827.015) (-829.106) [-825.824] (-824.091) * (-826.320) [-824.909] (-825.028) (-825.240) -- 0:00:57
239500 -- (-826.709) [-826.787] (-827.428) (-825.816) * (-825.015) [-826.429] (-826.117) (-825.053) -- 0:00:57
240000 -- (-826.368) (-827.051) (-827.771) [-825.535] * (-824.960) (-832.543) (-827.841) [-825.061] -- 0:00:56
Average standard deviation of split frequencies: 0.017629
240500 -- (-827.676) [-827.621] (-828.701) (-825.754) * [-825.485] (-826.801) (-824.668) (-825.877) -- 0:00:56
241000 -- (-825.338) (-827.295) [-828.484] (-825.766) * [-825.309] (-826.983) (-824.132) (-824.975) -- 0:00:56
241500 -- (-825.163) [-824.213] (-824.318) (-825.383) * (-833.959) (-826.665) (-825.945) [-826.791] -- 0:00:56
242000 -- (-825.435) (-826.927) [-824.437] (-825.970) * (-825.276) [-826.065] (-829.296) (-827.341) -- 0:00:56
242500 -- (-824.938) [-824.464] (-825.472) (-830.089) * (-826.184) [-826.461] (-827.683) (-825.895) -- 0:00:56
243000 -- (-825.070) [-826.063] (-824.145) (-827.007) * (-824.901) (-828.641) (-828.510) [-826.156] -- 0:00:56
243500 -- (-824.821) [-824.098] (-824.791) (-827.808) * (-825.185) [-825.892] (-826.081) (-829.446) -- 0:00:55
244000 -- [-824.221] (-825.219) (-825.434) (-826.384) * (-825.776) (-825.982) (-824.973) [-825.898] -- 0:00:55
244500 -- (-828.587) (-825.234) (-825.433) [-826.632] * (-824.039) (-824.835) [-825.422] (-826.147) -- 0:00:55
245000 -- (-828.107) (-828.337) [-824.898] (-827.281) * [-826.443] (-824.989) (-824.506) (-835.356) -- 0:00:55
Average standard deviation of split frequencies: 0.018737
245500 -- (-826.222) (-826.712) (-826.724) [-828.615] * (-825.148) (-826.100) [-824.535] (-825.116) -- 0:00:55
246000 -- (-825.360) (-825.415) [-823.838] (-824.373) * (-826.210) (-826.940) [-826.947] (-825.102) -- 0:00:55
246500 -- (-824.176) (-825.160) [-827.088] (-824.925) * (-826.981) [-825.453] (-831.484) (-830.016) -- 0:00:55
247000 -- [-825.031] (-826.084) (-824.945) (-827.081) * (-828.374) (-824.328) [-828.324] (-824.367) -- 0:00:54
247500 -- (-824.769) (-827.784) [-829.603] (-824.819) * [-824.875] (-824.568) (-825.460) (-825.715) -- 0:00:54
248000 -- (-827.080) [-826.468] (-826.925) (-825.326) * (-827.306) (-827.697) (-824.833) [-827.400] -- 0:00:54
248500 -- [-827.738] (-825.469) (-825.685) (-825.117) * (-826.162) (-825.076) [-826.685] (-826.302) -- 0:00:54
249000 -- [-824.642] (-825.741) (-828.575) (-832.288) * (-824.044) (-825.103) [-824.318] (-828.132) -- 0:00:54
249500 -- [-826.806] (-826.347) (-827.126) (-829.209) * (-824.679) (-826.209) [-825.728] (-826.137) -- 0:00:54
250000 -- [-827.078] (-826.856) (-824.164) (-824.939) * (-824.464) [-825.371] (-825.435) (-824.357) -- 0:00:54
Average standard deviation of split frequencies: 0.018075
250500 -- (-828.464) (-824.545) [-824.045] (-825.761) * (-825.160) (-826.830) (-825.135) [-827.582] -- 0:00:56
251000 -- (-826.710) [-825.105] (-824.638) (-828.637) * (-825.097) (-826.431) [-825.249] (-824.819) -- 0:00:56
251500 -- (-827.725) [-824.489] (-825.453) (-830.973) * (-826.042) (-828.955) [-826.476] (-825.965) -- 0:00:56
252000 -- (-828.824) [-824.344] (-825.000) (-827.386) * (-825.537) (-826.805) [-825.520] (-830.100) -- 0:00:56
252500 -- (-830.461) (-826.866) [-825.820] (-825.653) * [-826.464] (-830.001) (-825.179) (-826.302) -- 0:00:56
253000 -- (-830.326) (-828.028) [-823.789] (-827.858) * (-826.028) (-827.624) [-824.412] (-826.026) -- 0:00:56
253500 -- [-827.518] (-825.715) (-824.263) (-825.884) * (-825.105) (-827.762) [-825.128] (-825.890) -- 0:00:55
254000 -- (-825.991) (-826.543) (-829.476) [-824.588] * (-825.669) (-829.313) (-825.879) [-824.930] -- 0:00:55
254500 -- (-826.462) (-825.503) (-826.122) [-829.504] * (-828.407) [-827.090] (-825.485) (-825.841) -- 0:00:55
255000 -- (-825.134) (-824.522) [-829.730] (-825.515) * [-828.266] (-825.731) (-828.692) (-830.911) -- 0:00:55
Average standard deviation of split frequencies: 0.018517
255500 -- (-824.825) (-827.019) [-826.354] (-826.406) * (-826.716) (-828.584) (-827.670) [-827.538] -- 0:00:55
256000 -- (-826.674) (-824.713) (-827.409) [-824.961] * (-825.586) (-824.353) (-823.899) [-827.431] -- 0:00:55
256500 -- (-826.058) [-825.047] (-827.336) (-829.293) * (-826.164) (-829.960) [-827.192] (-828.847) -- 0:00:55
257000 -- (-824.706) (-823.995) (-828.592) [-829.274] * [-824.829] (-825.905) (-824.344) (-824.392) -- 0:00:54
257500 -- (-827.555) [-825.608] (-825.397) (-826.098) * (-826.384) (-826.559) (-824.627) [-824.197] -- 0:00:54
258000 -- [-827.482] (-825.082) (-826.970) (-826.913) * (-826.492) [-824.394] (-825.021) (-825.960) -- 0:00:54
258500 -- (-825.897) (-826.589) [-826.041] (-828.235) * (-826.499) (-827.688) (-824.553) [-825.515] -- 0:00:54
259000 -- (-826.179) (-827.387) [-827.415] (-827.164) * (-826.370) [-824.693] (-825.844) (-825.490) -- 0:00:54
259500 -- [-825.228] (-825.868) (-826.660) (-826.389) * (-826.467) (-829.416) [-824.691] (-824.454) -- 0:00:54
260000 -- (-827.792) (-825.863) (-825.013) [-825.172] * (-825.236) [-827.918] (-824.708) (-827.620) -- 0:00:54
Average standard deviation of split frequencies: 0.017984
260500 -- [-828.040] (-824.982) (-830.230) (-826.545) * (-829.056) [-824.038] (-825.043) (-828.523) -- 0:00:53
261000 -- (-825.390) [-827.104] (-831.111) (-827.357) * [-832.123] (-828.779) (-826.932) (-825.860) -- 0:00:53
261500 -- [-824.415] (-825.364) (-829.126) (-827.625) * (-827.175) [-826.411] (-828.601) (-825.605) -- 0:00:53
262000 -- (-827.626) (-828.379) [-824.358] (-824.614) * (-824.231) (-825.304) (-834.839) [-825.976] -- 0:00:53
262500 -- (-825.351) [-826.912] (-825.015) (-827.170) * [-828.269] (-826.171) (-828.984) (-823.759) -- 0:00:53
263000 -- (-824.850) (-826.298) (-825.905) [-828.153] * (-824.796) [-826.547] (-825.643) (-826.197) -- 0:00:53
263500 -- (-827.671) (-825.370) (-828.916) [-826.396] * (-824.261) (-825.797) (-825.460) [-825.407] -- 0:00:53
264000 -- (-827.361) (-825.789) (-828.730) [-826.535] * (-824.162) (-829.027) (-826.582) [-825.688] -- 0:00:52
264500 -- (-825.503) [-827.044] (-824.955) (-827.505) * (-827.078) [-830.684] (-827.349) (-826.718) -- 0:00:55
265000 -- (-827.383) (-826.016) [-826.287] (-825.471) * [-827.530] (-825.617) (-826.323) (-828.613) -- 0:00:55
Average standard deviation of split frequencies: 0.017131
265500 -- (-824.680) (-825.306) (-823.856) [-825.258] * (-825.100) (-826.519) [-825.490] (-827.387) -- 0:00:55
266000 -- (-826.205) (-832.511) (-829.213) [-828.198] * (-825.153) (-824.148) [-825.192] (-825.125) -- 0:00:55
266500 -- [-826.021] (-825.281) (-832.372) (-827.416) * [-824.389] (-826.728) (-831.633) (-829.996) -- 0:00:55
267000 -- [-826.229] (-825.623) (-828.448) (-832.763) * (-827.747) (-829.932) [-824.771] (-829.551) -- 0:00:54
267500 -- (-828.316) (-824.077) (-825.741) [-825.307] * (-824.516) [-828.839] (-824.547) (-829.121) -- 0:00:54
268000 -- [-829.680] (-827.007) (-825.663) (-828.386) * (-824.530) (-828.841) (-827.857) [-829.806] -- 0:00:54
268500 -- [-829.020] (-830.185) (-824.674) (-825.965) * (-826.274) (-825.879) (-824.647) [-827.347] -- 0:00:54
269000 -- [-829.575] (-830.240) (-825.877) (-825.351) * (-823.984) (-826.722) [-825.795] (-825.816) -- 0:00:54
269500 -- (-827.494) (-827.992) [-825.082] (-826.149) * [-827.705] (-829.356) (-832.215) (-829.402) -- 0:00:54
270000 -- (-825.403) (-826.358) [-825.090] (-827.134) * (-826.146) (-825.798) (-827.324) [-825.443] -- 0:00:54
Average standard deviation of split frequencies: 0.016836
270500 -- (-828.524) (-829.849) [-826.063] (-829.952) * [-824.807] (-824.471) (-824.609) (-826.107) -- 0:00:53
271000 -- [-827.066] (-828.266) (-825.724) (-826.431) * (-824.104) (-825.920) (-825.706) [-826.467] -- 0:00:53
271500 -- (-829.858) (-826.532) (-823.782) [-825.456] * [-824.511] (-833.200) (-824.970) (-827.726) -- 0:00:53
272000 -- (-825.067) (-830.749) (-824.151) [-826.062] * (-824.164) [-827.335] (-824.061) (-827.694) -- 0:00:53
272500 -- (-825.650) (-828.028) [-824.524] (-825.976) * (-825.679) (-828.885) (-829.811) [-825.616] -- 0:00:53
273000 -- [-827.005] (-830.603) (-825.150) (-826.616) * [-825.357] (-825.642) (-827.129) (-825.584) -- 0:00:53
273500 -- (-828.661) [-825.145] (-825.812) (-824.742) * [-826.103] (-826.856) (-827.603) (-828.996) -- 0:00:53
274000 -- (-825.870) [-825.878] (-824.516) (-826.672) * (-826.406) (-825.849) (-826.746) [-827.042] -- 0:00:52
274500 -- (-824.372) (-825.652) [-824.577] (-825.677) * (-825.333) [-824.017] (-826.574) (-825.617) -- 0:00:52
275000 -- [-826.157] (-824.901) (-826.823) (-830.146) * (-825.466) (-825.162) [-825.299] (-828.678) -- 0:00:52
Average standard deviation of split frequencies: 0.017365
275500 -- (-828.714) [-826.650] (-825.836) (-829.002) * (-825.275) (-827.564) [-826.218] (-826.483) -- 0:00:52
276000 -- (-824.846) (-825.094) (-826.630) [-826.885] * [-826.414] (-826.395) (-827.986) (-828.333) -- 0:00:52
276500 -- [-824.236] (-829.201) (-826.737) (-826.820) * (-824.423) (-827.810) [-827.007] (-829.315) -- 0:00:52
277000 -- (-825.314) (-828.796) (-824.750) [-825.831] * (-826.008) (-826.162) [-826.200] (-826.530) -- 0:00:52
277500 -- [-824.975] (-827.832) (-832.241) (-826.716) * [-829.472] (-825.738) (-826.746) (-825.317) -- 0:00:52
278000 -- (-826.596) (-825.796) [-828.962] (-824.798) * (-826.297) (-827.514) (-825.415) [-824.461] -- 0:00:51
278500 -- (-833.858) [-826.573] (-827.747) (-825.444) * (-825.213) (-827.809) [-829.601] (-824.383) -- 0:00:54
279000 -- (-828.385) [-825.789] (-827.548) (-827.795) * (-824.373) [-827.328] (-826.358) (-824.663) -- 0:00:54
279500 -- (-830.346) [-826.014] (-829.159) (-829.416) * (-825.384) (-824.349) (-826.429) [-825.578] -- 0:00:54
280000 -- (-827.221) (-825.277) [-823.949] (-830.682) * (-828.114) (-825.155) [-825.518] (-826.288) -- 0:00:53
Average standard deviation of split frequencies: 0.018080
280500 -- (-828.199) [-828.602] (-824.452) (-830.317) * (-826.577) (-825.378) [-825.732] (-824.279) -- 0:00:53
281000 -- (-829.688) (-827.475) (-827.278) [-827.903] * (-827.633) (-824.202) (-825.215) [-825.275] -- 0:00:53
281500 -- (-825.076) [-825.264] (-826.776) (-830.844) * (-824.686) [-833.117] (-826.342) (-825.323) -- 0:00:53
282000 -- [-826.910] (-826.648) (-826.164) (-828.734) * (-824.530) [-827.955] (-824.532) (-828.193) -- 0:00:53
282500 -- (-832.649) [-825.124] (-828.351) (-828.041) * (-827.659) (-828.290) (-825.312) [-824.319] -- 0:00:53
283000 -- (-826.198) (-829.209) (-825.472) [-828.260] * (-827.876) [-825.437] (-828.455) (-825.945) -- 0:00:53
283500 -- (-829.861) (-827.504) [-824.704] (-829.035) * (-827.773) [-826.472] (-830.081) (-828.650) -- 0:00:53
284000 -- (-827.340) (-825.109) (-827.217) [-824.382] * (-827.503) (-824.291) (-825.832) [-825.416] -- 0:00:52
284500 -- (-825.511) (-824.438) [-829.778] (-826.093) * (-826.494) (-824.916) (-825.687) [-826.017] -- 0:00:52
285000 -- [-827.677] (-828.476) (-827.277) (-831.044) * [-827.267] (-830.420) (-825.787) (-825.230) -- 0:00:52
Average standard deviation of split frequencies: 0.017398
285500 -- [-826.448] (-824.821) (-823.872) (-826.534) * [-828.141] (-826.989) (-825.279) (-824.617) -- 0:00:52
286000 -- (-829.767) (-826.475) (-834.016) [-830.458] * [-826.883] (-825.086) (-824.894) (-824.613) -- 0:00:52
286500 -- (-828.458) (-828.802) (-825.374) [-828.866] * (-829.040) (-826.203) (-826.434) [-826.365] -- 0:00:52
287000 -- (-825.729) (-827.908) (-824.663) [-825.997] * (-828.617) [-825.020] (-825.939) (-826.087) -- 0:00:52
287500 -- [-826.354] (-826.531) (-825.442) (-827.567) * (-825.837) (-825.975) [-826.273] (-825.030) -- 0:00:52
288000 -- [-829.058] (-827.005) (-825.486) (-829.187) * (-824.581) (-825.444) [-825.746] (-824.681) -- 0:00:51
288500 -- (-829.304) (-827.092) [-829.651] (-826.229) * (-825.307) (-824.877) [-825.655] (-824.783) -- 0:00:51
289000 -- [-825.518] (-824.957) (-825.645) (-825.681) * (-826.378) (-827.558) (-825.487) [-829.431] -- 0:00:51
289500 -- [-826.103] (-832.094) (-825.156) (-826.201) * (-826.122) [-829.705] (-829.947) (-826.070) -- 0:00:51
290000 -- (-825.421) (-826.451) [-826.987] (-825.123) * (-827.746) (-825.794) (-829.402) [-824.505] -- 0:00:51
Average standard deviation of split frequencies: 0.016308
290500 -- (-830.803) (-825.508) [-826.400] (-826.228) * (-825.289) (-826.911) (-829.905) [-824.012] -- 0:00:51
291000 -- (-826.402) (-825.305) [-826.267] (-828.485) * (-825.361) (-825.297) (-829.277) [-825.542] -- 0:00:51
291500 -- [-827.974] (-826.329) (-829.843) (-827.472) * [-826.166] (-826.940) (-827.270) (-825.643) -- 0:00:51
292000 -- (-828.698) [-825.355] (-831.858) (-827.133) * [-825.235] (-828.396) (-826.884) (-825.435) -- 0:00:50
292500 -- (-826.055) (-827.490) [-829.675] (-824.057) * (-826.767) [-826.518] (-825.540) (-831.273) -- 0:00:50
293000 -- [-826.461] (-826.962) (-826.628) (-825.006) * (-825.310) (-825.495) [-825.330] (-828.020) -- 0:00:53
293500 -- (-824.777) (-829.684) [-828.103] (-825.427) * (-824.448) (-824.843) (-823.982) [-826.545] -- 0:00:52
294000 -- (-824.431) [-825.656] (-826.085) (-824.796) * (-824.895) (-825.407) (-830.442) [-826.872] -- 0:00:52
294500 -- [-825.021] (-826.254) (-826.190) (-827.790) * [-827.162] (-829.098) (-826.293) (-825.448) -- 0:00:52
295000 -- (-829.344) [-825.489] (-829.504) (-826.970) * (-827.956) (-828.275) (-824.546) [-824.923] -- 0:00:52
Average standard deviation of split frequencies: 0.016457
295500 -- [-827.372] (-836.983) (-828.067) (-827.794) * (-825.545) (-827.767) (-824.227) [-826.382] -- 0:00:52
296000 -- [-825.353] (-826.529) (-824.695) (-825.773) * [-824.683] (-825.184) (-823.871) (-824.729) -- 0:00:52
296500 -- (-825.768) (-825.768) (-824.348) [-826.257] * (-826.124) (-826.227) [-827.094] (-825.966) -- 0:00:52
297000 -- (-826.082) (-825.400) [-827.436] (-828.527) * [-824.765] (-829.125) (-830.882) (-826.755) -- 0:00:52
297500 -- (-824.726) [-824.523] (-824.890) (-826.435) * (-825.482) (-826.745) [-824.762] (-826.175) -- 0:00:51
298000 -- (-826.889) (-826.012) (-824.241) [-825.091] * (-827.621) (-825.883) [-824.723] (-832.185) -- 0:00:51
298500 -- (-829.065) [-824.024] (-825.005) (-825.742) * (-826.120) (-824.223) (-825.807) [-828.490] -- 0:00:51
299000 -- (-828.238) [-825.851] (-828.314) (-826.079) * (-826.637) (-828.315) (-824.351) [-824.411] -- 0:00:51
299500 -- [-824.570] (-827.588) (-828.276) (-825.519) * (-827.046) (-827.378) [-830.671] (-828.528) -- 0:00:51
300000 -- (-827.483) [-824.359] (-825.196) (-825.719) * [-825.460] (-826.022) (-825.570) (-827.082) -- 0:00:51
Average standard deviation of split frequencies: 0.016637
300500 -- (-828.428) (-825.361) [-824.712] (-826.815) * (-825.241) (-828.755) (-825.470) [-824.922] -- 0:00:51
301000 -- (-826.068) (-824.568) [-825.183] (-830.694) * [-825.305] (-825.869) (-824.943) (-827.023) -- 0:00:51
301500 -- [-828.115] (-827.118) (-828.001) (-824.600) * (-824.096) (-826.440) (-826.066) [-825.990] -- 0:00:50
302000 -- (-828.781) (-825.487) (-829.307) [-826.526] * (-826.312) [-825.190] (-829.274) (-827.664) -- 0:00:50
302500 -- (-825.766) [-826.191] (-825.853) (-824.328) * (-826.296) (-824.768) (-828.129) [-824.506] -- 0:00:50
303000 -- (-826.641) [-827.969] (-827.605) (-825.810) * [-825.990] (-824.270) (-826.634) (-826.398) -- 0:00:50
303500 -- [-827.873] (-825.959) (-827.376) (-825.192) * (-829.381) (-824.772) [-828.602] (-827.596) -- 0:00:50
304000 -- (-825.040) [-824.859] (-826.694) (-825.340) * (-828.398) [-827.654] (-830.567) (-825.008) -- 0:00:50
304500 -- (-824.116) (-826.429) [-826.712] (-827.866) * (-825.880) (-825.210) [-824.255] (-825.666) -- 0:00:50
305000 -- (-828.405) [-827.693] (-825.870) (-825.270) * [-826.177] (-824.776) (-825.135) (-825.445) -- 0:00:50
Average standard deviation of split frequencies: 0.016261
305500 -- (-826.318) (-824.985) (-827.506) [-826.555] * [-825.596] (-825.418) (-825.780) (-832.465) -- 0:00:50
306000 -- (-827.226) [-826.015] (-825.721) (-825.449) * [-825.008] (-828.242) (-825.865) (-826.738) -- 0:00:49
306500 -- (-826.548) (-825.776) [-826.386] (-827.281) * [-825.481] (-831.329) (-825.101) (-828.604) -- 0:00:49
307000 -- [-825.042] (-825.665) (-828.275) (-827.121) * (-828.442) (-824.770) [-829.268] (-826.106) -- 0:00:51
307500 -- (-825.232) (-824.547) [-827.451] (-827.828) * (-826.317) (-824.849) [-824.844] (-828.269) -- 0:00:51
308000 -- (-825.873) (-827.822) [-826.522] (-827.652) * (-828.514) (-828.487) [-825.309] (-828.834) -- 0:00:51
308500 -- (-825.873) (-829.005) (-828.622) [-826.857] * (-827.471) (-825.168) (-827.605) [-824.616] -- 0:00:51
309000 -- (-828.113) [-830.536] (-833.887) (-824.681) * [-825.198] (-825.754) (-824.529) (-824.723) -- 0:00:51
309500 -- [-825.725] (-825.006) (-828.670) (-826.115) * [-825.085] (-834.391) (-824.932) (-825.952) -- 0:00:51
310000 -- (-828.350) (-825.143) [-828.236] (-826.265) * (-827.491) (-824.129) (-824.661) [-824.124] -- 0:00:51
Average standard deviation of split frequencies: 0.014752
310500 -- [-827.882] (-833.972) (-828.294) (-826.329) * (-826.144) [-824.708] (-828.147) (-824.728) -- 0:00:51
311000 -- (-826.332) (-831.780) (-833.968) [-825.771] * (-827.357) (-826.830) (-829.529) [-824.228] -- 0:00:50
311500 -- [-824.749] (-824.766) (-825.466) (-826.009) * (-827.627) (-827.085) [-827.550] (-825.515) -- 0:00:50
312000 -- [-824.705] (-824.125) (-824.821) (-824.884) * (-827.602) [-829.089] (-826.846) (-825.831) -- 0:00:50
312500 -- (-827.817) (-829.886) [-826.014] (-825.796) * (-825.325) [-824.690] (-826.840) (-826.118) -- 0:00:50
313000 -- [-825.266] (-827.547) (-824.670) (-824.937) * (-825.511) (-824.334) [-826.602] (-825.830) -- 0:00:50
313500 -- [-825.557] (-826.891) (-827.739) (-826.933) * (-828.323) (-825.773) [-826.812] (-824.884) -- 0:00:50
314000 -- [-824.124] (-825.656) (-828.111) (-828.077) * (-829.593) [-827.851] (-826.777) (-824.762) -- 0:00:50
314500 -- (-827.152) (-826.893) (-827.175) [-824.259] * (-826.399) [-824.892] (-825.637) (-824.871) -- 0:00:50
315000 -- (-827.148) (-825.580) [-825.400] (-824.051) * (-826.626) [-825.174] (-824.527) (-825.735) -- 0:00:50
Average standard deviation of split frequencies: 0.014835
315500 -- (-825.467) (-826.141) (-825.763) [-825.769] * (-826.742) (-827.588) [-825.666] (-827.399) -- 0:00:49
316000 -- (-826.091) (-827.960) (-828.147) [-825.925] * (-829.382) (-826.781) [-824.395] (-828.654) -- 0:00:49
316500 -- (-825.566) (-829.475) [-827.520] (-827.071) * (-825.617) (-823.800) (-826.550) [-824.462] -- 0:00:49
317000 -- [-824.887] (-827.889) (-825.591) (-824.013) * [-825.272] (-826.594) (-826.469) (-824.444) -- 0:00:49
317500 -- [-824.857] (-825.423) (-825.999) (-825.422) * (-825.715) (-827.069) [-826.181] (-826.846) -- 0:00:49
318000 -- (-829.173) (-824.569) (-826.060) [-825.111] * (-825.445) (-825.154) [-825.601] (-826.908) -- 0:00:49
318500 -- (-829.717) (-827.140) [-825.412] (-827.695) * [-824.470] (-827.511) (-829.939) (-826.289) -- 0:00:49
319000 -- (-827.232) (-826.931) (-827.164) [-824.924] * (-830.078) (-826.441) [-828.276] (-825.855) -- 0:00:49
319500 -- (-824.685) (-826.327) (-828.928) [-826.615] * (-824.693) (-830.400) (-824.768) [-826.004] -- 0:00:48
320000 -- (-824.953) [-825.078] (-835.650) (-824.079) * [-826.562] (-826.026) (-824.372) (-829.829) -- 0:00:48
Average standard deviation of split frequencies: 0.014129
320500 -- (-827.221) [-825.725] (-825.582) (-826.102) * (-825.335) [-826.405] (-825.151) (-825.632) -- 0:00:48
321000 -- (-828.366) [-826.155] (-825.205) (-824.397) * (-824.804) [-826.658] (-826.130) (-823.731) -- 0:00:50
321500 -- [-827.289] (-825.028) (-825.564) (-829.802) * (-827.000) [-828.214] (-825.223) (-826.298) -- 0:00:50
322000 -- (-829.290) (-825.922) [-825.730] (-825.319) * (-825.961) (-829.558) [-827.614] (-827.781) -- 0:00:50
322500 -- (-825.887) [-826.509] (-826.003) (-826.113) * (-824.729) [-826.342] (-830.348) (-829.994) -- 0:00:50
323000 -- (-824.516) (-829.999) [-827.223] (-827.598) * (-825.072) (-828.765) (-831.721) [-825.264] -- 0:00:50
323500 -- [-827.777] (-832.059) (-824.282) (-828.897) * (-825.981) [-830.368] (-827.936) (-825.394) -- 0:00:50
324000 -- (-830.173) (-828.358) [-824.883] (-829.864) * (-825.895) (-827.228) (-828.347) [-827.732] -- 0:00:50
324500 -- [-829.164] (-827.076) (-825.248) (-825.894) * (-825.766) [-829.225] (-827.167) (-827.267) -- 0:00:49
325000 -- [-827.120] (-825.695) (-826.563) (-825.032) * (-826.237) (-824.930) (-827.603) [-827.410] -- 0:00:49
Average standard deviation of split frequencies: 0.013577
325500 -- (-824.231) [-824.101] (-828.066) (-833.025) * (-826.429) (-826.529) [-825.324] (-826.277) -- 0:00:49
326000 -- (-832.176) [-827.781] (-828.211) (-829.304) * [-827.482] (-826.220) (-825.776) (-824.564) -- 0:00:49
326500 -- (-832.102) [-825.175] (-825.374) (-827.086) * (-825.882) (-830.511) (-831.589) [-825.776] -- 0:00:49
327000 -- (-826.884) (-825.667) [-824.868] (-827.967) * (-824.076) (-825.384) (-828.867) [-825.515] -- 0:00:49
327500 -- (-828.567) (-826.973) (-825.389) [-829.248] * [-824.670] (-824.767) (-829.751) (-824.093) -- 0:00:49
328000 -- [-827.235] (-831.004) (-825.087) (-825.878) * (-824.333) (-830.376) (-825.445) [-826.414] -- 0:00:49
328500 -- (-825.767) (-829.600) [-830.096] (-826.572) * (-824.252) (-830.670) [-826.462] (-829.752) -- 0:00:49
329000 -- (-825.450) (-825.525) (-827.201) [-826.710] * [-826.000] (-830.459) (-827.715) (-829.919) -- 0:00:48
329500 -- (-826.229) [-828.233] (-824.643) (-825.496) * (-825.951) (-828.540) (-828.593) [-826.026] -- 0:00:48
330000 -- (-825.548) (-827.384) (-824.503) [-827.647] * (-825.850) [-826.120] (-825.971) (-824.101) -- 0:00:48
Average standard deviation of split frequencies: 0.012910
330500 -- [-825.329] (-826.824) (-825.777) (-826.165) * [-825.683] (-824.331) (-826.140) (-826.685) -- 0:00:48
331000 -- [-825.325] (-825.617) (-825.039) (-828.179) * [-824.973] (-825.158) (-829.342) (-826.239) -- 0:00:48
331500 -- (-826.711) [-825.147] (-831.841) (-828.674) * (-825.237) [-824.916] (-827.403) (-825.113) -- 0:00:48
332000 -- (-828.085) [-826.652] (-826.129) (-825.442) * (-826.820) (-824.794) [-831.220] (-824.358) -- 0:00:48
332500 -- (-824.061) (-830.360) (-826.057) [-825.481] * (-826.571) [-825.435] (-824.265) (-826.885) -- 0:00:48
333000 -- (-826.016) (-825.947) (-827.318) [-828.918] * (-825.138) [-826.144] (-825.048) (-826.264) -- 0:00:48
333500 -- (-826.503) (-825.624) (-825.063) [-824.720] * (-827.965) (-827.374) (-827.759) [-824.015] -- 0:00:47
334000 -- (-825.792) (-826.489) (-828.847) [-825.879] * [-829.232] (-825.599) (-832.354) (-826.442) -- 0:00:47
334500 -- (-826.087) (-827.850) (-827.132) [-826.201] * (-825.319) [-824.443] (-826.478) (-826.832) -- 0:00:47
335000 -- (-824.603) (-826.395) (-826.776) [-826.777] * [-825.149] (-826.900) (-824.581) (-825.780) -- 0:00:47
Average standard deviation of split frequencies: 0.013017
335500 -- (-826.717) (-830.117) (-824.603) [-828.121] * (-824.659) (-826.014) (-825.370) [-827.272] -- 0:00:49
336000 -- [-825.893] (-825.473) (-825.802) (-826.349) * (-828.945) (-825.977) (-826.263) [-829.309] -- 0:00:49
336500 -- [-826.125] (-825.823) (-825.792) (-825.845) * (-825.343) (-826.164) [-825.131] (-825.453) -- 0:00:49
337000 -- (-825.723) (-825.461) [-825.711] (-825.545) * (-826.288) [-824.410] (-828.501) (-826.215) -- 0:00:49
337500 -- (-827.946) (-826.373) (-825.836) [-827.095] * (-828.356) (-825.532) [-826.662] (-827.143) -- 0:00:49
338000 -- [-825.362] (-827.147) (-824.856) (-827.339) * (-828.940) (-825.393) [-826.673] (-825.031) -- 0:00:48
338500 -- [-827.423] (-826.903) (-826.678) (-828.450) * (-826.513) (-827.072) (-825.858) [-824.175] -- 0:00:48
339000 -- [-825.648] (-829.798) (-831.522) (-824.915) * (-832.228) (-824.099) (-826.051) [-824.044] -- 0:00:48
339500 -- (-825.007) (-830.125) [-830.240] (-825.136) * (-827.247) (-825.595) (-826.632) [-824.302] -- 0:00:48
340000 -- (-825.089) [-829.500] (-827.592) (-824.796) * (-826.804) (-825.933) [-826.906] (-826.239) -- 0:00:48
Average standard deviation of split frequencies: 0.012210
340500 -- (-824.255) (-827.525) [-825.396] (-825.686) * (-825.269) (-825.810) [-825.584] (-825.627) -- 0:00:48
341000 -- [-825.139] (-828.797) (-828.960) (-825.686) * [-824.582] (-826.045) (-826.543) (-825.610) -- 0:00:48
341500 -- [-824.936] (-829.087) (-827.015) (-826.546) * (-824.670) (-826.523) [-825.686] (-825.679) -- 0:00:48
342000 -- (-824.823) [-824.690] (-828.935) (-826.013) * (-826.964) (-830.052) (-824.455) [-825.229] -- 0:00:48
342500 -- (-824.773) [-824.538] (-832.111) (-825.971) * (-826.162) (-827.046) (-824.708) [-826.382] -- 0:00:47
343000 -- (-826.239) (-824.550) [-826.610] (-827.098) * (-829.184) [-825.794] (-826.165) (-826.220) -- 0:00:47
343500 -- (-825.240) (-826.438) [-826.330] (-827.435) * [-826.567] (-825.161) (-827.114) (-826.375) -- 0:00:47
344000 -- (-831.032) (-824.417) [-825.191] (-824.951) * (-829.353) (-825.239) [-825.387] (-827.271) -- 0:00:47
344500 -- [-824.993] (-825.694) (-826.907) (-824.966) * (-825.593) (-826.876) [-825.068] (-830.061) -- 0:00:47
345000 -- (-825.877) (-827.787) (-825.289) [-826.705] * (-827.001) [-827.418] (-830.650) (-829.456) -- 0:00:47
Average standard deviation of split frequencies: 0.011959
345500 -- [-825.859] (-827.301) (-825.512) (-826.156) * [-827.587] (-827.003) (-825.552) (-826.071) -- 0:00:47
346000 -- (-824.866) (-827.377) [-827.476] (-826.092) * (-827.022) (-825.094) (-826.550) [-825.585] -- 0:00:47
346500 -- (-825.724) (-824.569) (-826.660) [-827.603] * (-824.830) [-825.940] (-827.647) (-826.030) -- 0:00:47
347000 -- (-824.427) (-826.290) [-827.584] (-826.882) * [-827.672] (-825.475) (-828.620) (-826.292) -- 0:00:47
347500 -- (-824.585) [-827.387] (-824.796) (-824.139) * (-825.361) (-824.618) (-825.176) [-827.448] -- 0:00:46
348000 -- (-826.305) (-828.114) (-826.455) [-824.857] * [-825.689] (-826.320) (-826.810) (-827.210) -- 0:00:46
348500 -- [-825.015] (-831.086) (-827.794) (-826.544) * (-825.590) (-825.429) [-829.058] (-825.998) -- 0:00:46
349000 -- (-825.061) [-828.556] (-828.129) (-824.872) * [-827.236] (-829.184) (-826.182) (-825.626) -- 0:00:46
349500 -- [-825.747] (-828.953) (-826.467) (-826.427) * (-825.320) (-827.891) (-825.281) [-825.418] -- 0:00:48
350000 -- [-824.700] (-825.350) (-827.141) (-827.351) * (-827.581) (-826.332) [-824.780] (-825.572) -- 0:00:48
Average standard deviation of split frequencies: 0.011150
350500 -- (-825.385) [-827.104] (-826.373) (-824.398) * (-826.354) (-827.465) (-826.080) [-823.842] -- 0:00:48
351000 -- (-825.334) (-826.867) (-825.395) [-825.801] * (-830.706) (-828.359) (-825.013) [-828.795] -- 0:00:48
351500 -- (-824.620) (-826.919) [-825.817] (-825.367) * (-833.110) (-826.649) [-829.287] (-824.544) -- 0:00:47
352000 -- (-825.525) (-831.491) [-825.633] (-826.800) * (-829.063) [-826.675] (-826.390) (-825.615) -- 0:00:47
352500 -- (-825.871) (-824.522) [-826.534] (-830.984) * (-827.731) (-824.384) (-826.434) [-827.066] -- 0:00:47
353000 -- (-825.756) (-824.082) [-830.035] (-827.904) * (-825.172) (-828.991) (-824.990) [-826.365] -- 0:00:47
353500 -- (-825.871) (-824.784) (-825.460) [-827.291] * (-825.921) [-827.293] (-825.886) (-825.315) -- 0:00:47
354000 -- (-826.396) (-824.789) [-828.679] (-824.820) * [-828.298] (-828.663) (-826.883) (-836.688) -- 0:00:47
354500 -- (-829.005) [-825.456] (-825.242) (-825.098) * (-829.886) (-827.689) [-825.650] (-831.492) -- 0:00:47
355000 -- (-828.149) (-829.840) [-826.109] (-823.848) * [-824.737] (-827.752) (-827.933) (-825.274) -- 0:00:47
Average standard deviation of split frequencies: 0.011061
355500 -- (-825.756) (-829.197) (-823.922) [-825.508] * (-827.492) (-828.951) (-828.039) [-825.144] -- 0:00:47
356000 -- [-824.297] (-825.753) (-827.117) (-825.155) * [-830.490] (-826.607) (-826.919) (-827.977) -- 0:00:47
356500 -- (-828.178) [-823.948] (-824.499) (-828.668) * (-827.204) (-824.206) [-825.544] (-829.827) -- 0:00:46
357000 -- (-827.937) (-828.101) (-825.620) [-826.152] * (-825.488) (-826.370) (-825.161) [-824.503] -- 0:00:46
357500 -- (-825.207) (-825.259) [-824.580] (-823.994) * [-825.471] (-827.744) (-826.304) (-828.228) -- 0:00:46
358000 -- (-831.306) (-825.252) [-823.954] (-826.705) * (-825.498) [-825.562] (-825.159) (-824.766) -- 0:00:46
358500 -- [-824.925] (-826.680) (-824.761) (-829.075) * (-824.809) [-826.955] (-825.916) (-824.526) -- 0:00:46
359000 -- (-825.368) [-825.555] (-825.633) (-827.447) * (-827.701) (-827.270) [-824.951] (-824.750) -- 0:00:46
359500 -- (-826.117) (-829.217) [-824.990] (-826.156) * (-825.767) [-825.602] (-825.198) (-827.768) -- 0:00:46
360000 -- (-826.041) [-825.146] (-826.731) (-825.311) * [-826.113] (-824.601) (-826.326) (-824.452) -- 0:00:46
Average standard deviation of split frequencies: 0.010687
360500 -- (-828.605) (-825.558) (-824.418) [-826.255] * [-826.153] (-825.413) (-827.136) (-829.169) -- 0:00:46
361000 -- (-825.935) [-827.124] (-826.177) (-831.822) * (-828.380) [-825.285] (-824.625) (-826.658) -- 0:00:46
361500 -- [-825.908] (-827.003) (-826.384) (-828.802) * (-825.852) [-824.185] (-828.925) (-828.144) -- 0:00:45
362000 -- (-830.836) (-829.331) [-826.563] (-827.255) * (-826.361) (-824.202) [-826.569] (-830.559) -- 0:00:45
362500 -- (-826.587) [-829.915] (-829.287) (-827.363) * (-827.541) [-824.676] (-824.437) (-826.834) -- 0:00:45
363000 -- [-828.436] (-830.751) (-832.989) (-826.253) * (-824.646) (-826.188) (-824.860) [-825.527] -- 0:00:45
363500 -- (-825.919) [-826.490] (-831.039) (-825.267) * (-825.929) (-827.259) [-825.269] (-824.516) -- 0:00:45
364000 -- (-823.912) [-825.730] (-824.286) (-826.478) * (-826.663) (-831.253) (-828.054) [-824.345] -- 0:00:47
364500 -- (-825.275) [-825.855] (-824.239) (-826.478) * [-824.603] (-829.389) (-829.648) (-824.643) -- 0:00:47
365000 -- (-828.727) (-826.396) [-825.044] (-824.815) * (-826.307) (-829.287) [-826.556] (-824.116) -- 0:00:46
Average standard deviation of split frequencies: 0.010228
365500 -- [-826.691] (-824.522) (-826.717) (-828.372) * [-828.568] (-827.457) (-824.840) (-826.573) -- 0:00:46
366000 -- (-827.219) (-824.351) (-828.725) [-828.009] * (-826.623) [-824.810] (-826.350) (-825.621) -- 0:00:46
366500 -- [-824.907] (-825.482) (-828.505) (-824.539) * [-827.207] (-827.610) (-831.871) (-825.983) -- 0:00:46
367000 -- (-824.468) (-824.135) (-827.315) [-825.614] * [-826.427] (-827.623) (-827.809) (-825.899) -- 0:00:46
367500 -- (-826.425) (-824.537) [-824.442] (-825.564) * (-824.798) (-827.999) [-826.598] (-824.787) -- 0:00:46
368000 -- (-825.123) (-825.774) (-825.608) [-826.319] * (-827.769) (-828.596) [-830.394] (-825.058) -- 0:00:46
368500 -- (-825.059) (-824.693) (-825.596) [-824.213] * (-824.846) (-826.663) (-826.204) [-829.221] -- 0:00:46
369000 -- (-825.540) [-825.225] (-825.002) (-824.984) * [-826.796] (-826.459) (-827.156) (-826.128) -- 0:00:46
369500 -- (-826.677) (-824.339) [-826.648] (-824.894) * (-826.428) [-826.777] (-826.294) (-826.361) -- 0:00:46
370000 -- (-826.760) (-825.904) (-825.923) [-825.413] * (-827.102) (-824.603) (-825.211) [-826.185] -- 0:00:45
Average standard deviation of split frequencies: 0.009276
370500 -- (-826.365) [-826.166] (-825.080) (-826.244) * [-824.673] (-826.438) (-829.698) (-826.218) -- 0:00:45
371000 -- (-824.285) [-825.792] (-826.506) (-824.245) * (-826.480) [-824.721] (-826.270) (-828.274) -- 0:00:45
371500 -- (-825.613) [-823.825] (-825.931) (-825.627) * [-828.587] (-823.950) (-829.295) (-825.774) -- 0:00:45
372000 -- (-824.218) (-825.901) [-825.152] (-829.252) * (-826.896) (-823.947) (-826.344) [-823.860] -- 0:00:45
372500 -- (-824.242) [-825.974] (-827.095) (-830.318) * (-827.128) (-825.113) (-834.329) [-831.388] -- 0:00:45
373000 -- (-824.800) (-827.131) [-825.946] (-826.839) * (-829.372) (-824.812) (-825.567) [-826.779] -- 0:00:45
373500 -- (-828.289) [-828.220] (-827.530) (-825.068) * (-825.887) (-825.034) [-827.795] (-826.170) -- 0:00:45
374000 -- [-827.251] (-824.372) (-824.853) (-826.283) * (-826.375) [-825.106] (-828.075) (-825.680) -- 0:00:45
374500 -- (-826.548) [-824.430] (-824.422) (-826.748) * (-825.217) (-825.850) [-824.965] (-829.294) -- 0:00:45
375000 -- (-825.211) [-825.097] (-825.724) (-833.323) * (-824.239) [-825.096] (-824.747) (-824.943) -- 0:00:45
Average standard deviation of split frequencies: 0.008924
375500 -- (-825.086) [-825.091] (-826.013) (-827.002) * (-825.115) [-827.577] (-831.064) (-826.993) -- 0:00:44
376000 -- (-826.414) (-825.646) [-826.293] (-828.211) * (-825.836) (-826.926) (-826.962) [-823.890] -- 0:00:44
376500 -- (-825.634) (-828.507) [-826.298] (-828.090) * (-825.179) (-825.405) (-827.889) [-824.387] -- 0:00:44
377000 -- (-827.188) (-828.721) [-823.922] (-825.934) * (-829.883) [-828.876] (-826.559) (-826.105) -- 0:00:44
377500 -- (-826.020) [-826.088] (-824.629) (-824.799) * (-826.194) (-829.204) [-827.362] (-824.766) -- 0:00:44
378000 -- [-826.962] (-826.258) (-826.130) (-826.354) * (-827.995) (-826.053) [-826.405] (-826.618) -- 0:00:46
378500 -- (-826.606) (-826.808) (-825.812) [-824.785] * [-826.758] (-826.654) (-825.178) (-828.616) -- 0:00:45
379000 -- (-826.388) [-824.752] (-824.036) (-824.983) * [-826.993] (-825.305) (-827.648) (-830.292) -- 0:00:45
379500 -- [-825.462] (-824.511) (-826.012) (-826.232) * (-826.296) (-824.723) (-825.320) [-825.070] -- 0:00:45
380000 -- [-827.432] (-829.511) (-827.359) (-828.325) * (-827.103) (-825.835) (-827.095) [-827.362] -- 0:00:45
Average standard deviation of split frequencies: 0.008450
380500 -- (-824.219) (-829.374) (-828.296) [-828.450] * (-826.571) (-826.307) (-826.393) [-827.703] -- 0:00:45
381000 -- (-824.734) (-826.179) (-829.448) [-827.392] * (-825.541) (-825.092) (-825.346) [-825.172] -- 0:00:45
381500 -- (-825.723) (-824.680) (-826.665) [-826.891] * (-827.198) (-824.584) [-826.505] (-825.134) -- 0:00:45
382000 -- [-824.753] (-825.442) (-825.849) (-827.824) * [-825.620] (-826.875) (-826.451) (-827.387) -- 0:00:45
382500 -- [-826.991] (-827.408) (-826.030) (-825.779) * (-824.954) (-827.216) [-827.752] (-825.797) -- 0:00:45
383000 -- [-825.515] (-827.103) (-825.723) (-832.738) * [-827.801] (-824.924) (-829.870) (-825.296) -- 0:00:45
383500 -- (-825.891) [-825.017] (-825.458) (-825.902) * (-826.421) (-826.423) (-824.876) [-825.369] -- 0:00:45
384000 -- (-826.698) (-826.630) [-829.906] (-829.435) * (-825.852) (-827.321) (-828.635) [-825.545] -- 0:00:44
384500 -- (-825.836) [-826.552] (-830.646) (-825.841) * (-825.497) (-824.922) (-827.481) [-825.147] -- 0:00:44
385000 -- (-825.978) [-827.630] (-830.327) (-825.017) * (-825.828) [-825.523] (-825.683) (-827.163) -- 0:00:44
Average standard deviation of split frequencies: 0.008405
385500 -- (-826.410) [-826.054] (-824.848) (-828.786) * (-825.645) [-827.123] (-826.825) (-826.646) -- 0:00:44
386000 -- (-826.406) (-826.934) (-824.480) [-831.623] * (-826.380) [-825.957] (-824.614) (-827.855) -- 0:00:44
386500 -- (-828.103) (-824.875) [-824.956] (-828.993) * [-825.994] (-826.148) (-829.255) (-827.777) -- 0:00:44
387000 -- (-827.418) [-826.130] (-824.555) (-828.241) * (-826.789) (-827.646) [-825.869] (-825.818) -- 0:00:44
387500 -- (-825.345) (-825.710) (-824.128) [-827.187] * (-827.265) [-824.690] (-825.038) (-826.202) -- 0:00:44
388000 -- (-827.692) (-825.165) [-824.523] (-826.757) * (-824.488) (-825.728) [-825.148] (-824.926) -- 0:00:44
388500 -- (-826.123) [-827.717] (-825.186) (-827.312) * (-825.741) (-828.076) (-825.813) [-824.166] -- 0:00:44
389000 -- [-826.091] (-826.026) (-824.775) (-826.279) * [-824.433] (-827.513) (-829.315) (-827.773) -- 0:00:43
389500 -- (-828.089) [-825.289] (-825.107) (-826.995) * (-830.444) (-825.972) (-824.094) [-828.411] -- 0:00:43
390000 -- [-826.921] (-824.421) (-826.628) (-826.847) * [-824.694] (-824.211) (-824.353) (-826.077) -- 0:00:43
Average standard deviation of split frequencies: 0.008092
390500 -- (-827.845) [-826.619] (-828.142) (-827.170) * (-824.987) (-824.678) (-826.201) [-829.819] -- 0:00:43
391000 -- [-827.836] (-824.731) (-824.859) (-832.043) * (-825.071) [-824.668] (-824.108) (-830.163) -- 0:00:43
391500 -- (-824.601) (-826.631) [-825.408] (-825.330) * (-829.122) [-826.129] (-827.634) (-830.868) -- 0:00:43
392000 -- [-825.832] (-825.544) (-825.531) (-826.982) * (-828.393) (-827.692) [-826.012] (-830.239) -- 0:00:43
392500 -- (-826.310) (-827.989) (-830.038) [-826.874] * (-828.053) [-825.814] (-829.162) (-825.719) -- 0:00:44
393000 -- (-824.857) (-826.518) [-825.790] (-825.999) * (-826.072) (-825.063) [-825.003] (-826.195) -- 0:00:44
393500 -- (-825.078) (-830.332) (-827.221) [-825.974] * [-827.079] (-826.145) (-824.930) (-825.272) -- 0:00:44
394000 -- [-824.377] (-827.563) (-827.659) (-829.298) * (-826.018) (-824.402) (-824.587) [-825.863] -- 0:00:44
394500 -- (-827.175) (-826.291) (-828.231) [-825.994] * (-825.526) [-825.900] (-829.415) (-824.799) -- 0:00:44
395000 -- (-824.567) (-826.539) (-828.798) [-826.434] * (-825.721) [-825.198] (-826.313) (-824.350) -- 0:00:44
Average standard deviation of split frequencies: 0.008963
395500 -- [-828.042] (-826.269) (-825.491) (-824.909) * (-833.965) (-827.293) (-828.794) [-826.059] -- 0:00:44
396000 -- (-825.968) (-825.092) [-827.535] (-824.686) * (-824.959) (-828.514) (-829.599) [-824.618] -- 0:00:44
396500 -- (-827.271) (-824.158) (-825.721) [-824.959] * [-824.959] (-826.638) (-827.508) (-826.230) -- 0:00:44
397000 -- (-824.717) [-824.236] (-828.148) (-824.462) * (-828.253) [-828.684] (-825.444) (-824.951) -- 0:00:44
397500 -- (-824.021) [-824.590] (-828.043) (-824.160) * [-827.004] (-827.803) (-824.668) (-826.530) -- 0:00:43
398000 -- (-826.141) [-825.248] (-824.429) (-826.415) * [-824.539] (-826.368) (-824.501) (-827.947) -- 0:00:43
398500 -- (-825.638) (-824.114) [-828.659] (-826.383) * (-828.472) (-827.784) (-825.154) [-828.798] -- 0:00:43
399000 -- (-823.957) (-824.591) (-832.537) [-824.068] * (-827.114) (-826.440) (-827.308) [-825.943] -- 0:00:43
399500 -- (-825.419) [-824.645] (-826.054) (-824.978) * [-824.662] (-827.270) (-827.041) (-828.248) -- 0:00:43
400000 -- (-826.051) (-825.719) [-825.599] (-826.961) * (-825.851) (-827.511) (-826.877) [-825.296] -- 0:00:43
Average standard deviation of split frequencies: 0.008374
400500 -- [-825.999] (-825.298) (-824.665) (-828.027) * (-825.634) (-827.850) [-825.628] (-827.625) -- 0:00:43
401000 -- [-826.359] (-825.434) (-824.972) (-827.085) * [-828.196] (-824.213) (-825.164) (-826.148) -- 0:00:43
401500 -- (-828.466) (-824.994) (-828.881) [-828.249] * (-824.117) (-823.958) [-824.905] (-826.869) -- 0:00:43
402000 -- (-825.654) (-824.373) [-826.314] (-826.458) * [-825.982] (-826.219) (-827.488) (-823.959) -- 0:00:43
402500 -- [-824.552] (-825.122) (-827.276) (-825.232) * (-826.206) [-825.779] (-825.491) (-825.721) -- 0:00:43
403000 -- (-824.304) [-827.234] (-826.720) (-828.792) * (-824.795) (-824.734) [-825.328] (-827.351) -- 0:00:42
403500 -- [-827.604] (-825.722) (-825.653) (-827.361) * (-824.384) (-828.743) [-824.455] (-825.221) -- 0:00:42
404000 -- [-827.529] (-825.713) (-824.768) (-826.167) * (-825.419) (-827.467) [-824.140] (-825.533) -- 0:00:42
404500 -- (-826.948) (-828.234) [-824.411] (-827.133) * [-826.382] (-824.484) (-827.879) (-825.407) -- 0:00:42
405000 -- (-824.524) (-826.948) [-824.404] (-826.222) * (-825.600) (-824.885) [-826.955] (-827.822) -- 0:00:42
Average standard deviation of split frequencies: 0.009357
405500 -- [-824.284] (-825.416) (-826.154) (-825.173) * (-824.772) (-824.525) (-824.611) [-825.233] -- 0:00:42
406000 -- (-826.862) (-826.506) [-827.122] (-826.316) * (-832.045) (-826.424) (-824.987) [-826.863] -- 0:00:42
406500 -- (-827.479) (-826.083) (-827.661) [-827.719] * (-825.531) (-827.947) [-827.795] (-825.364) -- 0:00:43
407000 -- (-825.240) [-826.019] (-828.704) (-827.579) * [-824.101] (-826.246) (-824.526) (-824.915) -- 0:00:43
407500 -- (-827.538) (-826.361) [-827.670] (-827.272) * (-825.049) (-824.774) [-823.950] (-827.048) -- 0:00:43
408000 -- (-825.467) [-829.696] (-828.195) (-826.069) * [-824.827] (-824.454) (-824.409) (-827.605) -- 0:00:43
408500 -- [-825.009] (-825.511) (-827.989) (-826.485) * [-825.061] (-825.884) (-827.650) (-825.266) -- 0:00:43
409000 -- (-824.959) [-831.251] (-828.619) (-826.126) * (-827.256) [-826.125] (-824.143) (-824.125) -- 0:00:43
409500 -- (-824.801) [-828.600] (-825.666) (-827.185) * [-824.818] (-824.366) (-825.803) (-828.092) -- 0:00:43
410000 -- (-829.725) [-827.853] (-825.202) (-826.091) * (-825.492) (-827.766) [-824.729] (-829.222) -- 0:00:43
Average standard deviation of split frequencies: 0.009791
410500 -- (-825.996) [-826.477] (-830.465) (-826.858) * (-827.038) (-826.710) [-827.182] (-826.840) -- 0:00:43
411000 -- (-824.601) (-829.409) [-826.289] (-826.296) * [-825.704] (-825.700) (-825.832) (-826.298) -- 0:00:42
411500 -- (-827.235) (-825.432) [-825.327] (-826.208) * (-825.705) (-830.481) (-826.185) [-825.278] -- 0:00:42
412000 -- [-825.405] (-824.064) (-824.755) (-824.988) * (-828.850) (-825.248) [-825.596] (-826.941) -- 0:00:42
412500 -- [-825.673] (-828.634) (-826.694) (-826.308) * [-827.077] (-823.881) (-829.281) (-825.304) -- 0:00:42
413000 -- [-827.935] (-825.816) (-828.553) (-826.733) * (-825.422) (-826.772) [-827.149] (-825.605) -- 0:00:42
413500 -- [-829.326] (-828.682) (-826.523) (-834.187) * (-826.276) (-826.522) (-827.585) [-825.314] -- 0:00:42
414000 -- [-825.217] (-825.355) (-825.907) (-828.982) * (-827.452) (-825.785) (-824.643) [-825.614] -- 0:00:42
414500 -- (-824.552) (-824.607) (-825.230) [-824.503] * (-824.969) [-825.492] (-824.924) (-826.812) -- 0:00:42
415000 -- (-824.350) [-826.769] (-826.586) (-826.139) * [-827.159] (-825.486) (-827.864) (-826.335) -- 0:00:42
Average standard deviation of split frequencies: 0.007999
415500 -- (-826.638) (-825.985) (-826.522) [-826.192] * (-828.132) [-825.114] (-830.016) (-827.921) -- 0:00:42
416000 -- (-827.469) (-826.452) (-827.227) [-825.467] * (-828.085) (-831.534) (-825.092) [-824.695] -- 0:00:42
416500 -- [-827.139] (-828.050) (-825.042) (-826.952) * [-826.230] (-825.867) (-826.790) (-824.489) -- 0:00:42
417000 -- (-828.014) (-828.742) (-825.914) [-826.632] * (-827.090) (-824.617) [-828.342] (-825.438) -- 0:00:41
417500 -- (-828.468) (-826.876) (-828.644) [-828.659] * (-828.193) (-827.807) [-828.533] (-828.027) -- 0:00:41
418000 -- [-825.990] (-826.127) (-827.650) (-826.340) * (-828.733) (-825.663) [-826.433] (-827.796) -- 0:00:41
418500 -- (-825.786) (-828.443) [-826.825] (-829.380) * (-827.601) [-824.200] (-829.017) (-829.256) -- 0:00:41
419000 -- [-831.668] (-828.053) (-828.009) (-825.616) * [-825.675] (-824.989) (-827.082) (-824.491) -- 0:00:41
419500 -- (-829.904) (-832.990) (-827.502) [-825.705] * (-824.472) (-826.906) [-825.073] (-824.826) -- 0:00:41
420000 -- (-827.348) [-824.447] (-825.191) (-827.109) * (-829.150) (-824.449) (-824.863) [-827.198] -- 0:00:41
Average standard deviation of split frequencies: 0.007383
420500 -- (-824.958) (-825.655) [-827.570] (-824.526) * [-825.549] (-824.372) (-825.821) (-824.725) -- 0:00:42
421000 -- [-825.361] (-826.688) (-826.798) (-826.238) * (-824.688) (-827.646) (-826.887) [-832.976] -- 0:00:42
421500 -- (-825.821) [-825.910] (-824.775) (-827.607) * (-830.152) [-825.292] (-825.928) (-832.600) -- 0:00:42
422000 -- (-826.750) (-824.240) [-824.017] (-825.735) * (-825.315) (-825.025) (-826.544) [-828.618] -- 0:00:42
422500 -- (-824.035) (-826.040) (-825.207) [-824.335] * (-828.275) [-826.010] (-825.732) (-825.136) -- 0:00:42
423000 -- (-823.777) (-826.710) (-828.051) [-828.610] * (-829.285) (-825.178) [-827.529] (-826.099) -- 0:00:42
423500 -- (-825.049) (-831.210) (-828.211) [-825.164] * [-829.573] (-824.502) (-826.127) (-828.335) -- 0:00:42
424000 -- (-825.707) (-831.274) [-826.719] (-825.226) * (-829.619) [-825.631] (-824.917) (-826.419) -- 0:00:42
424500 -- (-824.782) (-828.832) [-827.950] (-824.644) * (-827.185) (-824.064) (-825.242) [-825.579] -- 0:00:42
425000 -- (-826.856) (-829.332) [-824.466] (-824.571) * (-826.557) (-827.233) [-825.304] (-824.868) -- 0:00:41
Average standard deviation of split frequencies: 0.007681
425500 -- (-825.147) (-827.472) (-828.695) [-825.794] * [-824.071] (-826.114) (-824.807) (-829.556) -- 0:00:41
426000 -- [-825.372] (-826.635) (-826.922) (-826.160) * (-825.194) (-826.357) [-824.847] (-828.318) -- 0:00:41
426500 -- (-825.027) (-826.562) (-824.380) [-825.890] * (-824.085) [-826.567] (-824.757) (-825.200) -- 0:00:41
427000 -- (-828.089) (-832.087) [-825.622] (-828.262) * [-825.520] (-825.270) (-825.275) (-827.050) -- 0:00:41
427500 -- [-825.809] (-831.053) (-827.037) (-827.181) * (-825.336) [-826.860] (-826.562) (-827.786) -- 0:00:41
428000 -- (-825.400) (-826.449) (-832.953) [-826.801] * (-829.285) (-825.186) (-825.671) [-825.389] -- 0:00:41
428500 -- (-832.337) (-824.307) (-825.289) [-825.642] * [-827.414] (-824.774) (-825.319) (-827.447) -- 0:00:41
429000 -- (-826.188) (-825.716) (-824.204) [-831.963] * (-826.183) [-823.773] (-824.508) (-827.822) -- 0:00:41
429500 -- [-828.158] (-823.796) (-824.114) (-829.419) * (-825.135) (-825.510) [-827.749] (-829.251) -- 0:00:41
430000 -- (-825.904) (-824.600) (-825.509) [-828.350] * [-824.811] (-824.212) (-825.007) (-826.780) -- 0:00:41
Average standard deviation of split frequencies: 0.007405
430500 -- [-825.020] (-828.781) (-825.756) (-827.262) * [-824.629] (-824.008) (-824.637) (-824.488) -- 0:00:41
431000 -- (-829.038) (-825.737) [-826.144] (-826.822) * (-826.815) (-826.174) [-825.448] (-825.232) -- 0:00:40
431500 -- (-824.793) (-825.343) [-825.822] (-826.028) * (-825.776) (-826.043) [-824.321] (-826.741) -- 0:00:40
432000 -- (-825.592) (-828.405) [-827.887] (-827.774) * (-826.224) (-824.101) (-825.123) [-824.698] -- 0:00:40
432500 -- (-824.669) (-828.253) [-825.716] (-825.642) * (-826.924) (-824.713) (-825.116) [-825.854] -- 0:00:40
433000 -- [-823.968] (-826.239) (-826.586) (-825.248) * (-824.242) (-823.940) (-832.011) [-824.668] -- 0:00:40
433500 -- [-824.426] (-828.286) (-826.856) (-826.539) * (-829.448) [-823.837] (-832.729) (-826.644) -- 0:00:40
434000 -- [-829.858] (-827.367) (-824.797) (-824.549) * (-826.505) [-825.034] (-826.309) (-826.959) -- 0:00:40
434500 -- (-825.045) (-826.496) [-826.221] (-827.109) * (-824.458) (-824.979) (-826.325) [-829.570] -- 0:00:40
435000 -- (-826.791) [-825.881] (-828.402) (-826.845) * [-825.394] (-824.947) (-826.525) (-825.995) -- 0:00:41
Average standard deviation of split frequencies: 0.007696
435500 -- [-825.987] (-824.916) (-825.447) (-827.002) * (-826.203) (-828.557) [-824.755] (-828.523) -- 0:00:41
436000 -- (-824.618) (-827.235) (-827.591) [-826.281] * (-825.143) (-828.816) [-825.591] (-825.419) -- 0:00:41
436500 -- (-826.733) (-824.975) [-826.450] (-825.418) * (-825.001) (-828.396) [-824.332] (-827.924) -- 0:00:41
437000 -- (-826.721) (-825.013) (-825.263) [-826.681] * (-824.384) [-825.083] (-825.368) (-828.566) -- 0:00:41
437500 -- (-825.093) (-827.356) [-826.362] (-826.814) * (-829.560) (-825.603) [-825.656] (-828.088) -- 0:00:41
438000 -- [-825.661] (-831.236) (-829.413) (-827.482) * (-831.884) (-827.895) [-828.987] (-824.289) -- 0:00:41
438500 -- (-825.738) [-825.197] (-826.630) (-825.642) * [-825.825] (-825.236) (-826.275) (-824.010) -- 0:00:40
439000 -- (-824.573) (-825.379) [-825.543] (-825.294) * (-825.574) [-825.236] (-824.308) (-828.886) -- 0:00:40
439500 -- [-823.872] (-824.953) (-825.631) (-825.795) * (-825.152) [-825.465] (-828.049) (-827.037) -- 0:00:40
440000 -- (-826.022) [-828.820] (-825.011) (-824.984) * (-828.615) (-825.648) [-825.494] (-831.002) -- 0:00:40
Average standard deviation of split frequencies: 0.007889
440500 -- (-826.500) (-828.754) (-824.128) [-829.776] * [-825.838] (-828.722) (-826.548) (-827.436) -- 0:00:40
441000 -- [-826.364] (-825.251) (-824.282) (-825.264) * (-824.497) [-826.882] (-827.594) (-825.442) -- 0:00:40
441500 -- [-825.676] (-827.549) (-826.468) (-828.976) * (-825.344) [-827.421] (-827.068) (-826.469) -- 0:00:40
442000 -- (-831.174) [-828.418] (-828.220) (-827.029) * [-828.424] (-833.139) (-828.171) (-827.112) -- 0:00:40
442500 -- (-824.677) (-828.508) (-829.799) [-825.414] * (-826.344) (-827.091) (-825.873) [-826.099] -- 0:00:40
443000 -- (-827.093) [-826.480] (-826.211) (-827.749) * (-824.853) (-827.387) [-828.289] (-824.285) -- 0:00:40
443500 -- (-826.025) (-824.558) (-826.319) [-824.789] * (-825.918) (-827.553) [-824.505] (-825.356) -- 0:00:40
444000 -- (-826.211) (-825.704) [-827.323] (-827.981) * [-825.025] (-824.565) (-824.389) (-826.925) -- 0:00:40
444500 -- [-825.746] (-827.041) (-824.454) (-826.163) * [-826.149] (-827.597) (-825.025) (-824.636) -- 0:00:39
445000 -- (-831.601) (-826.074) (-828.246) [-825.499] * (-826.875) (-823.749) (-827.543) [-826.815] -- 0:00:39
Average standard deviation of split frequencies: 0.008588
445500 -- (-828.700) [-825.475] (-826.174) (-826.225) * (-824.333) [-825.476] (-827.457) (-824.761) -- 0:00:39
446000 -- (-826.111) (-825.475) (-826.189) [-826.871] * (-826.976) [-824.200] (-825.861) (-829.043) -- 0:00:39
446500 -- (-826.985) [-829.232] (-826.372) (-824.462) * (-826.834) (-826.226) [-833.089] (-825.774) -- 0:00:39
447000 -- (-824.498) (-827.103) (-824.165) [-824.737] * (-825.840) [-825.639] (-824.459) (-825.652) -- 0:00:39
447500 -- (-826.810) (-828.783) (-824.948) [-825.639] * (-825.312) (-826.022) (-825.066) [-825.669] -- 0:00:39
448000 -- (-831.981) (-825.893) [-825.087] (-828.829) * (-825.952) (-826.581) [-824.218] (-828.442) -- 0:00:39
448500 -- (-829.007) (-826.907) [-824.299] (-831.232) * (-825.991) (-831.582) [-828.329] (-824.837) -- 0:00:39
449000 -- (-827.336) (-829.144) [-825.124] (-828.342) * (-826.589) (-827.081) (-825.160) [-824.677] -- 0:00:39
449500 -- (-828.841) (-824.355) (-824.298) [-824.925] * (-826.078) (-825.200) [-824.997] (-824.816) -- 0:00:40
450000 -- (-824.484) (-824.966) (-824.314) [-825.252] * [-827.147] (-827.298) (-825.243) (-825.186) -- 0:00:40
Average standard deviation of split frequencies: 0.008676
450500 -- (-824.705) (-827.408) (-826.575) [-826.132] * (-826.918) [-826.986] (-824.469) (-826.600) -- 0:00:40
451000 -- (-829.648) (-826.386) (-827.422) [-827.267] * (-825.166) (-824.131) [-826.701] (-825.797) -- 0:00:40
451500 -- (-829.258) [-826.600] (-826.760) (-825.552) * (-825.543) [-825.743] (-826.232) (-826.924) -- 0:00:40
452000 -- [-828.298] (-825.739) (-825.665) (-827.715) * (-827.571) (-826.401) [-824.130] (-826.156) -- 0:00:40
452500 -- (-828.358) (-826.451) [-824.320] (-827.490) * (-829.037) [-824.793] (-827.401) (-826.839) -- 0:00:39
453000 -- [-828.395] (-824.577) (-827.122) (-831.093) * (-824.541) [-824.327] (-828.721) (-826.533) -- 0:00:39
453500 -- (-826.723) [-827.047] (-827.839) (-825.169) * [-826.570] (-826.180) (-825.444) (-826.874) -- 0:00:39
454000 -- (-824.551) [-827.208] (-826.409) (-824.519) * (-826.796) (-824.604) (-826.041) [-824.515] -- 0:00:39
454500 -- (-825.448) (-830.718) [-825.033] (-826.236) * (-824.009) [-825.806] (-826.469) (-825.215) -- 0:00:39
455000 -- [-824.660] (-828.173) (-824.086) (-825.777) * (-824.362) (-827.561) [-826.584] (-825.425) -- 0:00:39
Average standard deviation of split frequencies: 0.008149
455500 -- (-824.222) (-825.395) (-827.709) [-827.555] * (-824.516) (-825.412) (-827.132) [-825.030] -- 0:00:39
456000 -- [-826.831] (-825.418) (-825.618) (-825.797) * (-824.041) (-826.581) (-826.268) [-825.532] -- 0:00:39
456500 -- [-824.506] (-824.125) (-826.081) (-825.226) * (-824.136) [-828.809] (-826.907) (-828.752) -- 0:00:39
457000 -- (-823.997) [-824.630] (-825.532) (-826.264) * [-824.071] (-828.345) (-831.356) (-827.618) -- 0:00:39
457500 -- (-828.868) (-827.005) [-827.048] (-830.117) * (-826.123) (-829.409) (-826.510) [-830.320] -- 0:00:39
458000 -- [-825.522] (-827.441) (-825.513) (-826.064) * (-825.069) (-831.706) (-825.645) [-827.331] -- 0:00:39
458500 -- (-824.541) (-824.936) [-827.915] (-829.223) * [-825.397] (-826.197) (-826.498) (-825.980) -- 0:00:38
459000 -- [-825.925] (-826.894) (-829.345) (-825.635) * (-827.179) (-825.054) [-825.828] (-824.624) -- 0:00:38
459500 -- [-823.977] (-824.708) (-826.495) (-826.943) * (-829.650) (-825.522) (-825.162) [-825.068] -- 0:00:38
460000 -- [-825.900] (-825.774) (-824.145) (-827.244) * (-829.191) (-826.810) [-824.667] (-825.457) -- 0:00:38
Average standard deviation of split frequencies: 0.006843
460500 -- [-827.282] (-824.322) (-824.324) (-826.393) * (-824.837) (-833.618) (-824.839) [-825.213] -- 0:00:38
461000 -- (-829.656) (-824.571) (-824.555) [-825.850] * (-825.760) (-826.693) (-824.355) [-825.244] -- 0:00:38
461500 -- [-824.657] (-825.527) (-827.468) (-824.558) * (-827.826) [-824.628] (-824.718) (-825.084) -- 0:00:38
462000 -- (-825.188) [-824.642] (-825.276) (-824.761) * (-825.208) (-825.768) [-825.039] (-826.041) -- 0:00:38
462500 -- (-827.806) [-825.364] (-827.628) (-824.392) * (-826.225) (-825.073) [-827.788] (-826.491) -- 0:00:38
463000 -- (-826.128) (-824.776) (-825.848) [-824.022] * (-825.955) (-826.450) (-830.834) [-825.568] -- 0:00:38
463500 -- (-827.619) (-824.731) (-826.897) [-827.454] * (-826.048) [-826.150] (-828.793) (-827.801) -- 0:00:39
464000 -- (-828.324) (-824.435) (-828.604) [-828.274] * (-827.185) (-826.404) (-830.883) [-825.859] -- 0:00:39
464500 -- (-824.476) [-824.993] (-827.481) (-828.190) * (-826.620) [-827.697] (-828.405) (-827.953) -- 0:00:39
465000 -- (-826.606) (-824.492) [-825.323] (-831.775) * (-825.721) [-825.246] (-828.094) (-825.935) -- 0:00:39
Average standard deviation of split frequencies: 0.007438
465500 -- [-826.696] (-824.251) (-829.024) (-828.725) * [-824.452] (-824.731) (-828.461) (-825.793) -- 0:00:39
466000 -- (-824.928) (-825.868) (-828.695) [-825.028] * (-825.580) (-824.981) [-827.538] (-826.851) -- 0:00:38
466500 -- [-827.551] (-825.765) (-825.728) (-827.305) * (-825.463) (-827.744) [-826.897] (-825.446) -- 0:00:38
467000 -- [-829.226] (-826.258) (-827.194) (-825.388) * (-825.138) (-828.134) [-824.791] (-825.825) -- 0:00:38
467500 -- (-826.035) (-827.740) [-825.548] (-825.329) * (-828.701) (-825.244) [-824.170] (-826.924) -- 0:00:38
468000 -- (-825.815) (-827.508) (-823.781) [-827.054] * (-826.439) [-824.579] (-828.797) (-827.551) -- 0:00:38
468500 -- (-826.032) (-829.157) [-826.014] (-825.855) * (-826.180) [-824.485] (-827.570) (-826.843) -- 0:00:38
469000 -- (-825.864) [-827.361] (-828.065) (-824.839) * (-827.018) (-827.806) (-827.895) [-825.607] -- 0:00:38
469500 -- [-824.707] (-826.038) (-831.373) (-825.286) * (-826.973) [-825.432] (-824.733) (-825.947) -- 0:00:38
470000 -- (-825.177) (-825.468) [-828.514] (-825.607) * [-825.912] (-828.420) (-824.352) (-826.727) -- 0:00:38
Average standard deviation of split frequencies: 0.007188
470500 -- (-824.747) (-825.716) (-827.136) [-825.245] * [-825.658] (-825.976) (-825.480) (-826.732) -- 0:00:38
471000 -- (-826.368) (-826.743) (-827.596) [-828.165] * (-825.515) (-829.816) [-826.910] (-825.146) -- 0:00:38
471500 -- (-826.409) [-825.025] (-825.614) (-825.306) * (-825.312) [-826.240] (-825.514) (-824.068) -- 0:00:38
472000 -- (-825.161) (-827.064) (-829.256) [-825.297] * (-826.625) (-825.813) [-828.498] (-825.883) -- 0:00:38
472500 -- (-827.880) [-825.664] (-826.927) (-828.366) * (-826.735) [-824.914] (-827.221) (-826.633) -- 0:00:37
473000 -- (-827.089) (-826.746) [-825.380] (-827.065) * (-827.591) (-827.175) (-825.836) [-827.585] -- 0:00:37
473500 -- (-827.378) (-825.939) (-826.099) [-827.839] * (-827.286) (-824.347) [-826.004] (-825.983) -- 0:00:37
474000 -- (-826.716) (-826.677) (-828.050) [-826.683] * (-826.896) (-829.010) (-824.106) [-826.524] -- 0:00:37
474500 -- [-827.918] (-825.826) (-827.845) (-824.249) * (-827.638) (-826.259) (-824.309) [-825.035] -- 0:00:37
475000 -- (-826.332) (-826.476) (-827.406) [-825.632] * [-824.793] (-826.032) (-826.182) (-826.244) -- 0:00:37
Average standard deviation of split frequencies: 0.007340
475500 -- [-826.302] (-826.594) (-828.096) (-825.314) * (-825.435) [-825.053] (-825.799) (-828.571) -- 0:00:37
476000 -- (-825.082) [-825.778] (-824.594) (-828.456) * [-825.234] (-824.936) (-825.653) (-827.015) -- 0:00:37
476500 -- (-825.752) [-826.545] (-824.275) (-825.649) * (-827.157) (-826.462) [-823.907] (-823.941) -- 0:00:37
477000 -- (-827.557) [-825.688] (-825.201) (-825.345) * (-827.946) (-828.362) (-826.777) [-824.908] -- 0:00:37
477500 -- (-826.056) (-826.096) (-826.686) [-824.862] * (-827.058) (-827.854) (-826.366) [-825.336] -- 0:00:37
478000 -- (-826.448) (-828.214) [-826.438] (-825.355) * (-825.585) (-830.734) [-826.391] (-827.533) -- 0:00:38
478500 -- (-832.982) (-824.930) [-829.523] (-826.893) * (-827.421) (-828.504) (-826.110) [-827.447] -- 0:00:38
479000 -- (-825.268) (-825.202) [-825.626] (-829.210) * (-824.867) [-825.210] (-825.845) (-828.367) -- 0:00:38
479500 -- (-824.749) (-826.152) [-825.844] (-827.965) * (-825.192) (-829.101) [-824.793] (-827.084) -- 0:00:37
480000 -- (-824.681) (-826.491) (-825.482) [-826.953] * [-824.669] (-833.013) (-824.310) (-829.060) -- 0:00:37
Average standard deviation of split frequencies: 0.006807
480500 -- (-824.854) (-828.208) (-826.217) [-824.759] * (-825.456) (-825.864) (-824.767) [-825.009] -- 0:00:37
481000 -- (-824.521) (-824.213) (-825.049) [-826.519] * [-827.912] (-826.192) (-824.691) (-828.466) -- 0:00:37
481500 -- (-825.795) (-826.357) (-825.210) [-824.659] * (-828.711) (-825.134) (-824.312) [-825.691] -- 0:00:37
482000 -- [-828.410] (-830.184) (-825.936) (-825.172) * (-825.790) [-825.880] (-824.778) (-828.368) -- 0:00:37
482500 -- (-826.653) (-826.885) (-827.749) [-824.788] * (-826.693) (-826.577) (-825.457) [-824.590] -- 0:00:37
483000 -- (-829.086) (-826.322) [-828.455] (-826.857) * [-827.241] (-825.690) (-825.372) (-828.108) -- 0:00:37
483500 -- (-826.697) (-828.408) (-826.520) [-827.067] * (-827.796) [-825.199] (-824.557) (-825.268) -- 0:00:37
484000 -- (-826.647) (-830.952) [-825.943] (-826.407) * (-828.540) (-827.178) [-824.406] (-825.177) -- 0:00:37
484500 -- (-824.582) (-827.107) (-827.515) [-825.632] * (-826.183) (-826.920) [-825.850] (-825.482) -- 0:00:37
485000 -- (-827.890) [-826.033] (-827.956) (-826.455) * (-825.537) [-824.105] (-825.747) (-825.508) -- 0:00:37
Average standard deviation of split frequencies: 0.007360
485500 -- [-824.629] (-824.006) (-829.815) (-826.823) * (-827.320) (-825.067) (-824.344) [-824.399] -- 0:00:37
486000 -- [-825.919] (-824.062) (-828.159) (-829.825) * [-828.905] (-829.832) (-826.156) (-826.744) -- 0:00:37
486500 -- (-825.148) [-827.397] (-825.330) (-827.189) * [-829.118] (-825.998) (-826.759) (-827.757) -- 0:00:36
487000 -- (-828.081) (-824.940) [-828.326] (-827.699) * (-831.756) [-826.927] (-827.472) (-826.351) -- 0:00:36
487500 -- (-826.855) (-827.257) [-829.873] (-827.650) * (-827.598) [-824.669] (-828.607) (-824.806) -- 0:00:36
488000 -- (-827.846) (-825.946) [-831.632] (-825.501) * (-826.019) (-824.735) [-830.378] (-825.725) -- 0:00:36
488500 -- (-826.077) (-826.531) (-829.641) [-825.578] * [-825.592] (-825.039) (-825.717) (-824.642) -- 0:00:36
489000 -- [-826.237] (-825.565) (-825.688) (-824.839) * (-824.577) (-831.881) [-827.004] (-826.299) -- 0:00:36
489500 -- [-826.759] (-828.251) (-825.654) (-828.924) * (-824.359) [-829.688] (-828.110) (-826.120) -- 0:00:36
490000 -- (-826.936) (-827.376) (-826.354) [-829.510] * (-826.913) (-828.482) (-825.216) [-824.420] -- 0:00:36
Average standard deviation of split frequencies: 0.007855
490500 -- (-829.559) (-825.171) (-829.261) [-826.899] * (-824.989) (-826.146) (-826.038) [-824.322] -- 0:00:36
491000 -- [-828.464] (-825.427) (-831.087) (-826.860) * [-824.913] (-824.865) (-827.054) (-829.458) -- 0:00:36
491500 -- (-828.212) [-826.592] (-824.406) (-825.374) * (-825.851) (-829.779) [-827.927] (-828.292) -- 0:00:36
492000 -- [-824.089] (-826.189) (-825.618) (-826.448) * (-828.098) (-826.816) [-825.502] (-829.916) -- 0:00:37
492500 -- (-824.581) (-826.853) (-828.052) [-825.888] * (-825.816) (-825.161) (-825.392) [-826.967] -- 0:00:37
493000 -- (-824.547) (-825.335) [-827.805] (-826.818) * (-826.018) (-825.362) [-824.548] (-825.400) -- 0:00:37
493500 -- (-826.157) (-830.182) [-828.039] (-825.269) * (-829.242) [-824.100] (-825.012) (-828.134) -- 0:00:36
494000 -- [-825.374] (-831.193) (-829.723) (-825.725) * (-828.888) (-824.313) (-827.433) [-825.537] -- 0:00:36
494500 -- [-826.644] (-825.432) (-830.886) (-827.321) * [-825.258] (-825.753) (-831.626) (-826.003) -- 0:00:36
495000 -- [-825.692] (-825.844) (-826.148) (-826.131) * (-824.299) (-826.005) (-828.392) [-824.712] -- 0:00:36
Average standard deviation of split frequencies: 0.007659
495500 -- (-826.681) (-824.863) [-825.904] (-829.627) * (-826.910) (-835.661) (-826.161) [-824.701] -- 0:00:36
496000 -- (-826.119) [-827.093] (-825.691) (-824.375) * (-824.762) (-827.301) (-823.836) [-826.169] -- 0:00:36
496500 -- (-826.932) (-826.355) (-828.744) [-825.730] * (-825.669) (-825.900) [-824.568] (-826.304) -- 0:00:36
497000 -- (-825.106) [-825.463] (-825.072) (-824.804) * (-826.263) [-827.270] (-824.159) (-826.616) -- 0:00:36
497500 -- (-826.107) [-826.283] (-826.738) (-830.434) * [-824.902] (-833.040) (-832.966) (-825.598) -- 0:00:36
498000 -- (-824.838) (-827.732) [-825.494] (-827.631) * (-825.418) (-824.587) (-831.805) [-825.301] -- 0:00:36
498500 -- (-825.056) (-825.465) (-825.731) [-826.318] * (-823.863) (-828.779) (-828.167) [-824.326] -- 0:00:36
499000 -- [-825.423] (-825.966) (-825.563) (-825.845) * (-826.432) (-828.995) [-825.864] (-827.255) -- 0:00:36
499500 -- (-825.478) [-827.171] (-828.403) (-825.925) * [-825.745] (-827.335) (-824.882) (-825.259) -- 0:00:36
500000 -- [-826.853] (-826.370) (-829.187) (-823.893) * [-825.134] (-826.737) (-826.648) (-825.188) -- 0:00:36
Average standard deviation of split frequencies: 0.007532
500500 -- (-830.742) (-830.687) [-828.976] (-824.913) * [-824.256] (-825.688) (-827.410) (-826.915) -- 0:00:35
501000 -- [-825.810] (-826.201) (-825.578) (-825.897) * [-824.633] (-827.591) (-826.144) (-824.119) -- 0:00:35
501500 -- (-829.924) [-825.681] (-826.650) (-826.802) * (-825.246) [-827.075] (-826.845) (-825.604) -- 0:00:35
502000 -- (-825.450) (-828.543) (-827.403) [-824.300] * (-827.699) [-825.578] (-827.206) (-826.178) -- 0:00:35
502500 -- (-826.184) (-826.581) [-827.538] (-824.244) * (-827.077) [-829.965] (-825.666) (-826.372) -- 0:00:35
503000 -- (-825.859) (-825.493) [-825.021] (-825.639) * (-824.885) [-825.173] (-827.386) (-826.386) -- 0:00:35
503500 -- [-826.870] (-825.140) (-830.135) (-825.875) * (-825.264) [-824.381] (-825.083) (-824.208) -- 0:00:35
504000 -- (-827.834) [-825.906] (-825.248) (-824.049) * (-825.690) (-825.075) [-826.809] (-826.773) -- 0:00:35
504500 -- [-824.644] (-825.422) (-826.608) (-828.397) * (-826.203) [-825.445] (-824.572) (-826.008) -- 0:00:35
505000 -- (-825.254) (-825.862) [-825.224] (-825.982) * (-824.284) [-824.894] (-828.265) (-826.215) -- 0:00:35
Average standard deviation of split frequencies: 0.007946
505500 -- (-824.755) (-826.075) (-824.785) [-827.114] * (-824.840) [-825.535] (-824.881) (-828.327) -- 0:00:35
506000 -- (-825.124) (-825.446) (-825.075) [-825.091] * (-823.836) (-825.722) [-826.793] (-826.013) -- 0:00:36
506500 -- [-827.847] (-826.569) (-827.409) (-826.214) * (-824.445) (-827.140) [-826.826] (-825.254) -- 0:00:36
507000 -- [-824.524] (-827.009) (-825.994) (-825.957) * (-826.593) [-825.989] (-827.544) (-826.948) -- 0:00:35
507500 -- (-824.458) (-826.235) (-824.197) [-825.930] * (-824.515) [-824.920] (-825.905) (-824.561) -- 0:00:35
508000 -- [-826.722] (-825.088) (-827.428) (-829.015) * (-827.528) (-824.182) (-825.553) [-824.327] -- 0:00:35
508500 -- (-826.524) (-826.969) (-828.134) [-824.104] * (-826.847) (-826.996) [-829.420] (-825.652) -- 0:00:35
509000 -- (-825.219) [-827.673] (-829.554) (-825.997) * [-825.561] (-824.822) (-828.126) (-825.600) -- 0:00:35
509500 -- (-830.203) (-833.112) [-826.336] (-825.078) * (-826.631) (-825.401) [-825.899] (-825.660) -- 0:00:35
510000 -- (-826.460) [-827.179] (-825.615) (-827.628) * (-825.252) [-824.557] (-828.457) (-824.577) -- 0:00:35
Average standard deviation of split frequencies: 0.008308
510500 -- (-826.448) (-828.571) (-827.545) [-823.951] * (-825.141) [-825.721] (-828.447) (-824.366) -- 0:00:35
511000 -- (-826.054) (-829.085) (-828.462) [-826.994] * (-825.440) [-828.068] (-832.551) (-825.240) -- 0:00:35
511500 -- (-830.367) [-827.659] (-825.577) (-826.495) * [-829.950] (-825.781) (-828.458) (-825.349) -- 0:00:35
512000 -- (-824.505) [-824.066] (-824.957) (-825.322) * (-827.599) [-825.082] (-825.866) (-825.943) -- 0:00:35
512500 -- (-825.518) [-824.747] (-826.910) (-826.477) * (-828.088) (-828.203) (-826.428) [-824.944] -- 0:00:35
513000 -- [-826.053] (-827.320) (-825.705) (-826.226) * (-824.236) [-824.459] (-829.491) (-826.783) -- 0:00:35
513500 -- (-826.466) (-831.579) [-828.775] (-826.018) * (-825.317) (-825.377) (-828.341) [-827.393] -- 0:00:35
514000 -- (-824.476) (-830.296) [-824.417] (-824.375) * (-825.131) (-824.595) (-829.656) [-825.930] -- 0:00:34
514500 -- (-824.384) [-824.664] (-826.260) (-826.081) * [-825.942] (-824.328) (-828.229) (-828.737) -- 0:00:34
515000 -- [-825.243] (-824.930) (-831.894) (-825.765) * (-827.654) [-826.999] (-831.263) (-826.449) -- 0:00:34
Average standard deviation of split frequencies: 0.007792
515500 -- (-829.869) [-824.770] (-829.774) (-826.619) * (-824.970) [-828.204] (-828.874) (-826.297) -- 0:00:34
516000 -- (-826.366) [-825.858] (-827.943) (-824.719) * (-826.711) (-826.432) [-827.914] (-827.197) -- 0:00:34
516500 -- [-825.526] (-825.227) (-824.594) (-827.682) * (-826.009) (-827.349) [-827.042] (-828.290) -- 0:00:34
517000 -- (-825.882) [-824.812] (-826.634) (-824.666) * (-831.426) (-827.260) [-826.075] (-827.041) -- 0:00:34
517500 -- (-828.710) (-825.325) [-824.981] (-830.155) * (-833.583) (-825.475) (-826.088) [-826.396] -- 0:00:34
518000 -- (-826.844) (-825.820) [-828.430] (-832.876) * (-828.683) (-827.881) (-825.436) [-826.999] -- 0:00:34
518500 -- (-828.502) (-825.352) (-825.215) [-826.277] * (-824.811) [-829.981] (-829.275) (-825.618) -- 0:00:34
519000 -- (-828.500) (-825.837) [-825.026] (-825.142) * (-826.157) (-825.340) (-825.567) [-827.781] -- 0:00:34
519500 -- [-827.707] (-824.305) (-827.922) (-827.586) * [-825.250] (-828.357) (-827.576) (-828.277) -- 0:00:34
520000 -- (-830.478) (-825.410) [-828.223] (-833.880) * [-825.996] (-825.929) (-826.023) (-825.990) -- 0:00:34
Average standard deviation of split frequencies: 0.008148
520500 -- (-829.164) [-826.191] (-829.788) (-826.583) * [-825.159] (-824.887) (-826.197) (-827.556) -- 0:00:35
521000 -- (-828.379) (-826.302) (-825.903) [-825.374] * (-826.207) (-826.593) (-830.819) [-825.411] -- 0:00:34
521500 -- (-829.566) (-827.852) (-825.731) [-825.558] * (-831.203) (-829.689) [-825.038] (-827.794) -- 0:00:34
522000 -- (-826.822) (-829.718) (-828.396) [-826.281] * (-826.481) (-829.409) (-826.627) [-824.694] -- 0:00:34
522500 -- (-824.526) [-824.969] (-825.400) (-825.023) * [-826.540] (-828.397) (-825.937) (-825.793) -- 0:00:34
523000 -- [-824.192] (-825.682) (-825.010) (-824.728) * (-825.355) (-827.377) (-824.504) [-826.933] -- 0:00:34
523500 -- [-826.369] (-827.656) (-826.242) (-827.198) * (-834.477) [-826.343] (-824.358) (-827.608) -- 0:00:34
524000 -- [-825.623] (-826.400) (-828.221) (-832.346) * (-827.436) (-828.142) (-824.238) [-824.903] -- 0:00:34
524500 -- (-825.412) (-827.068) [-824.118] (-826.888) * [-823.771] (-830.595) (-826.023) (-826.294) -- 0:00:34
525000 -- [-824.876] (-827.720) (-824.726) (-827.767) * (-824.244) [-825.401] (-825.034) (-829.852) -- 0:00:34
Average standard deviation of split frequencies: 0.008382
525500 -- [-827.675] (-826.180) (-825.133) (-828.572) * (-825.392) (-825.370) [-825.332] (-826.081) -- 0:00:34
526000 -- [-828.068] (-829.435) (-826.590) (-824.120) * (-827.154) (-828.648) (-823.863) [-825.183] -- 0:00:34
526500 -- (-829.893) (-824.865) (-827.036) [-827.149] * (-829.601) (-826.712) [-824.938] (-828.565) -- 0:00:34
527000 -- (-831.703) (-827.303) (-827.908) [-825.317] * (-825.156) (-827.849) (-827.791) [-829.563] -- 0:00:34
527500 -- (-827.354) (-830.337) [-826.952] (-826.147) * (-827.576) (-828.160) [-826.304] (-828.799) -- 0:00:34
528000 -- (-829.140) (-827.149) (-828.846) [-829.251] * (-828.053) (-825.884) [-825.645] (-826.212) -- 0:00:33
528500 -- (-825.344) (-826.017) [-826.492] (-832.622) * (-825.115) (-827.162) [-827.157] (-826.914) -- 0:00:33
529000 -- (-828.926) (-827.403) (-831.383) [-827.290] * (-824.676) [-824.996] (-830.458) (-825.611) -- 0:00:33
529500 -- (-825.253) (-825.295) [-829.491] (-827.418) * (-826.469) (-825.838) (-828.560) [-826.563] -- 0:00:33
530000 -- [-824.651] (-824.260) (-829.130) (-826.658) * (-826.338) [-825.932] (-827.094) (-824.717) -- 0:00:33
Average standard deviation of split frequencies: 0.007995
530500 -- [-825.735] (-826.159) (-829.025) (-825.567) * [-824.444] (-827.530) (-824.876) (-825.151) -- 0:00:33
531000 -- [-826.904] (-827.319) (-826.552) (-826.388) * (-824.391) (-829.582) (-826.446) [-824.202] -- 0:00:33
531500 -- (-824.699) [-825.045] (-828.188) (-825.548) * [-824.818] (-825.604) (-830.253) (-825.008) -- 0:00:33
532000 -- (-827.983) (-829.451) [-825.240] (-828.910) * [-825.552] (-828.140) (-825.381) (-828.530) -- 0:00:33
532500 -- (-826.506) [-824.548] (-827.572) (-826.215) * (-826.232) (-826.811) (-827.368) [-825.506] -- 0:00:33
533000 -- [-826.415] (-824.825) (-827.748) (-828.817) * (-824.000) (-829.253) (-824.367) [-826.354] -- 0:00:33
533500 -- (-824.573) (-829.051) (-825.342) [-824.173] * (-827.645) (-825.182) [-825.603] (-826.679) -- 0:00:33
534000 -- (-825.065) (-825.155) (-826.940) [-824.911] * (-826.041) (-827.483) [-824.846] (-827.418) -- 0:00:33
534500 -- (-825.423) [-825.521] (-828.514) (-824.723) * (-825.671) (-826.201) [-827.161] (-825.699) -- 0:00:33
535000 -- (-825.906) [-825.610] (-828.082) (-826.571) * (-824.033) [-826.552] (-827.969) (-825.965) -- 0:00:33
Average standard deviation of split frequencies: 0.008080
535500 -- (-826.265) (-825.542) (-825.715) [-825.626] * (-824.777) (-825.921) (-825.649) [-826.638] -- 0:00:33
536000 -- (-825.499) (-828.874) [-827.902] (-831.797) * [-825.101] (-824.446) (-826.400) (-825.865) -- 0:00:33
536500 -- (-824.530) (-825.605) (-828.234) [-825.480] * (-826.071) [-825.867] (-825.998) (-825.794) -- 0:00:33
537000 -- (-826.164) (-825.493) (-824.941) [-825.337] * (-829.494) (-829.543) (-825.566) [-826.260] -- 0:00:33
537500 -- (-828.969) (-826.584) (-828.382) [-827.968] * (-828.725) (-828.284) [-828.012] (-835.525) -- 0:00:33
538000 -- (-824.462) [-828.094] (-824.259) (-826.149) * (-827.486) (-828.399) [-826.741] (-825.408) -- 0:00:33
538500 -- [-824.585] (-827.572) (-824.226) (-825.956) * (-826.357) (-828.000) [-825.115] (-825.011) -- 0:00:33
539000 -- (-826.862) [-825.162] (-825.143) (-825.096) * [-826.249] (-825.727) (-824.636) (-823.945) -- 0:00:33
539500 -- (-825.099) (-825.382) [-825.875] (-825.143) * (-824.467) [-826.512] (-827.573) (-824.781) -- 0:00:33
540000 -- [-827.001] (-825.896) (-827.647) (-825.071) * (-827.027) (-825.175) [-824.615] (-827.502) -- 0:00:33
Average standard deviation of split frequencies: 0.006917
540500 -- (-827.869) (-825.058) (-828.156) [-825.512] * (-827.210) (-824.682) [-826.983] (-826.674) -- 0:00:33
541000 -- (-825.074) (-825.355) (-824.416) [-824.577] * (-825.028) [-824.171] (-829.118) (-826.225) -- 0:00:33
541500 -- [-827.113] (-829.041) (-824.636) (-825.615) * [-825.527] (-824.811) (-831.337) (-828.231) -- 0:00:33
542000 -- [-828.472] (-825.957) (-827.130) (-825.447) * (-826.524) (-828.572) (-826.486) [-825.760] -- 0:00:32
542500 -- [-825.902] (-826.490) (-825.883) (-824.952) * [-826.743] (-824.772) (-823.972) (-829.325) -- 0:00:32
543000 -- (-827.100) [-828.025] (-828.626) (-824.593) * (-825.766) (-827.064) [-823.996] (-826.942) -- 0:00:32
543500 -- (-830.597) (-831.531) [-826.748] (-826.831) * (-824.588) [-828.036] (-825.985) (-829.743) -- 0:00:32
544000 -- (-825.595) (-828.508) [-827.190] (-824.425) * [-825.209] (-827.099) (-826.256) (-831.718) -- 0:00:32
544500 -- (-825.225) [-826.212] (-831.931) (-824.475) * (-825.589) (-826.001) [-828.188] (-827.353) -- 0:00:32
545000 -- (-824.042) (-830.653) (-830.174) [-824.313] * [-824.821] (-827.595) (-826.003) (-825.914) -- 0:00:32
Average standard deviation of split frequencies: 0.007662
545500 -- (-824.663) (-827.638) (-824.354) [-824.041] * (-824.863) [-824.472] (-824.914) (-827.671) -- 0:00:32
546000 -- (-825.421) (-827.018) [-823.758] (-825.107) * [-824.553] (-824.692) (-825.860) (-827.701) -- 0:00:32
546500 -- (-826.740) (-827.607) [-825.340] (-828.033) * (-829.224) [-826.804] (-825.505) (-828.260) -- 0:00:32
547000 -- (-828.986) (-827.260) [-825.930] (-828.233) * (-828.742) (-825.720) (-824.009) [-828.459] -- 0:00:32
547500 -- [-829.140] (-828.015) (-827.706) (-825.936) * (-826.455) [-827.018] (-826.351) (-828.633) -- 0:00:32
548000 -- (-827.993) [-826.500] (-826.007) (-828.810) * [-827.751] (-827.396) (-827.427) (-827.653) -- 0:00:32
548500 -- [-827.210] (-827.928) (-825.897) (-827.532) * (-825.813) [-825.310] (-825.277) (-825.051) -- 0:00:32
549000 -- (-824.403) (-826.020) (-825.248) [-825.832] * [-828.058] (-825.828) (-825.138) (-827.494) -- 0:00:32
549500 -- (-825.158) (-832.554) (-828.196) [-826.849] * [-827.989] (-825.816) (-824.178) (-826.974) -- 0:00:32
550000 -- (-824.710) (-834.439) (-825.190) [-824.743] * [-825.275] (-825.710) (-826.731) (-826.484) -- 0:00:32
Average standard deviation of split frequencies: 0.007819
550500 -- (-826.427) (-829.717) (-827.029) [-825.125] * (-824.358) (-824.727) (-827.667) [-828.666] -- 0:00:32
551000 -- (-827.330) [-828.239] (-828.298) (-825.424) * [-824.642] (-826.347) (-828.201) (-824.662) -- 0:00:32
551500 -- (-825.542) (-827.591) (-825.283) [-827.405] * (-825.759) [-824.451] (-827.502) (-824.488) -- 0:00:32
552000 -- (-826.216) (-829.529) (-825.320) [-825.500] * (-825.272) [-826.342] (-824.356) (-824.774) -- 0:00:32
552500 -- (-825.283) (-826.907) [-824.749] (-824.796) * (-826.012) [-825.071] (-825.628) (-826.139) -- 0:00:32
553000 -- (-825.164) (-830.240) [-830.294] (-824.969) * (-825.645) [-825.305] (-826.178) (-825.119) -- 0:00:32
553500 -- (-826.318) (-829.025) [-824.596] (-826.956) * (-824.041) (-825.021) (-826.548) [-827.283] -- 0:00:32
554000 -- [-825.363] (-825.084) (-824.607) (-828.959) * [-827.552] (-824.365) (-825.930) (-827.827) -- 0:00:32
554500 -- [-831.424] (-825.550) (-828.227) (-829.594) * (-824.503) [-825.075] (-827.969) (-827.855) -- 0:00:32
555000 -- (-828.862) (-827.531) [-827.143] (-826.765) * (-824.801) (-827.454) (-829.114) [-826.372] -- 0:00:32
Average standard deviation of split frequencies: 0.007744
555500 -- (-830.473) (-824.035) [-826.154] (-826.810) * (-825.228) [-825.581] (-828.442) (-824.410) -- 0:00:32
556000 -- (-831.377) (-827.171) [-826.180] (-826.754) * (-825.573) (-827.161) [-825.349] (-825.668) -- 0:00:31
556500 -- (-826.173) (-826.880) [-827.796] (-826.489) * (-826.023) [-824.089] (-826.044) (-826.377) -- 0:00:31
557000 -- (-829.303) (-824.872) [-826.684] (-825.597) * (-824.519) [-825.672] (-825.737) (-825.389) -- 0:00:31
557500 -- [-826.744] (-824.729) (-827.516) (-827.907) * (-825.626) [-827.179] (-827.287) (-826.700) -- 0:00:31
558000 -- (-826.314) [-824.948] (-824.833) (-826.865) * (-826.550) [-826.448] (-829.554) (-826.673) -- 0:00:31
558500 -- (-827.270) (-831.834) (-824.526) [-824.939] * (-824.771) (-831.784) [-825.444] (-825.762) -- 0:00:31
559000 -- [-828.585] (-833.110) (-829.200) (-828.906) * (-825.519) (-828.959) (-825.616) [-826.973] -- 0:00:31
559500 -- (-826.335) (-830.382) [-825.197] (-824.891) * (-826.817) (-825.742) [-824.590] (-828.336) -- 0:00:31
560000 -- [-825.291] (-826.465) (-828.091) (-827.105) * (-824.937) (-827.587) [-826.430] (-825.833) -- 0:00:31
Average standard deviation of split frequencies: 0.008352
560500 -- (-828.319) [-827.024] (-827.452) (-828.342) * (-825.083) [-827.091] (-831.381) (-825.019) -- 0:00:31
561000 -- [-825.312] (-826.285) (-824.641) (-824.648) * [-826.897] (-827.207) (-826.539) (-827.207) -- 0:00:31
561500 -- (-828.233) (-828.717) (-824.687) [-827.567] * (-827.997) [-825.076] (-827.107) (-825.231) -- 0:00:31
562000 -- (-824.037) (-826.421) [-826.057] (-826.279) * (-824.222) (-825.365) (-825.760) [-824.753] -- 0:00:31
562500 -- (-827.090) (-826.351) [-831.325] (-825.730) * (-825.420) (-830.187) [-824.545] (-824.933) -- 0:00:31
563000 -- (-825.273) (-826.017) [-829.918] (-826.677) * [-828.289] (-832.290) (-825.096) (-826.552) -- 0:00:31
563500 -- [-826.086] (-824.879) (-829.078) (-829.175) * [-832.023] (-828.168) (-824.722) (-827.122) -- 0:00:31
564000 -- (-829.295) (-824.060) (-826.370) [-825.222] * (-825.602) (-828.008) (-825.331) [-827.443] -- 0:00:31
564500 -- (-825.083) (-826.763) (-825.365) [-825.406] * (-824.935) (-829.313) (-825.920) [-824.222] -- 0:00:31
565000 -- [-825.633] (-827.743) (-828.200) (-825.127) * (-826.417) (-831.524) (-828.245) [-824.199] -- 0:00:31
Average standard deviation of split frequencies: 0.008551
565500 -- (-825.047) [-826.009] (-829.630) (-825.097) * (-827.651) (-831.895) (-828.530) [-824.138] -- 0:00:31
566000 -- (-827.041) (-825.921) (-830.966) [-826.162] * (-827.753) (-827.020) [-825.727] (-824.914) -- 0:00:31
566500 -- (-827.026) (-826.421) [-826.205] (-824.967) * [-827.009] (-824.648) (-824.507) (-826.245) -- 0:00:31
567000 -- (-829.787) [-823.931] (-828.212) (-828.331) * [-826.478] (-823.970) (-827.866) (-826.516) -- 0:00:31
567500 -- [-824.307] (-824.174) (-825.754) (-828.981) * [-826.455] (-825.537) (-827.563) (-831.107) -- 0:00:31
568000 -- (-828.736) [-827.759] (-828.455) (-827.592) * (-825.977) (-825.380) [-828.619] (-825.176) -- 0:00:31
568500 -- [-828.355] (-826.293) (-828.622) (-827.829) * [-826.720] (-829.144) (-825.408) (-824.914) -- 0:00:31
569000 -- [-827.595] (-825.635) (-827.008) (-828.333) * (-825.927) [-824.228] (-827.554) (-825.442) -- 0:00:31
569500 -- (-824.455) (-826.561) (-825.899) [-828.407] * [-825.392] (-825.132) (-827.034) (-826.519) -- 0:00:30
570000 -- (-828.696) (-829.910) (-825.576) [-828.632] * (-826.580) [-825.287] (-824.402) (-825.268) -- 0:00:30
Average standard deviation of split frequencies: 0.007951
570500 -- (-825.369) [-826.207] (-826.101) (-826.804) * (-827.102) (-833.316) (-824.505) [-825.995] -- 0:00:30
571000 -- [-825.545] (-827.287) (-826.058) (-827.358) * [-825.983] (-827.149) (-825.398) (-825.050) -- 0:00:30
571500 -- (-826.976) (-824.919) [-824.968] (-827.122) * (-826.892) (-826.276) (-827.831) [-825.051] -- 0:00:30
572000 -- (-824.360) (-825.275) [-829.138] (-825.715) * (-827.954) [-825.482] (-827.005) (-825.434) -- 0:00:30
572500 -- (-825.757) [-830.345] (-825.036) (-827.045) * (-825.970) (-824.049) (-824.436) [-825.628] -- 0:00:30
573000 -- [-824.284] (-825.246) (-824.395) (-826.145) * (-826.859) (-825.222) (-824.330) [-828.590] -- 0:00:30
573500 -- [-824.702] (-827.547) (-826.355) (-825.358) * (-826.210) (-828.761) [-831.534] (-826.637) -- 0:00:30
574000 -- (-824.471) [-825.421] (-827.147) (-825.317) * (-826.411) (-827.659) (-825.535) [-828.273] -- 0:00:30
574500 -- (-826.536) (-825.092) (-828.161) [-825.395] * (-826.020) (-824.868) (-826.345) [-826.048] -- 0:00:30
575000 -- (-826.087) (-826.770) [-826.010] (-825.367) * (-831.440) (-824.019) [-824.670] (-829.606) -- 0:00:30
Average standard deviation of split frequencies: 0.008184
575500 -- [-825.337] (-826.832) (-826.643) (-828.172) * (-827.645) (-824.620) (-825.161) [-825.404] -- 0:00:30
576000 -- (-826.186) [-825.196] (-825.458) (-828.013) * [-825.332] (-826.688) (-824.569) (-832.273) -- 0:00:30
576500 -- (-825.894) (-827.640) (-826.309) [-828.865] * (-826.326) (-826.969) (-827.929) [-828.077] -- 0:00:30
577000 -- [-828.694] (-827.250) (-826.762) (-831.033) * [-824.548] (-824.874) (-826.841) (-828.727) -- 0:00:30
577500 -- [-825.708] (-826.952) (-824.575) (-826.822) * [-824.977] (-826.065) (-827.755) (-830.618) -- 0:00:30
578000 -- (-825.178) (-825.368) (-826.679) [-829.465] * (-825.064) [-826.078] (-826.252) (-830.860) -- 0:00:30
578500 -- (-830.287) (-826.177) [-827.393] (-827.203) * (-827.943) (-827.948) (-825.478) [-828.419] -- 0:00:30
579000 -- (-825.729) (-825.182) (-826.842) [-824.640] * [-825.671] (-824.919) (-824.995) (-827.126) -- 0:00:30
579500 -- (-827.737) (-825.898) (-830.952) [-826.785] * [-826.212] (-827.635) (-825.780) (-827.260) -- 0:00:30
580000 -- (-828.533) (-827.119) (-829.747) [-824.718] * (-828.309) (-825.375) (-826.618) [-827.279] -- 0:00:30
Average standard deviation of split frequencies: 0.008443
580500 -- (-824.633) (-825.217) (-830.624) [-825.301] * [-825.423] (-825.407) (-827.461) (-826.200) -- 0:00:30
581000 -- (-824.208) [-828.784] (-825.705) (-826.584) * (-826.099) (-826.594) (-827.575) [-824.274] -- 0:00:30
581500 -- [-824.909] (-825.164) (-828.142) (-832.578) * (-828.911) [-824.762] (-830.739) (-823.814) -- 0:00:30
582000 -- (-826.027) (-824.579) (-824.650) [-826.993] * (-827.428) (-824.563) (-827.554) [-826.066] -- 0:00:30
582500 -- [-827.182] (-824.784) (-826.759) (-825.117) * (-824.295) (-826.089) [-825.755] (-824.470) -- 0:00:30
583000 -- (-831.411) (-827.770) (-828.598) [-826.413] * (-825.623) [-827.603] (-828.073) (-828.129) -- 0:00:30
583500 -- (-828.643) (-826.824) [-824.564] (-824.984) * (-830.700) (-827.767) [-827.405] (-825.533) -- 0:00:29
584000 -- (-826.376) (-828.958) [-827.660] (-828.181) * [-827.093] (-830.446) (-827.707) (-824.587) -- 0:00:29
584500 -- (-827.419) (-826.805) [-825.701] (-825.197) * [-827.518] (-824.996) (-825.785) (-828.025) -- 0:00:29
585000 -- (-832.725) (-828.909) [-824.408] (-825.227) * (-825.633) (-829.130) (-824.636) [-825.297] -- 0:00:29
Average standard deviation of split frequencies: 0.007994
585500 -- [-824.029] (-826.692) (-824.302) (-829.098) * [-826.913] (-834.707) (-826.350) (-826.950) -- 0:00:29
586000 -- [-825.314] (-826.189) (-824.120) (-826.298) * [-827.146] (-829.277) (-824.888) (-826.295) -- 0:00:29
586500 -- (-826.048) [-825.518] (-824.325) (-834.183) * (-833.360) (-828.867) (-826.375) [-824.404] -- 0:00:29
587000 -- (-827.227) [-825.469] (-826.924) (-829.076) * (-838.074) (-824.275) (-825.867) [-828.502] -- 0:00:29
587500 -- (-826.098) [-824.393] (-827.650) (-828.210) * (-828.700) [-828.024] (-826.133) (-824.755) -- 0:00:29
588000 -- (-824.981) (-829.975) [-827.043] (-825.139) * [-824.443] (-827.233) (-827.266) (-824.561) -- 0:00:29
588500 -- (-824.533) [-827.716] (-825.554) (-824.771) * [-824.968] (-827.504) (-827.678) (-825.329) -- 0:00:29
589000 -- (-824.397) (-826.217) (-827.395) [-824.698] * (-826.718) (-825.017) (-825.714) [-828.527] -- 0:00:29
589500 -- (-829.301) [-826.503] (-825.318) (-829.656) * (-827.006) [-827.584] (-827.648) (-825.410) -- 0:00:29
590000 -- [-824.917] (-829.627) (-824.327) (-833.794) * [-830.410] (-825.617) (-827.828) (-825.106) -- 0:00:29
Average standard deviation of split frequencies: 0.008081
590500 -- (-825.601) [-824.464] (-824.300) (-825.446) * (-827.823) [-826.196] (-826.635) (-824.620) -- 0:00:29
591000 -- [-824.511] (-826.671) (-826.400) (-831.276) * (-828.575) (-823.806) [-825.309] (-824.206) -- 0:00:29
591500 -- (-825.954) [-825.450] (-826.952) (-833.032) * (-829.224) (-824.795) (-826.223) [-824.466] -- 0:00:29
592000 -- (-828.072) (-824.677) (-826.832) [-828.228] * [-825.879] (-825.319) (-826.545) (-826.279) -- 0:00:29
592500 -- [-825.358] (-824.403) (-827.845) (-825.427) * (-826.017) (-827.097) [-826.888] (-825.423) -- 0:00:29
593000 -- [-825.699] (-826.377) (-828.603) (-827.281) * (-827.194) (-825.421) [-825.633] (-823.968) -- 0:00:29
593500 -- (-831.182) [-826.267] (-827.483) (-828.195) * [-826.422] (-824.398) (-827.421) (-826.996) -- 0:00:29
594000 -- [-825.474] (-825.843) (-827.877) (-824.992) * (-828.691) [-824.634] (-827.915) (-824.502) -- 0:00:29
594500 -- [-826.568] (-825.181) (-824.781) (-825.418) * (-826.645) (-825.284) [-824.273] (-825.516) -- 0:00:29
595000 -- (-829.041) [-827.189] (-827.064) (-824.544) * (-825.115) (-827.314) (-825.999) [-824.795] -- 0:00:29
Average standard deviation of split frequencies: 0.008384
595500 -- (-830.751) (-825.491) (-828.145) [-826.450] * (-825.446) [-825.882] (-826.595) (-825.569) -- 0:00:29
596000 -- (-827.015) (-827.191) [-826.331] (-825.892) * [-824.741] (-827.789) (-826.202) (-826.563) -- 0:00:29
596500 -- (-827.412) [-826.291] (-826.396) (-825.783) * (-824.212) (-831.078) (-827.030) [-825.108] -- 0:00:29
597000 -- (-825.572) (-826.327) [-826.776] (-827.893) * (-824.011) (-829.648) (-826.811) [-825.767] -- 0:00:29
597500 -- [-824.832] (-832.325) (-825.452) (-827.088) * (-825.187) (-827.739) [-825.630] (-830.213) -- 0:00:28
598000 -- (-824.699) [-826.227] (-826.949) (-828.363) * [-826.611] (-825.480) (-829.246) (-827.226) -- 0:00:28
598500 -- (-827.381) [-826.927] (-825.310) (-825.185) * (-827.365) [-826.545] (-825.702) (-825.120) -- 0:00:28
599000 -- [-827.021] (-828.492) (-826.614) (-825.258) * (-831.280) (-825.184) [-826.790] (-825.805) -- 0:00:28
599500 -- [-827.537] (-825.520) (-825.447) (-829.139) * (-826.742) (-825.407) (-827.452) [-826.790] -- 0:00:28
600000 -- (-826.765) (-824.622) [-826.078] (-825.093) * (-826.803) (-827.677) (-829.423) [-829.198] -- 0:00:28
Average standard deviation of split frequencies: 0.009156
600500 -- [-823.777] (-825.431) (-825.429) (-825.137) * (-827.254) (-828.629) [-825.935] (-829.745) -- 0:00:28
601000 -- (-828.883) (-826.292) (-824.613) [-826.339] * (-828.229) (-828.456) (-831.250) [-826.561] -- 0:00:28
601500 -- (-827.523) (-825.587) [-826.366] (-825.005) * (-823.983) (-825.458) (-832.970) [-824.843] -- 0:00:28
602000 -- (-826.734) (-825.328) [-825.900] (-828.250) * (-825.205) (-825.923) (-827.873) [-826.446] -- 0:00:28
602500 -- (-827.375) [-825.204] (-825.356) (-825.845) * (-829.174) [-824.164] (-827.820) (-824.500) -- 0:00:28
603000 -- (-825.873) [-824.846] (-825.436) (-824.983) * (-828.315) [-826.676] (-831.861) (-826.685) -- 0:00:28
603500 -- (-825.690) [-824.898] (-826.026) (-826.736) * (-828.138) (-826.207) (-825.210) [-826.225] -- 0:00:28
604000 -- [-826.369] (-824.217) (-825.025) (-824.660) * (-828.746) (-827.650) (-826.430) [-825.451] -- 0:00:28
604500 -- [-825.362] (-825.120) (-824.552) (-825.733) * [-828.493] (-829.352) (-827.214) (-825.674) -- 0:00:28
605000 -- (-827.703) (-824.658) (-825.607) [-826.900] * (-825.152) [-828.875] (-825.299) (-827.873) -- 0:00:28
Average standard deviation of split frequencies: 0.008609
605500 -- (-825.311) [-825.186] (-827.311) (-828.933) * (-830.231) (-826.177) [-826.567] (-826.287) -- 0:00:28
606000 -- [-831.269] (-823.969) (-824.714) (-826.732) * [-825.256] (-824.788) (-825.762) (-826.997) -- 0:00:28
606500 -- (-824.300) (-824.681) (-825.343) [-824.619] * [-827.919] (-825.830) (-825.193) (-828.964) -- 0:00:28
607000 -- (-826.194) (-824.499) (-826.287) [-824.708] * (-829.637) (-831.194) [-824.659] (-825.842) -- 0:00:28
607500 -- (-825.122) (-829.655) (-829.136) [-824.185] * (-825.953) (-826.041) [-825.127] (-828.659) -- 0:00:28
608000 -- (-824.304) [-825.294] (-826.972) (-827.234) * (-827.296) (-826.352) [-826.192] (-824.558) -- 0:00:28
608500 -- (-824.573) (-829.026) (-828.021) [-824.724] * (-825.651) [-824.707] (-827.577) (-825.448) -- 0:00:28
609000 -- (-826.305) (-827.645) [-827.737] (-825.247) * (-825.684) [-824.605] (-827.912) (-827.551) -- 0:00:28
609500 -- [-825.283] (-826.940) (-827.635) (-826.928) * [-826.400] (-824.898) (-826.492) (-827.292) -- 0:00:28
610000 -- (-824.997) (-825.550) [-827.111] (-825.584) * (-828.797) [-828.370] (-826.374) (-824.509) -- 0:00:28
Average standard deviation of split frequencies: 0.008594
610500 -- (-824.559) (-827.630) [-825.044] (-824.603) * (-830.077) (-826.338) [-823.816] (-824.806) -- 0:00:28
611000 -- [-824.834] (-826.726) (-825.231) (-830.580) * (-826.165) (-824.847) (-826.443) [-828.123] -- 0:00:28
611500 -- (-824.933) (-827.224) [-824.130] (-829.355) * (-825.363) (-825.428) (-825.608) [-826.085] -- 0:00:27
612000 -- (-825.540) (-824.823) [-827.093] (-827.716) * (-825.242) [-825.542] (-825.710) (-826.368) -- 0:00:27
612500 -- (-824.798) (-824.762) (-824.463) [-824.123] * [-826.458] (-828.906) (-825.259) (-825.095) -- 0:00:27
613000 -- (-825.488) (-825.034) [-826.119] (-824.351) * [-826.210] (-829.562) (-826.995) (-824.140) -- 0:00:27
613500 -- (-826.552) (-826.368) (-828.660) [-824.422] * (-825.751) [-830.560] (-824.341) (-824.192) -- 0:00:27
614000 -- (-826.125) (-827.068) [-825.639] (-825.416) * [-824.558] (-824.004) (-824.332) (-825.718) -- 0:00:27
614500 -- (-826.829) [-825.516] (-826.236) (-825.986) * (-825.648) [-826.521] (-827.845) (-826.927) -- 0:00:27
615000 -- (-827.680) [-828.109] (-826.010) (-831.185) * (-823.853) (-827.909) (-827.739) [-827.027] -- 0:00:27
Average standard deviation of split frequencies: 0.008418
615500 -- (-826.522) (-825.291) [-825.234] (-826.369) * (-828.535) [-826.448] (-824.842) (-828.150) -- 0:00:27
616000 -- (-825.274) [-824.674] (-826.372) (-827.289) * (-825.636) (-825.781) [-826.050] (-827.358) -- 0:00:27
616500 -- (-825.397) (-826.909) (-826.965) [-825.134] * (-824.782) [-826.724] (-825.026) (-826.267) -- 0:00:27
617000 -- (-827.792) (-832.815) [-826.277] (-828.530) * (-825.555) (-825.012) (-833.752) [-827.347] -- 0:00:27
617500 -- (-828.075) (-829.001) [-824.619] (-826.331) * (-827.139) (-826.241) (-827.241) [-826.318] -- 0:00:27
618000 -- (-832.446) (-827.799) [-825.134] (-826.657) * [-828.268] (-824.695) (-827.300) (-826.853) -- 0:00:27
618500 -- [-827.951] (-826.186) (-825.693) (-830.006) * (-828.582) [-824.633] (-824.852) (-824.356) -- 0:00:27
619000 -- [-825.052] (-828.926) (-825.025) (-825.026) * [-825.696] (-825.420) (-828.491) (-826.351) -- 0:00:27
619500 -- (-826.119) (-830.245) (-826.128) [-825.579] * [-830.947] (-826.353) (-830.789) (-826.226) -- 0:00:27
620000 -- (-824.412) (-829.272) [-824.491] (-829.509) * (-825.888) (-824.196) [-825.997] (-828.395) -- 0:00:27
Average standard deviation of split frequencies: 0.009013
620500 -- (-825.761) [-826.773] (-826.196) (-830.652) * [-824.811] (-826.960) (-825.477) (-829.050) -- 0:00:27
621000 -- [-825.018] (-829.310) (-827.704) (-826.108) * (-824.687) [-826.280] (-826.964) (-826.364) -- 0:00:27
621500 -- (-823.893) (-825.141) [-825.123] (-825.289) * (-824.201) [-825.317] (-824.865) (-829.865) -- 0:00:27
622000 -- (-824.447) (-826.824) (-825.403) [-826.206] * (-824.000) [-828.021] (-825.407) (-825.591) -- 0:00:27
622500 -- (-824.098) [-828.455] (-825.228) (-828.031) * (-824.585) (-826.139) [-825.115] (-826.448) -- 0:00:27
623000 -- (-825.454) (-829.784) [-828.619] (-826.831) * [-824.757] (-826.050) (-825.013) (-831.494) -- 0:00:27
623500 -- (-825.257) (-825.327) [-826.073] (-826.766) * (-825.814) (-825.167) (-826.056) [-829.907] -- 0:00:27
624000 -- (-830.492) [-825.471] (-827.304) (-824.410) * [-825.143] (-826.714) (-827.268) (-827.035) -- 0:00:27
624500 -- (-826.829) [-825.682] (-825.767) (-825.515) * (-825.651) (-827.591) [-828.925] (-827.878) -- 0:00:27
625000 -- (-828.711) [-824.305] (-826.242) (-824.778) * (-825.927) [-825.944] (-831.221) (-827.502) -- 0:00:27
Average standard deviation of split frequencies: 0.009087
625500 -- [-826.912] (-824.966) (-825.392) (-825.559) * (-828.162) (-828.196) [-828.468] (-825.020) -- 0:00:26
626000 -- (-826.967) [-824.648] (-825.096) (-826.035) * (-826.394) [-824.113] (-826.884) (-825.297) -- 0:00:26
626500 -- (-829.041) (-825.288) (-827.739) [-825.054] * (-827.315) [-824.011] (-825.777) (-826.436) -- 0:00:26
627000 -- [-826.933] (-824.300) (-828.426) (-829.392) * (-825.525) (-825.254) [-824.325] (-829.487) -- 0:00:26
627500 -- (-829.490) [-823.996] (-826.016) (-825.517) * (-825.557) [-826.154] (-824.398) (-825.843) -- 0:00:26
628000 -- (-825.073) (-824.533) (-830.320) [-825.786] * (-825.687) (-824.665) (-825.031) [-826.006] -- 0:00:26
628500 -- (-824.772) (-827.991) [-826.243] (-827.963) * (-824.387) (-826.876) (-824.885) [-826.639] -- 0:00:26
629000 -- (-826.297) (-827.831) [-826.086] (-824.369) * (-825.151) (-827.668) [-824.275] (-828.069) -- 0:00:26
629500 -- (-830.043) (-826.053) (-825.655) [-827.006] * (-824.670) (-827.328) [-824.226] (-827.668) -- 0:00:26
630000 -- [-828.816] (-827.885) (-824.672) (-827.984) * [-827.263] (-827.295) (-824.745) (-826.045) -- 0:00:26
Average standard deviation of split frequencies: 0.009069
630500 -- [-826.027] (-826.830) (-830.218) (-830.251) * (-826.309) [-826.071] (-826.463) (-825.816) -- 0:00:26
631000 -- (-827.460) (-827.232) [-825.508] (-829.961) * (-826.467) [-825.561] (-824.495) (-825.275) -- 0:00:26
631500 -- (-825.997) (-825.986) (-825.955) [-826.357] * [-825.419] (-826.756) (-825.070) (-830.891) -- 0:00:26
632000 -- [-824.447] (-826.600) (-829.185) (-825.321) * (-829.991) (-828.157) [-825.299] (-826.269) -- 0:00:26
632500 -- (-827.708) (-825.502) (-829.913) [-824.866] * (-826.317) (-826.178) [-825.597] (-825.568) -- 0:00:26
633000 -- (-829.282) (-824.332) [-826.514] (-824.904) * [-825.399] (-824.621) (-825.113) (-825.792) -- 0:00:26
633500 -- (-827.870) [-824.836] (-824.614) (-824.706) * [-826.130] (-824.247) (-824.127) (-824.837) -- 0:00:26
634000 -- (-828.306) [-824.901] (-825.174) (-825.709) * [-826.906] (-824.391) (-824.428) (-825.895) -- 0:00:26
634500 -- (-825.839) (-825.856) [-829.312] (-826.501) * [-826.489] (-824.088) (-825.020) (-824.335) -- 0:00:26
635000 -- (-837.991) (-825.354) (-828.396) [-827.059] * (-826.552) [-828.174] (-828.411) (-827.599) -- 0:00:26
Average standard deviation of split frequencies: 0.009685
635500 -- (-826.512) (-826.246) (-826.894) [-826.126] * (-824.813) (-825.000) [-825.553] (-825.891) -- 0:00:26
636000 -- (-829.068) (-828.873) (-831.844) [-825.459] * (-824.916) (-824.866) [-825.082] (-824.626) -- 0:00:26
636500 -- (-825.739) [-826.788] (-824.920) (-825.224) * (-827.490) (-827.321) [-827.166] (-828.396) -- 0:00:26
637000 -- (-827.991) (-826.902) (-824.922) [-826.809] * (-826.905) (-826.468) [-827.104] (-826.318) -- 0:00:26
637500 -- (-825.466) [-825.931] (-830.645) (-827.837) * (-825.868) (-828.441) (-825.477) [-826.587] -- 0:00:26
638000 -- [-826.861] (-826.920) (-826.884) (-826.412) * (-827.950) (-826.976) [-824.965] (-825.600) -- 0:00:26
638500 -- (-829.957) (-828.485) (-826.530) [-824.241] * (-827.699) [-829.057] (-824.512) (-825.899) -- 0:00:26
639000 -- (-829.527) [-826.613] (-825.804) (-825.094) * (-825.954) [-825.732] (-828.341) (-830.329) -- 0:00:25
639500 -- (-828.287) (-825.486) [-824.532] (-825.225) * (-825.734) [-824.000] (-832.775) (-826.791) -- 0:00:25
640000 -- (-825.719) (-827.522) (-824.382) [-829.399] * (-826.945) (-823.982) [-827.534] (-826.745) -- 0:00:25
Average standard deviation of split frequencies: 0.009841
640500 -- (-824.932) [-824.898] (-828.130) (-826.331) * (-825.998) [-826.406] (-825.245) (-836.764) -- 0:00:25
641000 -- [-825.531] (-824.859) (-832.779) (-826.945) * [-824.847] (-829.380) (-826.702) (-827.569) -- 0:00:25
641500 -- (-827.875) (-825.263) (-828.509) [-826.866] * [-824.901] (-827.046) (-832.638) (-824.327) -- 0:00:25
642000 -- (-828.092) (-825.429) [-824.660] (-826.098) * (-828.716) (-829.145) (-831.658) [-824.941] -- 0:00:25
642500 -- (-834.786) [-825.805] (-827.961) (-825.088) * [-828.517] (-826.655) (-825.499) (-827.304) -- 0:00:25
643000 -- (-825.730) (-826.316) [-827.341] (-825.917) * (-824.872) [-825.951] (-824.933) (-824.889) -- 0:00:25
643500 -- [-825.298] (-827.549) (-825.367) (-826.021) * [-824.769] (-828.930) (-827.975) (-824.865) -- 0:00:25
644000 -- (-826.929) (-826.194) (-824.369) [-826.080] * [-826.081] (-827.369) (-824.488) (-825.184) -- 0:00:25
644500 -- (-825.264) (-826.537) [-825.114] (-826.092) * (-826.627) (-824.883) (-826.558) [-825.050] -- 0:00:25
645000 -- [-825.534] (-826.259) (-826.708) (-826.700) * (-825.661) (-824.138) [-825.848] (-825.577) -- 0:00:25
Average standard deviation of split frequencies: 0.009532
645500 -- [-827.835] (-828.233) (-826.535) (-824.573) * (-825.907) (-826.021) [-827.426] (-823.971) -- 0:00:25
646000 -- (-825.376) (-828.481) (-827.707) [-825.446] * (-827.756) (-826.711) [-828.531] (-825.721) -- 0:00:25
646500 -- (-827.122) [-826.319] (-824.607) (-833.381) * (-825.894) [-827.824] (-824.810) (-830.895) -- 0:00:25
647000 -- (-827.143) (-827.031) (-827.186) [-828.901] * [-825.990] (-827.806) (-827.617) (-827.614) -- 0:00:25
647500 -- [-828.672] (-830.998) (-824.479) (-831.991) * (-827.111) (-826.137) (-824.116) [-825.018] -- 0:00:25
648000 -- (-829.428) (-829.526) [-824.656] (-827.509) * [-826.507] (-826.802) (-824.148) (-824.463) -- 0:00:25
648500 -- [-826.467] (-825.548) (-824.766) (-826.742) * (-827.143) [-825.896] (-828.139) (-826.810) -- 0:00:25
649000 -- (-826.276) [-827.530] (-825.996) (-828.400) * (-827.110) (-823.984) (-827.450) [-827.768] -- 0:00:25
649500 -- (-823.884) (-826.607) (-827.216) [-825.624] * (-829.086) (-825.636) [-826.716] (-827.514) -- 0:00:25
650000 -- [-824.832] (-825.343) (-825.626) (-824.992) * (-825.948) (-826.057) [-825.069] (-826.254) -- 0:00:25
Average standard deviation of split frequencies: 0.009461
650500 -- (-824.102) [-825.132] (-828.320) (-825.607) * (-825.917) (-824.832) [-824.641] (-826.179) -- 0:00:25
651000 -- [-826.999] (-823.856) (-826.643) (-824.842) * (-829.685) (-826.414) [-825.320] (-828.826) -- 0:00:25
651500 -- [-824.923] (-827.129) (-824.477) (-824.063) * (-826.443) (-825.846) (-826.563) [-826.138] -- 0:00:25
652000 -- (-825.519) (-826.860) [-830.573] (-829.315) * (-826.275) [-826.212] (-827.503) (-825.466) -- 0:00:25
652500 -- (-825.425) (-827.594) (-828.452) [-824.319] * [-824.551] (-824.593) (-825.564) (-825.804) -- 0:00:25
653000 -- (-825.218) (-825.839) (-824.335) [-827.512] * (-825.180) (-828.413) (-827.304) [-826.328] -- 0:00:24
653500 -- (-827.708) [-825.113] (-826.079) (-827.045) * (-825.028) [-826.101] (-827.564) (-824.091) -- 0:00:24
654000 -- (-825.773) (-825.541) (-825.897) [-827.182] * (-826.537) (-825.454) [-827.456] (-824.943) -- 0:00:24
654500 -- [-825.140] (-824.859) (-825.102) (-824.497) * (-826.198) [-826.100] (-824.027) (-824.974) -- 0:00:24
655000 -- (-826.102) [-825.041] (-824.425) (-826.488) * [-825.462] (-825.212) (-824.651) (-826.510) -- 0:00:24
Average standard deviation of split frequencies: 0.009131
655500 -- (-825.114) (-825.950) [-824.845] (-824.419) * [-826.259] (-827.066) (-831.334) (-828.235) -- 0:00:24
656000 -- (-825.713) [-827.498] (-824.033) (-825.852) * (-825.118) [-825.694] (-827.081) (-825.144) -- 0:00:24
656500 -- (-826.168) (-827.604) [-824.651] (-829.455) * [-825.273] (-825.619) (-824.740) (-826.167) -- 0:00:24
657000 -- [-826.543] (-827.477) (-824.651) (-826.657) * [-829.182] (-825.558) (-827.698) (-827.609) -- 0:00:24
657500 -- (-824.403) (-824.595) (-825.366) [-827.059] * [-826.460] (-826.074) (-826.331) (-827.364) -- 0:00:24
658000 -- (-825.058) (-824.369) (-825.571) [-824.491] * (-825.859) [-824.447] (-829.804) (-826.068) -- 0:00:24
658500 -- [-825.839] (-827.911) (-824.477) (-825.955) * (-829.744) [-827.617] (-823.766) (-826.910) -- 0:00:24
659000 -- [-825.489] (-828.075) (-824.673) (-828.901) * (-828.867) [-826.405] (-826.633) (-825.625) -- 0:00:24
659500 -- (-826.075) (-828.461) [-829.391] (-827.328) * [-826.265] (-825.377) (-825.066) (-827.279) -- 0:00:24
660000 -- (-826.785) [-827.973] (-828.243) (-825.775) * (-827.161) [-824.822] (-825.710) (-826.949) -- 0:00:24
Average standard deviation of split frequencies: 0.008856
660500 -- [-825.805] (-824.908) (-827.424) (-824.928) * (-825.020) (-826.208) [-825.111] (-824.171) -- 0:00:24
661000 -- [-825.954] (-827.079) (-828.535) (-823.830) * (-825.428) [-827.069] (-825.059) (-826.440) -- 0:00:24
661500 -- (-827.709) (-827.342) [-827.512] (-825.378) * (-825.483) [-828.867] (-825.708) (-827.813) -- 0:00:24
662000 -- [-825.108] (-827.901) (-825.581) (-826.626) * (-824.114) (-833.683) [-824.165] (-825.967) -- 0:00:24
662500 -- (-827.811) [-828.028] (-829.699) (-826.600) * (-823.988) (-830.482) [-825.744] (-825.418) -- 0:00:24
663000 -- (-828.068) [-824.545] (-827.412) (-834.596) * (-824.542) (-830.062) (-827.415) [-826.339] -- 0:00:24
663500 -- [-827.720] (-824.174) (-826.822) (-824.028) * [-825.644] (-825.635) (-827.416) (-828.601) -- 0:00:24
664000 -- (-824.280) [-830.038] (-824.481) (-830.258) * [-827.156] (-824.348) (-824.207) (-828.400) -- 0:00:24
664500 -- (-824.263) (-825.508) (-824.424) [-828.736] * (-826.072) [-824.522] (-824.811) (-826.561) -- 0:00:24
665000 -- (-826.780) (-825.152) (-829.512) [-825.637] * (-826.779) [-825.207] (-826.918) (-829.754) -- 0:00:24
Average standard deviation of split frequencies: 0.009160
665500 -- (-825.964) (-829.867) [-824.023] (-830.186) * (-829.220) (-824.955) [-825.225] (-830.286) -- 0:00:24
666000 -- (-825.057) (-826.704) [-823.812] (-830.839) * (-826.009) (-828.351) [-825.581] (-826.192) -- 0:00:24
666500 -- (-825.236) [-824.458] (-824.214) (-830.182) * (-829.854) (-826.106) (-827.409) [-826.499] -- 0:00:24
667000 -- (-825.187) (-825.311) [-824.653] (-826.909) * [-824.527] (-825.108) (-829.320) (-824.784) -- 0:00:23
667500 -- [-826.370] (-829.912) (-827.737) (-828.616) * [-824.780] (-826.149) (-826.418) (-825.341) -- 0:00:23
668000 -- (-829.048) [-824.168] (-827.781) (-826.817) * (-824.603) (-826.968) (-830.665) [-824.813] -- 0:00:23
668500 -- (-825.629) [-824.495] (-827.102) (-824.760) * (-825.650) (-828.768) (-826.276) [-825.752] -- 0:00:23
669000 -- [-825.267] (-824.534) (-826.657) (-829.065) * (-824.930) (-824.427) (-824.745) [-826.145] -- 0:00:23
669500 -- [-823.930] (-824.854) (-827.330) (-827.497) * [-825.122] (-825.500) (-827.254) (-825.368) -- 0:00:23
670000 -- (-823.856) [-825.568] (-827.566) (-825.275) * (-824.591) (-826.966) [-826.653] (-828.146) -- 0:00:23
Average standard deviation of split frequencies: 0.008269
670500 -- (-824.082) (-826.254) (-824.760) [-826.613] * (-827.237) (-826.614) (-826.681) [-828.509] -- 0:00:23
671000 -- (-824.569) (-824.764) (-824.175) [-827.081] * (-830.258) [-825.847] (-830.088) (-825.556) -- 0:00:23
671500 -- [-823.957] (-824.960) (-824.986) (-827.064) * (-827.005) (-826.519) [-826.525] (-825.651) -- 0:00:23
672000 -- (-825.605) [-828.536] (-824.714) (-826.474) * [-827.204] (-826.411) (-829.281) (-827.662) -- 0:00:23
672500 -- (-824.117) (-824.826) (-825.257) [-826.363] * (-826.518) (-825.668) [-827.740] (-827.119) -- 0:00:23
673000 -- (-830.239) [-824.721] (-825.321) (-826.779) * [-824.714] (-824.455) (-831.532) (-826.933) -- 0:00:23
673500 -- (-826.223) [-825.216] (-829.009) (-826.328) * (-827.241) [-825.234] (-826.655) (-826.457) -- 0:00:23
674000 -- [-824.190] (-825.567) (-827.064) (-830.248) * [-827.640] (-826.101) (-825.663) (-832.007) -- 0:00:23
674500 -- [-824.443] (-825.450) (-825.553) (-827.837) * (-829.352) [-826.305] (-826.046) (-835.738) -- 0:00:23
675000 -- (-828.210) (-826.976) (-826.130) [-825.659] * (-825.482) (-824.489) [-829.096] (-826.483) -- 0:00:23
Average standard deviation of split frequencies: 0.008063
675500 -- (-827.729) (-825.412) (-824.139) [-825.494] * (-827.216) (-828.019) (-826.810) [-825.593] -- 0:00:23
676000 -- [-829.208] (-824.790) (-824.846) (-828.152) * [-825.035] (-829.662) (-828.860) (-826.414) -- 0:00:23
676500 -- (-824.336) (-824.735) [-827.017] (-828.925) * (-825.881) (-825.646) [-826.617] (-824.576) -- 0:00:23
677000 -- (-824.336) (-828.422) (-825.203) [-824.642] * [-825.001] (-826.579) (-826.819) (-826.188) -- 0:00:23
677500 -- [-827.900] (-825.575) (-826.246) (-826.032) * [-825.956] (-824.796) (-826.172) (-827.116) -- 0:00:23
678000 -- (-824.750) (-826.786) [-824.885] (-824.655) * (-825.504) (-825.826) (-826.971) [-824.613] -- 0:00:23
678500 -- (-825.796) [-824.105] (-823.865) (-824.787) * (-824.377) (-826.317) [-825.733] (-824.015) -- 0:00:23
679000 -- (-830.855) (-826.126) [-825.054] (-827.035) * (-832.593) [-826.782] (-826.184) (-826.966) -- 0:00:23
679500 -- [-825.124] (-823.816) (-828.622) (-826.879) * (-825.375) (-829.121) (-829.317) [-825.235] -- 0:00:23
680000 -- (-826.478) (-825.698) (-825.438) [-824.582] * (-826.676) [-825.812] (-825.444) (-828.617) -- 0:00:23
Average standard deviation of split frequencies: 0.008527
680500 -- (-825.457) (-825.135) [-829.550] (-824.765) * (-826.297) (-825.931) [-825.818] (-827.875) -- 0:00:23
681000 -- [-825.581] (-829.235) (-829.168) (-826.573) * (-826.402) [-825.536] (-828.042) (-827.198) -- 0:00:22
681500 -- (-824.340) [-824.693] (-823.966) (-825.201) * (-825.108) (-827.144) [-825.411] (-825.385) -- 0:00:22
682000 -- (-823.991) (-826.036) (-827.785) [-827.622] * (-825.596) (-825.703) (-825.701) [-827.198] -- 0:00:22
682500 -- [-824.418] (-827.070) (-826.913) (-824.362) * [-825.255] (-826.727) (-826.408) (-828.623) -- 0:00:22
683000 -- (-825.481) (-824.585) (-824.319) [-824.358] * [-824.429] (-835.804) (-829.172) (-827.596) -- 0:00:22
683500 -- (-826.844) (-825.375) (-827.454) [-824.628] * (-825.053) (-835.987) [-824.727] (-827.127) -- 0:00:22
684000 -- (-825.708) [-827.197] (-826.891) (-824.732) * [-825.902] (-833.692) (-828.008) (-826.558) -- 0:00:22
684500 -- [-827.711] (-826.796) (-824.907) (-828.683) * (-828.246) (-833.243) [-826.184] (-830.531) -- 0:00:22
685000 -- (-827.721) [-826.603] (-825.037) (-831.888) * (-828.699) (-826.407) (-825.690) [-828.541] -- 0:00:22
Average standard deviation of split frequencies: 0.007602
685500 -- (-829.471) [-823.900] (-825.477) (-825.332) * (-824.423) (-824.884) [-824.133] (-828.105) -- 0:00:22
686000 -- (-828.879) (-825.325) (-823.849) [-825.207] * (-824.529) (-827.746) (-826.690) [-825.095] -- 0:00:22
686500 -- (-831.137) (-826.369) [-824.944] (-826.118) * (-825.580) [-825.582] (-827.820) (-825.633) -- 0:00:22
687000 -- [-829.056] (-826.543) (-827.062) (-826.083) * (-825.427) (-825.114) (-824.682) [-829.236] -- 0:00:22
687500 -- (-827.460) (-825.121) [-826.223] (-826.668) * (-824.223) (-827.168) [-825.128] (-825.838) -- 0:00:22
688000 -- (-830.117) [-825.622] (-825.936) (-825.036) * [-825.795] (-826.303) (-825.990) (-824.575) -- 0:00:22
688500 -- (-825.897) (-832.059) [-825.045] (-826.742) * (-832.823) (-828.003) [-825.678] (-823.847) -- 0:00:22
689000 -- [-824.825] (-828.956) (-825.025) (-828.460) * [-828.781] (-826.565) (-824.970) (-826.741) -- 0:00:22
689500 -- [-825.708] (-825.745) (-829.692) (-828.283) * (-828.647) (-827.663) (-824.589) [-829.684] -- 0:00:22
690000 -- (-826.466) (-826.059) [-825.397] (-828.241) * (-825.189) (-825.490) (-826.619) [-827.097] -- 0:00:22
Average standard deviation of split frequencies: 0.007295
690500 -- (-828.306) [-827.701] (-825.897) (-828.823) * (-827.338) (-827.857) (-826.913) [-826.803] -- 0:00:22
691000 -- [-827.944] (-828.747) (-827.701) (-827.130) * [-826.303] (-833.408) (-826.393) (-825.255) -- 0:00:22
691500 -- [-827.436] (-827.104) (-831.607) (-824.437) * (-826.502) (-828.369) [-827.833] (-827.292) -- 0:00:22
692000 -- (-826.412) [-825.806] (-827.993) (-824.121) * (-829.036) (-826.336) [-824.258] (-827.435) -- 0:00:22
692500 -- [-828.081] (-827.189) (-827.981) (-823.799) * [-825.719] (-827.665) (-824.689) (-829.680) -- 0:00:22
693000 -- [-824.542] (-827.271) (-825.032) (-824.817) * (-826.258) (-824.814) (-825.179) [-825.427] -- 0:00:22
693500 -- (-824.994) (-824.645) (-823.709) [-825.523] * (-825.527) [-828.273] (-829.299) (-826.715) -- 0:00:22
694000 -- (-826.550) [-823.920] (-826.266) (-825.156) * (-827.187) [-825.370] (-824.603) (-825.062) -- 0:00:22
694500 -- (-830.266) [-825.107] (-828.970) (-825.831) * (-824.109) (-825.446) (-825.663) [-827.656] -- 0:00:21
695000 -- (-824.403) [-829.093] (-828.071) (-826.596) * (-824.940) (-826.134) (-832.089) [-826.540] -- 0:00:21
Average standard deviation of split frequencies: 0.007450
695500 -- [-824.243] (-824.239) (-825.156) (-825.641) * (-826.527) (-824.318) (-825.182) [-826.264] -- 0:00:21
696000 -- [-826.064] (-831.878) (-827.074) (-825.449) * [-828.979] (-825.286) (-825.956) (-831.588) -- 0:00:21
696500 -- (-824.726) (-826.276) [-826.816] (-824.680) * (-824.333) (-830.067) (-826.719) [-826.044] -- 0:00:21
697000 -- [-824.416] (-827.625) (-824.528) (-825.144) * (-827.111) (-825.060) [-830.228] (-827.122) -- 0:00:21
697500 -- (-824.505) (-828.884) (-827.895) [-824.661] * (-827.646) [-828.273] (-828.279) (-825.501) -- 0:00:21
698000 -- (-824.946) (-825.927) (-825.344) [-828.519] * (-827.912) [-825.587] (-826.600) (-826.675) -- 0:00:21
698500 -- (-828.703) [-825.615] (-829.715) (-827.940) * (-827.917) (-824.952) [-826.104] (-827.456) -- 0:00:21
699000 -- (-824.857) (-827.793) (-831.093) [-825.346] * (-824.699) [-826.714] (-827.453) (-826.370) -- 0:00:21
699500 -- (-823.914) (-825.225) (-829.973) [-827.549] * (-828.515) [-827.589] (-827.851) (-826.720) -- 0:00:21
700000 -- [-825.063] (-827.435) (-829.166) (-827.435) * (-825.816) (-827.193) [-824.665] (-826.041) -- 0:00:21
Average standard deviation of split frequencies: 0.007569
700500 -- (-825.725) [-826.811] (-827.332) (-827.729) * (-828.911) (-827.273) [-825.390] (-826.184) -- 0:00:21
701000 -- (-828.966) (-825.983) (-827.338) [-827.095] * (-826.196) [-826.857] (-824.803) (-827.585) -- 0:00:21
701500 -- (-824.499) [-826.842] (-824.718) (-826.360) * (-826.993) (-826.054) [-824.595] (-825.687) -- 0:00:21
702000 -- [-826.139] (-826.601) (-824.889) (-826.323) * (-825.504) (-824.709) [-825.678] (-825.409) -- 0:00:21
702500 -- (-828.005) (-828.638) (-826.416) [-824.820] * [-824.906] (-825.130) (-825.184) (-826.353) -- 0:00:21
703000 -- [-826.779] (-825.960) (-827.014) (-824.632) * (-824.778) [-824.207] (-824.734) (-824.405) -- 0:00:21
703500 -- (-827.501) (-828.179) [-829.978] (-826.688) * (-824.207) [-824.574] (-825.306) (-824.233) -- 0:00:21
704000 -- (-826.183) (-829.722) (-830.493) [-824.821] * [-825.622] (-828.699) (-826.015) (-826.589) -- 0:00:21
704500 -- (-824.731) (-825.265) (-826.524) [-824.562] * (-825.658) (-827.879) (-827.349) [-827.116] -- 0:00:21
705000 -- (-825.417) (-825.271) [-827.771] (-824.309) * [-824.673] (-825.275) (-825.135) (-827.683) -- 0:00:21
Average standard deviation of split frequencies: 0.007384
705500 -- (-825.419) (-829.559) [-828.482] (-825.666) * (-825.110) (-826.051) [-824.154] (-825.362) -- 0:00:21
706000 -- (-826.617) (-830.386) (-827.188) [-825.996] * [-826.752] (-828.405) (-825.562) (-824.248) -- 0:00:21
706500 -- (-826.058) [-824.926] (-825.881) (-826.524) * (-841.387) (-828.553) (-825.776) [-824.833] -- 0:00:21
707000 -- [-824.645] (-824.280) (-825.853) (-825.118) * (-831.701) [-827.240] (-826.553) (-824.753) -- 0:00:21
707500 -- (-825.721) (-824.223) [-826.406] (-830.565) * (-827.860) (-825.209) [-830.225] (-828.030) -- 0:00:21
708000 -- (-827.120) (-824.901) [-824.641] (-826.520) * (-827.817) (-828.272) (-826.033) [-830.385] -- 0:00:21
708500 -- (-825.640) [-824.866] (-827.503) (-824.568) * (-828.890) [-825.853] (-826.581) (-825.812) -- 0:00:20
709000 -- [-825.323] (-829.826) (-827.040) (-829.495) * [-825.114] (-825.996) (-830.566) (-829.523) -- 0:00:20
709500 -- (-824.715) [-826.105] (-828.123) (-825.128) * (-825.490) (-829.309) (-827.242) [-826.043] -- 0:00:20
710000 -- (-824.089) (-826.156) [-824.537] (-827.114) * (-825.472) (-824.440) (-826.503) [-825.094] -- 0:00:20
Average standard deviation of split frequencies: 0.006906
710500 -- [-823.891] (-824.827) (-824.729) (-830.593) * [-827.198] (-825.981) (-827.456) (-826.995) -- 0:00:20
711000 -- (-825.929) (-827.692) [-824.630] (-829.884) * (-829.892) (-825.441) [-829.000] (-828.466) -- 0:00:20
711500 -- (-825.616) [-829.932] (-827.736) (-829.066) * [-828.239] (-828.828) (-827.983) (-828.539) -- 0:00:20
712000 -- (-825.755) (-825.309) (-827.364) [-828.720] * (-825.804) (-825.331) [-826.206] (-828.933) -- 0:00:20
712500 -- [-828.890] (-824.568) (-825.654) (-826.907) * (-828.022) (-827.475) (-831.085) [-824.600] -- 0:00:20
713000 -- (-826.275) (-824.629) [-826.886] (-825.786) * (-825.074) (-826.881) [-828.473] (-828.089) -- 0:00:20
713500 -- (-824.156) (-825.126) [-827.220] (-828.711) * (-826.736) [-826.847] (-825.985) (-825.081) -- 0:00:20
714000 -- [-825.111] (-826.159) (-828.073) (-826.425) * (-830.048) (-824.833) (-824.560) [-825.779] -- 0:00:20
714500 -- (-824.753) (-826.499) [-824.891] (-827.717) * (-827.385) [-826.040] (-825.093) (-824.238) -- 0:00:20
715000 -- (-827.117) [-825.348] (-826.110) (-827.173) * [-824.672] (-825.635) (-831.299) (-825.069) -- 0:00:20
Average standard deviation of split frequencies: 0.007204
715500 -- (-823.902) (-826.724) (-826.640) [-826.968] * (-824.894) (-825.973) (-825.122) [-825.328] -- 0:00:20
716000 -- (-823.900) (-824.830) (-827.775) [-825.149] * [-824.368] (-826.042) (-824.271) (-824.957) -- 0:00:20
716500 -- (-823.949) [-826.676] (-826.001) (-826.374) * (-824.705) (-826.038) [-826.167] (-827.184) -- 0:00:20
717000 -- (-824.357) (-825.028) [-826.906] (-829.834) * (-827.371) [-824.901] (-824.432) (-827.354) -- 0:00:20
717500 -- (-830.260) (-826.929) (-826.718) [-826.755] * (-827.629) [-830.123] (-824.509) (-825.865) -- 0:00:20
718000 -- (-833.079) (-826.615) [-826.439] (-826.240) * (-825.957) (-832.700) [-824.630] (-825.435) -- 0:00:20
718500 -- (-827.612) (-830.434) [-829.151] (-824.513) * (-826.434) (-829.859) [-824.800] (-827.372) -- 0:00:20
719000 -- (-827.419) [-828.302] (-834.633) (-824.460) * [-824.604] (-827.373) (-833.977) (-826.315) -- 0:00:20
719500 -- (-829.318) [-825.760] (-825.537) (-824.018) * (-826.193) [-824.387] (-825.660) (-830.128) -- 0:00:20
720000 -- (-827.848) (-825.080) (-825.977) [-823.931] * [-826.531] (-828.627) (-826.401) (-827.161) -- 0:00:20
Average standard deviation of split frequencies: 0.006387
720500 -- (-828.805) (-825.663) (-825.426) [-826.315] * (-826.371) (-825.764) [-824.413] (-825.161) -- 0:00:20
721000 -- (-826.488) (-825.010) [-828.117] (-828.673) * (-829.660) (-825.367) (-824.102) [-825.128] -- 0:00:20
721500 -- (-828.926) [-833.286] (-826.018) (-828.211) * (-831.577) (-825.035) [-824.491] (-829.872) -- 0:00:20
722000 -- (-827.403) [-826.812] (-826.550) (-827.789) * (-826.963) (-826.164) [-824.781] (-824.704) -- 0:00:20
722500 -- (-829.172) (-825.218) [-826.677] (-828.090) * (-828.164) [-826.110] (-828.181) (-824.816) -- 0:00:19
723000 -- [-826.943] (-826.132) (-826.891) (-826.677) * (-827.640) (-826.543) (-825.564) [-825.464] -- 0:00:19
723500 -- (-825.860) (-825.199) [-827.634] (-825.059) * (-828.044) [-824.718] (-825.726) (-827.003) -- 0:00:19
724000 -- (-825.950) (-825.069) (-826.762) [-825.206] * (-829.518) (-826.586) (-825.019) [-827.303] -- 0:00:19
724500 -- (-829.939) (-825.103) [-826.853] (-827.143) * (-829.068) (-828.047) [-825.271] (-830.377) -- 0:00:19
725000 -- (-827.345) (-824.782) [-825.329] (-828.493) * (-829.150) (-829.793) (-825.003) [-824.827] -- 0:00:19
Average standard deviation of split frequencies: 0.006493
725500 -- (-830.304) (-824.579) [-825.264] (-827.195) * (-831.385) [-825.955] (-825.938) (-825.021) -- 0:00:19
726000 -- (-832.164) [-824.439] (-825.273) (-827.684) * (-827.892) (-825.118) [-827.942] (-824.818) -- 0:00:19
726500 -- [-825.582] (-825.929) (-825.776) (-826.289) * (-827.963) (-824.969) (-825.535) [-827.685] -- 0:00:19
727000 -- [-826.073] (-826.668) (-827.695) (-831.832) * (-824.829) (-824.479) (-826.170) [-827.731] -- 0:00:19
727500 -- [-824.441] (-825.595) (-825.196) (-826.317) * (-826.654) (-826.901) (-825.528) [-826.666] -- 0:00:19
728000 -- (-824.632) (-826.841) [-824.134] (-827.299) * [-824.972] (-826.300) (-827.424) (-825.576) -- 0:00:19
728500 -- (-827.741) [-824.516] (-829.671) (-833.353) * (-828.375) (-827.594) [-824.277] (-827.004) -- 0:00:19
729000 -- (-827.389) (-825.320) [-827.090] (-832.465) * (-828.414) (-827.304) [-824.824] (-827.035) -- 0:00:19
729500 -- (-824.883) [-824.222] (-828.757) (-825.487) * [-828.396] (-826.355) (-824.369) (-825.591) -- 0:00:19
730000 -- [-826.320] (-824.107) (-825.144) (-826.526) * (-825.768) [-825.188] (-827.599) (-825.522) -- 0:00:19
Average standard deviation of split frequencies: 0.006774
730500 -- (-823.782) (-828.922) (-826.181) [-833.461] * (-826.522) (-824.268) [-826.701] (-829.860) -- 0:00:19
731000 -- [-823.779] (-825.363) (-824.981) (-829.285) * (-824.751) [-825.023] (-826.415) (-824.230) -- 0:00:19
731500 -- (-825.030) (-828.717) [-825.268] (-830.451) * (-825.165) (-824.972) (-825.248) [-827.689] -- 0:00:19
732000 -- [-825.397] (-825.156) (-824.987) (-826.253) * (-828.922) [-824.481] (-833.128) (-824.953) -- 0:00:19
732500 -- [-825.099] (-827.665) (-826.578) (-829.647) * [-826.550] (-827.330) (-833.330) (-824.683) -- 0:00:18
733000 -- [-826.111] (-828.958) (-827.291) (-828.523) * [-824.519] (-835.591) (-827.435) (-825.216) -- 0:00:19
733500 -- (-825.760) (-830.753) (-826.206) [-825.510] * (-829.192) (-828.378) (-827.938) [-825.910] -- 0:00:19
734000 -- (-825.548) (-826.216) (-828.376) [-825.885] * [-827.529] (-824.603) (-826.916) (-826.072) -- 0:00:19
734500 -- (-823.961) (-824.625) (-824.242) [-829.890] * (-825.673) [-825.675] (-825.251) (-829.761) -- 0:00:19
735000 -- (-824.563) [-825.087] (-825.927) (-828.070) * [-825.954] (-829.975) (-826.040) (-827.264) -- 0:00:19
Average standard deviation of split frequencies: 0.006885
735500 -- (-823.790) (-825.888) [-825.668] (-827.760) * (-832.226) (-824.290) [-826.692] (-824.644) -- 0:00:19
736000 -- (-824.375) (-826.297) (-825.154) [-826.101] * (-832.161) (-826.522) (-828.177) [-827.562] -- 0:00:19
736500 -- (-830.989) [-824.753] (-825.293) (-827.550) * (-827.039) (-829.558) (-829.416) [-829.256] -- 0:00:18
737000 -- [-823.843] (-828.908) (-825.255) (-826.765) * (-823.864) (-828.262) (-828.216) [-824.785] -- 0:00:18
737500 -- [-828.974] (-829.259) (-827.937) (-826.149) * [-825.991] (-823.863) (-828.404) (-825.429) -- 0:00:18
738000 -- (-828.053) (-828.830) (-831.295) [-824.966] * (-824.396) (-823.928) (-828.143) [-824.134] -- 0:00:18
738500 -- [-824.387] (-824.224) (-830.912) (-825.566) * (-828.917) (-824.104) [-824.582] (-824.684) -- 0:00:18
739000 -- (-826.111) (-829.518) [-833.800] (-831.539) * (-825.158) [-830.088] (-826.609) (-825.546) -- 0:00:18
739500 -- [-825.563] (-830.539) (-830.053) (-826.558) * [-827.132] (-824.183) (-824.821) (-825.643) -- 0:00:18
740000 -- [-825.263] (-828.075) (-825.600) (-826.871) * (-826.074) (-824.637) [-824.632] (-826.292) -- 0:00:18
Average standard deviation of split frequencies: 0.006802
740500 -- (-828.172) (-825.934) [-824.768] (-827.181) * [-827.380] (-825.300) (-827.291) (-825.105) -- 0:00:18
741000 -- (-825.956) (-829.048) [-824.287] (-825.046) * (-825.943) (-828.780) (-826.726) [-825.425] -- 0:00:18
741500 -- [-825.801] (-827.646) (-825.906) (-826.016) * (-824.335) [-827.767] (-835.306) (-824.859) -- 0:00:18
742000 -- (-826.168) (-825.192) (-829.407) [-826.106] * (-824.347) (-828.332) [-825.557] (-826.124) -- 0:00:18
742500 -- (-826.180) [-825.372] (-828.988) (-826.164) * (-824.341) (-824.004) (-825.483) [-826.059] -- 0:00:18
743000 -- (-827.618) [-825.550] (-825.125) (-827.900) * (-825.616) [-824.005] (-825.697) (-825.608) -- 0:00:18
743500 -- (-825.962) (-826.367) [-826.840] (-826.651) * [-827.278] (-825.175) (-830.303) (-826.877) -- 0:00:18
744000 -- (-827.224) (-828.690) [-825.616] (-830.384) * (-825.406) [-827.081] (-827.392) (-824.782) -- 0:00:18
744500 -- [-824.290] (-827.435) (-824.666) (-827.645) * (-824.448) (-827.272) (-828.180) [-828.795] -- 0:00:18
745000 -- (-824.113) [-826.154] (-826.099) (-827.296) * (-827.571) [-829.477] (-826.296) (-824.779) -- 0:00:18
Average standard deviation of split frequencies: 0.006635
745500 -- (-824.853) (-825.568) [-825.298] (-826.387) * (-825.158) (-827.072) [-828.265] (-826.195) -- 0:00:18
746000 -- [-825.391] (-825.478) (-829.552) (-824.810) * (-827.824) (-830.189) [-825.390] (-828.670) -- 0:00:18
746500 -- (-824.359) [-829.339] (-826.776) (-830.496) * [-825.204] (-829.277) (-825.622) (-824.770) -- 0:00:17
747000 -- (-827.788) (-827.174) (-826.848) [-824.306] * (-825.975) (-831.823) [-826.680] (-824.695) -- 0:00:18
747500 -- (-825.787) [-827.276] (-826.329) (-825.190) * (-826.772) [-826.007] (-827.979) (-825.042) -- 0:00:18
748000 -- (-829.562) [-826.040] (-827.108) (-827.431) * (-825.894) (-824.360) [-824.528] (-825.218) -- 0:00:18
748500 -- [-824.826] (-829.009) (-829.497) (-825.671) * (-826.283) (-825.362) (-827.037) [-828.206] -- 0:00:18
749000 -- (-825.487) (-825.512) (-826.532) [-825.717] * [-825.147] (-824.712) (-824.824) (-824.278) -- 0:00:18
749500 -- [-824.533] (-825.588) (-828.038) (-828.798) * (-825.437) (-828.264) [-825.618] (-824.578) -- 0:00:18
750000 -- (-827.489) [-824.542] (-825.003) (-824.495) * (-827.058) (-831.998) [-824.349] (-826.907) -- 0:00:18
Average standard deviation of split frequencies: 0.006476
750500 -- (-826.198) (-830.238) (-824.632) [-826.717] * (-826.978) (-825.282) [-824.315] (-825.773) -- 0:00:17
751000 -- (-826.606) (-830.358) [-825.624] (-827.281) * [-828.610] (-827.778) (-824.869) (-826.907) -- 0:00:17
751500 -- (-827.625) (-826.259) (-826.746) [-830.446] * (-826.797) (-828.472) [-824.145] (-829.551) -- 0:00:17
752000 -- (-826.033) [-827.981] (-826.861) (-826.409) * (-826.683) (-828.959) (-826.448) [-829.301] -- 0:00:17
752500 -- (-826.871) [-824.810] (-823.905) (-826.187) * (-824.494) (-827.370) (-826.606) [-823.785] -- 0:00:17
753000 -- (-825.061) (-825.399) (-824.227) [-825.848] * (-828.996) (-825.560) [-825.581] (-825.969) -- 0:00:17
753500 -- (-825.090) (-829.094) [-824.226] (-826.186) * (-824.575) (-827.005) [-825.027] (-824.782) -- 0:00:17
754000 -- (-829.969) [-825.350] (-825.404) (-826.526) * [-824.781] (-823.974) (-831.144) (-824.933) -- 0:00:17
754500 -- [-826.498] (-824.185) (-826.412) (-831.451) * (-824.684) [-825.166] (-830.831) (-827.003) -- 0:00:17
755000 -- (-825.141) [-824.126] (-826.817) (-828.551) * (-825.958) (-826.312) (-827.793) [-824.847] -- 0:00:17
Average standard deviation of split frequencies: 0.006664
755500 -- [-826.384] (-826.376) (-825.295) (-827.133) * (-830.529) (-824.431) (-825.026) [-824.351] -- 0:00:17
756000 -- [-827.076] (-826.775) (-826.718) (-829.720) * (-826.182) [-824.641] (-823.869) (-825.142) -- 0:00:17
756500 -- (-824.987) (-824.682) (-825.258) [-828.068] * (-825.679) (-830.153) (-824.438) [-825.339] -- 0:00:17
757000 -- (-826.894) (-826.431) (-826.383) [-826.089] * (-827.942) (-828.614) (-826.925) [-824.892] -- 0:00:17
757500 -- [-827.591] (-830.472) (-826.902) (-826.391) * (-830.333) (-830.718) (-827.864) [-827.304] -- 0:00:17
758000 -- [-825.171] (-827.672) (-826.481) (-825.050) * (-826.535) (-826.046) [-826.455] (-825.761) -- 0:00:17
758500 -- [-825.643] (-827.255) (-826.476) (-824.361) * (-826.584) [-828.129] (-825.565) (-825.695) -- 0:00:17
759000 -- (-828.097) (-827.155) [-830.996] (-824.844) * (-829.533) (-827.004) [-824.705] (-825.348) -- 0:00:17
759500 -- (-826.285) (-825.396) (-825.953) [-825.007] * (-827.793) (-827.263) [-825.219] (-828.781) -- 0:00:17
760000 -- [-825.437] (-825.168) (-826.450) (-825.214) * (-826.460) (-825.747) (-828.040) [-827.654] -- 0:00:17
Average standard deviation of split frequencies: 0.006391
760500 -- [-829.841] (-828.552) (-825.982) (-825.169) * [-824.348] (-827.459) (-827.326) (-825.745) -- 0:00:17
761000 -- (-827.412) (-824.797) [-824.495] (-830.043) * (-830.060) [-824.211] (-824.856) (-828.140) -- 0:00:16
761500 -- [-824.196] (-827.199) (-827.094) (-827.337) * [-826.503] (-824.522) (-824.354) (-827.251) -- 0:00:17
762000 -- (-825.656) [-830.539] (-825.558) (-826.802) * (-827.835) (-826.347) [-825.362] (-827.525) -- 0:00:17
762500 -- (-826.819) (-825.258) (-825.654) [-826.077] * [-826.347] (-826.222) (-824.821) (-827.928) -- 0:00:17
763000 -- (-824.728) [-824.355] (-824.199) (-824.889) * (-827.430) [-825.311] (-827.314) (-830.752) -- 0:00:17
763500 -- [-825.681] (-829.285) (-824.425) (-825.150) * (-827.390) (-825.145) [-826.019] (-828.070) -- 0:00:17
764000 -- (-827.013) (-827.412) (-825.672) [-826.731] * [-831.478] (-831.231) (-830.404) (-826.721) -- 0:00:16
764500 -- (-828.623) (-825.342) (-826.185) [-824.612] * (-826.712) (-827.228) [-825.991] (-825.251) -- 0:00:16
765000 -- (-827.943) (-826.468) (-831.568) [-825.646] * [-827.250] (-828.576) (-825.434) (-825.332) -- 0:00:16
Average standard deviation of split frequencies: 0.006577
765500 -- [-827.281] (-828.148) (-829.149) (-827.077) * (-825.250) (-824.293) [-828.414] (-827.701) -- 0:00:16
766000 -- [-825.763] (-825.815) (-825.428) (-829.312) * (-826.592) (-828.746) (-826.343) [-826.348] -- 0:00:16
766500 -- (-824.913) (-826.751) [-824.400] (-826.986) * [-827.854] (-825.749) (-826.924) (-826.063) -- 0:00:16
767000 -- [-825.690] (-826.849) (-829.454) (-824.998) * [-824.395] (-824.984) (-827.036) (-825.205) -- 0:00:16
767500 -- (-825.305) (-825.075) (-826.666) [-828.471] * (-824.261) [-829.049] (-827.944) (-828.549) -- 0:00:16
768000 -- (-824.538) [-825.369] (-826.517) (-826.995) * (-824.471) (-829.589) (-825.619) [-825.116] -- 0:00:16
768500 -- (-830.063) [-826.792] (-828.179) (-827.564) * (-824.125) (-825.056) (-825.451) [-825.909] -- 0:00:16
769000 -- (-826.829) [-827.194] (-825.201) (-826.487) * [-825.472] (-825.033) (-825.639) (-825.818) -- 0:00:16
769500 -- (-827.933) (-827.101) (-827.861) [-827.972] * (-824.372) [-825.898] (-830.209) (-828.233) -- 0:00:16
770000 -- (-825.858) [-828.203] (-825.722) (-827.081) * [-825.819] (-825.049) (-831.128) (-827.297) -- 0:00:16
Average standard deviation of split frequencies: 0.006423
770500 -- [-826.446] (-824.502) (-825.696) (-827.810) * (-831.241) (-827.442) (-824.792) [-827.598] -- 0:00:16
771000 -- (-827.962) (-827.796) [-828.070] (-832.373) * (-826.267) (-826.898) [-826.560] (-824.625) -- 0:00:16
771500 -- (-827.463) (-826.741) (-828.084) [-826.851] * [-824.333] (-830.091) (-826.155) (-824.148) -- 0:00:16
772000 -- (-825.140) [-826.164] (-830.531) (-824.247) * (-825.247) (-828.141) [-824.620] (-824.518) -- 0:00:16
772500 -- (-828.903) (-824.892) [-826.706] (-826.962) * (-826.454) [-825.833] (-825.180) (-825.374) -- 0:00:16
773000 -- (-828.555) [-825.200] (-828.437) (-824.957) * [-825.927] (-827.831) (-827.184) (-826.044) -- 0:00:16
773500 -- (-826.891) (-825.132) [-825.224] (-824.922) * (-828.183) (-828.217) (-825.853) [-826.108] -- 0:00:16
774000 -- (-826.854) (-830.673) [-827.357] (-824.324) * [-826.145] (-827.077) (-827.652) (-826.718) -- 0:00:16
774500 -- [-825.743] (-824.980) (-827.409) (-824.652) * (-825.126) (-825.182) (-825.706) [-827.903] -- 0:00:16
775000 -- (-825.847) [-824.227] (-829.586) (-824.430) * (-825.918) (-826.918) (-827.341) [-824.401] -- 0:00:15
Average standard deviation of split frequencies: 0.006303
775500 -- [-825.634] (-824.227) (-825.784) (-824.413) * [-825.839] (-826.422) (-827.203) (-824.431) -- 0:00:16
776000 -- (-827.216) [-824.572] (-826.411) (-825.804) * (-827.341) (-825.509) (-825.170) [-824.610] -- 0:00:16
776500 -- [-824.377] (-824.796) (-824.988) (-824.960) * (-825.094) [-824.987] (-827.448) (-827.224) -- 0:00:16
777000 -- (-826.264) (-825.079) [-825.585] (-825.601) * (-826.249) (-824.358) (-826.244) [-825.709] -- 0:00:16
777500 -- (-826.669) (-825.261) (-824.276) [-827.738] * [-826.362] (-826.035) (-823.930) (-829.173) -- 0:00:16
778000 -- (-826.888) (-826.829) [-825.798] (-825.768) * (-828.473) (-828.044) (-824.187) [-829.045] -- 0:00:15
778500 -- (-826.124) (-831.034) (-825.059) [-825.237] * (-827.190) [-830.337] (-825.526) (-828.460) -- 0:00:15
779000 -- [-825.482] (-824.261) (-829.919) (-825.023) * (-826.412) (-827.197) [-826.024] (-825.879) -- 0:00:15
779500 -- [-827.784] (-824.822) (-826.291) (-826.029) * (-824.336) (-824.478) [-824.646] (-826.381) -- 0:00:15
780000 -- (-827.997) [-827.102] (-825.773) (-824.106) * [-825.114] (-827.920) (-824.622) (-826.798) -- 0:00:15
Average standard deviation of split frequencies: 0.005359
780500 -- (-825.713) [-825.527] (-827.270) (-824.965) * [-824.894] (-827.024) (-826.252) (-825.689) -- 0:00:15
781000 -- [-824.358] (-824.971) (-829.804) (-824.729) * (-825.070) [-824.696] (-824.966) (-825.823) -- 0:00:15
781500 -- (-824.624) (-824.697) (-827.667) [-825.268] * [-825.089] (-826.548) (-826.036) (-824.928) -- 0:00:15
782000 -- [-828.027] (-827.337) (-825.904) (-824.571) * (-824.304) [-825.912] (-825.238) (-825.534) -- 0:00:15
782500 -- (-825.377) (-825.577) [-826.404] (-825.909) * (-827.422) (-826.366) (-825.349) [-825.895] -- 0:00:15
783000 -- (-826.994) [-824.821] (-828.233) (-824.947) * (-824.688) (-828.061) (-827.949) [-824.652] -- 0:00:15
783500 -- [-824.913] (-827.907) (-827.574) (-825.413) * (-825.815) (-826.815) [-824.492] (-824.945) -- 0:00:15
784000 -- [-824.114] (-828.034) (-825.820) (-826.065) * (-827.281) (-827.592) (-824.431) [-825.258] -- 0:00:15
784500 -- (-825.850) (-827.332) [-828.019] (-826.144) * (-824.784) (-825.061) [-825.009] (-825.845) -- 0:00:15
785000 -- (-830.914) (-828.136) (-825.671) [-826.421] * (-824.434) (-827.305) (-826.221) [-829.439] -- 0:00:15
Average standard deviation of split frequencies: 0.005473
785500 -- (-826.076) (-825.718) (-825.273) [-826.837] * (-825.621) (-826.380) (-829.280) [-826.159] -- 0:00:15
786000 -- (-828.498) [-826.226] (-825.234) (-826.405) * (-824.923) [-825.018] (-831.048) (-826.353) -- 0:00:15
786500 -- [-826.491] (-825.731) (-827.375) (-825.805) * [-826.990] (-824.447) (-824.821) (-825.735) -- 0:00:15
787000 -- (-829.753) (-827.716) (-824.412) [-827.307] * [-824.257] (-826.279) (-826.443) (-829.406) -- 0:00:15
787500 -- (-825.580) (-824.435) [-825.428] (-827.153) * (-826.565) (-825.644) [-827.207] (-827.124) -- 0:00:15
788000 -- (-826.262) (-824.426) (-826.420) [-824.469] * (-829.096) (-825.906) [-828.276] (-824.950) -- 0:00:15
788500 -- [-827.429] (-826.716) (-824.649) (-824.387) * (-828.370) (-825.092) [-827.660] (-826.809) -- 0:00:15
789000 -- (-826.543) (-827.182) [-831.670] (-824.862) * (-826.446) (-825.228) [-824.270] (-833.740) -- 0:00:14
789500 -- (-828.902) (-828.090) (-825.339) [-827.106] * (-825.186) (-828.860) (-825.498) [-829.284] -- 0:00:14
790000 -- (-824.044) [-827.556] (-827.018) (-827.344) * (-824.354) (-825.376) (-833.250) [-829.181] -- 0:00:15
Average standard deviation of split frequencies: 0.005291
790500 -- [-825.648] (-824.048) (-828.445) (-824.786) * (-826.756) (-825.096) (-824.553) [-826.803] -- 0:00:15
791000 -- (-825.483) (-824.444) [-827.973] (-824.366) * (-827.727) [-825.418] (-825.699) (-826.106) -- 0:00:15
791500 -- (-825.510) (-830.291) [-827.998] (-828.193) * (-827.822) (-826.897) (-825.446) [-827.183] -- 0:00:15
792000 -- [-830.091] (-829.376) (-825.172) (-830.664) * (-830.009) (-828.064) (-826.181) [-827.137] -- 0:00:14
792500 -- [-826.625] (-826.400) (-826.560) (-831.732) * (-827.647) (-826.553) (-827.536) [-826.794] -- 0:00:14
793000 -- (-826.367) [-826.206] (-825.153) (-827.198) * (-825.424) (-826.899) [-826.916] (-826.838) -- 0:00:14
793500 -- (-825.061) (-828.422) [-825.276] (-827.387) * (-826.696) (-825.947) [-827.508] (-824.874) -- 0:00:14
794000 -- (-825.085) (-830.817) [-826.402] (-825.710) * (-825.964) (-830.378) [-825.198] (-825.996) -- 0:00:14
794500 -- (-826.938) [-823.726] (-831.462) (-828.182) * (-824.555) (-826.736) [-825.172] (-825.670) -- 0:00:14
795000 -- (-826.136) [-824.492] (-827.780) (-825.251) * [-824.354] (-825.365) (-825.806) (-824.639) -- 0:00:14
Average standard deviation of split frequencies: 0.005293
795500 -- (-826.444) (-831.908) (-827.036) [-825.041] * [-826.506] (-826.226) (-824.512) (-824.266) -- 0:00:14
796000 -- [-827.081] (-828.209) (-827.023) (-827.133) * [-828.362] (-825.829) (-825.178) (-824.791) -- 0:00:14
796500 -- [-825.430] (-825.174) (-826.470) (-824.521) * (-827.702) (-826.860) [-827.895] (-825.074) -- 0:00:14
797000 -- (-825.431) [-828.852] (-831.614) (-826.053) * [-825.100] (-828.288) (-827.062) (-825.110) -- 0:00:14
797500 -- [-825.818] (-828.527) (-829.589) (-825.273) * [-824.409] (-827.910) (-829.593) (-826.464) -- 0:00:14
798000 -- (-826.729) [-826.436] (-829.598) (-828.264) * (-824.328) (-825.655) (-830.012) [-825.443] -- 0:00:14
798500 -- (-826.677) [-824.789] (-826.459) (-825.655) * (-824.254) (-827.557) (-825.701) [-825.872] -- 0:00:14
799000 -- [-824.500] (-824.412) (-824.558) (-826.052) * [-828.145] (-826.336) (-826.526) (-824.980) -- 0:00:14
799500 -- (-824.735) (-825.193) [-832.362] (-824.489) * (-825.497) (-825.906) [-826.913] (-829.021) -- 0:00:14
800000 -- (-824.825) (-825.179) [-824.437] (-828.908) * (-827.092) [-824.503] (-828.111) (-828.773) -- 0:00:14
Average standard deviation of split frequencies: 0.005495
800500 -- (-825.315) (-826.979) (-825.888) [-825.059] * (-827.500) (-826.053) (-825.100) [-828.046] -- 0:00:14
801000 -- (-824.658) (-824.983) [-826.583] (-826.685) * [-825.547] (-825.377) (-826.055) (-826.815) -- 0:00:14
801500 -- (-824.973) (-825.303) (-828.678) [-824.358] * (-825.113) (-825.541) [-825.451] (-828.734) -- 0:00:14
802000 -- [-824.317] (-824.583) (-829.218) (-828.213) * [-825.059] (-829.465) (-824.736) (-829.267) -- 0:00:14
802500 -- (-825.155) (-823.951) [-827.440] (-830.052) * (-827.141) [-826.157] (-824.273) (-826.108) -- 0:00:14
803000 -- (-824.001) (-825.087) [-826.578] (-833.775) * (-826.391) [-826.874] (-830.175) (-824.996) -- 0:00:13
803500 -- (-827.188) (-825.905) (-829.620) [-827.022] * (-828.687) (-824.343) [-827.476] (-828.693) -- 0:00:13
804000 -- (-826.477) (-826.607) (-825.952) [-824.425] * [-825.528] (-826.725) (-825.672) (-825.530) -- 0:00:13
804500 -- (-824.142) [-826.104] (-826.421) (-823.890) * (-824.548) [-826.880] (-825.108) (-829.392) -- 0:00:14
805000 -- (-824.156) [-826.070] (-836.166) (-828.250) * [-825.410] (-825.223) (-824.877) (-825.060) -- 0:00:14
Average standard deviation of split frequencies: 0.005498
805500 -- (-828.785) (-824.276) (-827.650) [-826.987] * (-827.955) [-826.195] (-825.202) (-828.873) -- 0:00:14
806000 -- (-829.035) (-826.325) [-828.195] (-824.775) * [-825.214] (-824.163) (-824.832) (-827.575) -- 0:00:13
806500 -- (-825.857) [-825.232] (-824.580) (-824.401) * (-824.746) (-828.159) [-824.696] (-825.775) -- 0:00:13
807000 -- (-825.435) (-826.815) (-826.066) [-824.681] * [-824.956] (-826.047) (-824.301) (-828.847) -- 0:00:13
807500 -- [-823.869] (-827.508) (-825.345) (-826.173) * (-828.461) [-824.551] (-824.956) (-825.038) -- 0:00:13
808000 -- [-824.921] (-827.020) (-825.343) (-826.573) * [-826.949] (-833.906) (-825.332) (-824.992) -- 0:00:13
808500 -- (-825.304) (-826.021) [-824.449] (-826.184) * (-826.341) (-830.388) (-826.533) [-825.001] -- 0:00:13
809000 -- (-825.002) (-831.385) (-825.670) [-828.190] * [-826.192] (-826.572) (-824.969) (-827.381) -- 0:00:13
809500 -- (-824.028) (-827.142) (-826.420) [-824.217] * [-827.644] (-826.781) (-825.136) (-826.990) -- 0:00:13
810000 -- (-824.307) (-827.462) [-826.805] (-824.486) * (-826.198) (-830.469) (-826.792) [-827.289] -- 0:00:13
Average standard deviation of split frequencies: 0.005621
810500 -- (-825.096) [-829.398] (-833.472) (-829.070) * (-826.560) (-828.273) [-827.673] (-830.655) -- 0:00:13
811000 -- (-824.519) (-824.375) [-826.642] (-824.858) * (-828.034) [-824.921] (-830.325) (-827.881) -- 0:00:13
811500 -- [-825.430] (-827.784) (-826.363) (-825.388) * (-826.314) [-827.144] (-826.569) (-827.885) -- 0:00:13
812000 -- (-826.460) [-825.577] (-827.781) (-824.107) * (-827.168) (-830.126) [-825.441] (-824.227) -- 0:00:13
812500 -- (-824.602) (-825.513) [-824.778] (-826.391) * (-827.133) [-829.500] (-829.151) (-825.399) -- 0:00:13
813000 -- (-824.747) (-825.427) (-825.382) [-825.977] * (-826.674) (-827.993) [-825.027] (-824.370) -- 0:00:13
813500 -- [-827.818] (-824.026) (-825.249) (-830.284) * (-824.866) (-826.986) (-825.129) [-826.819] -- 0:00:13
814000 -- [-824.318] (-825.230) (-828.677) (-827.457) * (-823.982) (-825.420) [-824.294] (-825.956) -- 0:00:13
814500 -- (-826.495) (-829.335) (-825.782) [-824.977] * (-825.731) (-825.405) [-827.953] (-829.938) -- 0:00:13
815000 -- (-825.798) (-826.227) [-824.150] (-827.627) * (-827.177) (-826.356) [-824.870] (-831.199) -- 0:00:13
Average standard deviation of split frequencies: 0.005353
815500 -- (-825.218) (-825.491) [-826.173] (-829.268) * (-824.665) (-828.685) [-824.342] (-826.034) -- 0:00:13
816000 -- (-825.075) (-827.268) [-829.952] (-830.491) * (-824.264) (-829.231) (-825.812) [-826.009] -- 0:00:13
816500 -- (-825.648) [-825.515] (-825.577) (-827.828) * (-827.093) (-824.699) [-832.130] (-825.158) -- 0:00:13
817000 -- [-830.424] (-826.496) (-826.142) (-827.077) * (-827.158) (-826.926) [-828.137] (-824.953) -- 0:00:12
817500 -- (-824.876) [-825.940] (-825.988) (-825.677) * [-827.471] (-827.960) (-827.109) (-827.601) -- 0:00:12
818000 -- (-827.393) [-826.850] (-826.897) (-826.334) * (-825.353) [-825.586] (-830.088) (-825.589) -- 0:00:12
818500 -- (-826.944) (-826.130) (-827.673) [-825.853] * (-826.216) [-825.761] (-828.461) (-825.557) -- 0:00:13
819000 -- (-826.229) (-830.666) [-825.204] (-827.420) * (-825.202) (-829.385) [-827.341] (-826.371) -- 0:00:13
819500 -- (-826.571) [-825.947] (-826.275) (-824.260) * (-829.318) (-828.867) [-829.151] (-826.556) -- 0:00:12
820000 -- [-831.684] (-825.924) (-826.281) (-827.656) * (-829.387) [-830.213] (-828.392) (-825.371) -- 0:00:12
Average standard deviation of split frequencies: 0.005246
820500 -- (-825.839) (-824.455) [-825.816] (-825.556) * (-828.968) (-829.948) (-825.899) [-825.092] -- 0:00:12
821000 -- (-825.657) [-826.826] (-827.829) (-827.244) * (-825.967) [-827.341] (-826.113) (-829.192) -- 0:00:12
821500 -- [-826.196] (-826.785) (-826.570) (-829.435) * [-825.203] (-826.872) (-826.140) (-826.058) -- 0:00:12
822000 -- [-825.278] (-826.356) (-826.159) (-825.707) * (-829.387) (-826.061) (-824.908) [-824.856] -- 0:00:12
822500 -- (-825.369) (-827.065) (-830.263) [-827.444] * (-830.495) (-825.076) [-826.177] (-826.248) -- 0:00:12
823000 -- [-825.267] (-824.515) (-825.696) (-826.938) * (-830.674) (-825.895) (-826.343) [-824.890] -- 0:00:12
823500 -- (-827.720) [-826.397] (-824.479) (-828.796) * (-824.695) (-825.214) (-825.804) [-824.893] -- 0:00:12
824000 -- [-825.044] (-823.958) (-828.293) (-827.200) * (-825.319) (-826.431) [-827.027] (-827.317) -- 0:00:12
824500 -- (-826.702) (-825.909) (-827.604) [-827.458] * (-824.651) (-829.213) [-827.146] (-826.555) -- 0:00:12
825000 -- [-824.415] (-826.275) (-825.313) (-826.244) * (-826.500) (-825.647) (-827.112) [-826.287] -- 0:00:12
Average standard deviation of split frequencies: 0.005136
825500 -- (-826.582) (-826.757) [-825.201] (-826.611) * (-829.234) [-824.314] (-825.754) (-828.990) -- 0:00:12
826000 -- (-825.651) (-826.444) [-829.662] (-824.690) * (-825.024) [-831.513] (-824.763) (-828.437) -- 0:00:12
826500 -- [-824.873] (-825.367) (-830.454) (-825.172) * (-826.450) [-825.401] (-827.024) (-826.071) -- 0:00:12
827000 -- [-827.202] (-827.783) (-826.114) (-826.687) * (-825.722) (-827.500) (-826.039) [-825.978] -- 0:00:12
827500 -- (-824.175) (-829.788) (-824.730) [-825.692] * (-833.414) (-831.578) (-826.625) [-825.802] -- 0:00:12
828000 -- [-824.512] (-827.030) (-824.654) (-823.956) * [-826.574] (-826.393) (-825.575) (-829.902) -- 0:00:12
828500 -- (-825.603) (-825.890) [-826.694] (-824.855) * (-824.583) (-827.134) [-825.985] (-824.674) -- 0:00:12
829000 -- (-824.122) (-825.431) (-826.978) [-826.027] * [-825.255] (-824.504) (-826.669) (-825.073) -- 0:00:12
829500 -- (-824.830) [-824.869] (-826.503) (-827.139) * (-826.723) [-824.582] (-825.550) (-824.853) -- 0:00:12
830000 -- (-827.221) (-827.043) (-825.630) [-824.269] * (-825.059) (-828.178) [-824.584] (-825.491) -- 0:00:12
Average standard deviation of split frequencies: 0.005037
830500 -- (-825.225) (-827.340) (-835.370) [-825.351] * [-827.505] (-830.663) (-825.426) (-827.750) -- 0:00:12
831000 -- (-825.415) [-825.272] (-825.772) (-826.437) * (-826.614) [-828.802] (-825.118) (-826.263) -- 0:00:11
831500 -- (-824.777) (-825.566) [-824.284] (-826.519) * (-825.854) (-825.268) [-827.616] (-828.468) -- 0:00:11
832000 -- (-825.771) (-825.189) [-825.113] (-829.140) * (-825.861) (-824.610) [-824.637] (-824.840) -- 0:00:11
832500 -- (-826.244) [-826.097] (-826.388) (-829.484) * [-824.290] (-826.203) (-827.264) (-825.185) -- 0:00:11
833000 -- [-827.883] (-827.659) (-826.178) (-826.901) * [-827.396] (-825.553) (-825.422) (-824.584) -- 0:00:12
833500 -- (-825.388) (-824.775) (-825.263) [-825.009] * (-829.399) [-824.931] (-826.508) (-824.868) -- 0:00:11
834000 -- (-828.275) (-824.779) (-826.331) [-825.137] * (-823.711) (-825.523) (-828.025) [-828.869] -- 0:00:11
834500 -- (-828.319) (-825.929) [-825.154] (-827.074) * (-825.552) [-825.934] (-830.810) (-828.855) -- 0:00:11
835000 -- (-826.773) [-825.464] (-829.354) (-828.134) * (-826.216) (-832.025) [-824.574] (-824.406) -- 0:00:11
Average standard deviation of split frequencies: 0.004934
835500 -- (-825.833) [-824.810] (-827.336) (-830.021) * (-825.161) (-825.947) [-826.887] (-823.844) -- 0:00:11
836000 -- (-827.919) (-824.541) (-830.239) [-826.369] * (-826.223) (-824.742) (-827.315) [-827.488] -- 0:00:11
836500 -- (-825.808) (-828.168) [-829.736] (-828.180) * [-827.970] (-823.975) (-827.302) (-829.439) -- 0:00:11
837000 -- [-824.093] (-826.257) (-827.688) (-824.345) * (-825.207) (-827.083) (-826.417) [-832.191] -- 0:00:11
837500 -- (-829.240) (-825.972) [-825.908] (-825.559) * [-827.062] (-827.075) (-825.882) (-827.729) -- 0:00:11
838000 -- [-827.639] (-825.451) (-826.428) (-825.558) * (-826.534) [-825.401] (-826.061) (-825.165) -- 0:00:11
838500 -- (-824.127) (-832.895) [-825.142] (-826.877) * [-827.073] (-825.577) (-829.226) (-825.587) -- 0:00:11
839000 -- (-825.569) (-827.078) (-826.599) [-826.366] * (-825.987) [-824.423] (-827.004) (-824.612) -- 0:00:11
839500 -- (-824.477) (-825.355) [-824.866] (-830.505) * (-826.110) (-825.961) (-829.188) [-824.278] -- 0:00:11
840000 -- (-827.130) [-825.160] (-828.221) (-829.792) * (-825.833) [-825.551] (-828.305) (-826.638) -- 0:00:11
Average standard deviation of split frequencies: 0.005159
840500 -- (-825.563) (-825.017) [-825.569] (-828.720) * (-830.581) (-831.063) [-825.471] (-826.126) -- 0:00:11
841000 -- (-825.055) [-825.320] (-824.147) (-829.476) * (-831.069) [-825.827] (-824.468) (-827.111) -- 0:00:11
841500 -- [-824.128] (-827.294) (-825.070) (-828.010) * (-824.452) (-827.678) (-827.792) [-828.032] -- 0:00:11
842000 -- (-827.485) (-826.214) [-826.282] (-826.418) * (-825.597) (-828.541) (-824.910) [-826.658] -- 0:00:11
842500 -- (-825.212) (-824.381) (-827.082) [-825.362] * (-825.155) (-829.401) [-824.596] (-827.163) -- 0:00:11
843000 -- [-824.546] (-826.378) (-827.182) (-824.525) * [-826.008] (-824.382) (-824.395) (-826.640) -- 0:00:11
843500 -- [-825.238] (-825.930) (-832.340) (-824.196) * (-826.411) (-826.285) (-827.279) [-826.240] -- 0:00:11
844000 -- (-826.914) (-824.967) (-831.718) [-824.831] * (-829.710) (-827.576) [-824.576] (-824.305) -- 0:00:11
844500 -- (-824.985) (-824.813) [-827.453] (-827.328) * (-825.286) (-827.148) [-825.646] (-825.904) -- 0:00:11
845000 -- [-826.053] (-828.860) (-828.153) (-826.029) * (-826.901) (-825.513) (-826.103) [-825.253] -- 0:00:11
Average standard deviation of split frequencies: 0.005189
845500 -- (-825.239) (-828.390) [-830.212] (-825.104) * (-827.340) (-826.794) (-829.875) [-825.031] -- 0:00:10
846000 -- [-824.874] (-825.722) (-829.817) (-827.397) * (-825.447) [-825.250] (-826.669) (-825.244) -- 0:00:10
846500 -- (-825.006) (-827.981) [-825.395] (-824.466) * (-829.079) (-825.268) [-826.008] (-825.850) -- 0:00:10
847000 -- (-828.964) (-827.620) (-826.232) [-824.466] * (-825.511) (-825.782) [-825.414] (-826.248) -- 0:00:10
847500 -- (-830.587) (-828.179) [-824.213] (-824.212) * [-826.844] (-826.260) (-826.885) (-825.538) -- 0:00:10
848000 -- (-826.161) [-826.735] (-826.397) (-825.553) * (-826.856) [-825.461] (-825.203) (-827.545) -- 0:00:10
848500 -- (-825.209) [-824.356] (-828.520) (-826.685) * [-826.863] (-825.654) (-825.011) (-827.144) -- 0:00:10
849000 -- [-825.812] (-826.948) (-826.766) (-823.759) * [-824.331] (-826.142) (-824.977) (-824.079) -- 0:00:10
849500 -- (-825.802) (-827.015) [-824.679] (-825.197) * (-824.613) (-827.558) (-826.632) [-824.504] -- 0:00:10
850000 -- (-826.914) (-830.595) (-825.656) [-827.839] * (-825.571) (-826.239) [-825.725] (-825.290) -- 0:00:10
Average standard deviation of split frequencies: 0.005265
850500 -- (-828.078) [-825.809] (-826.606) (-825.909) * (-825.908) (-826.685) [-824.958] (-826.576) -- 0:00:10
851000 -- (-824.780) (-824.849) [-826.756] (-828.061) * (-826.794) (-826.804) (-827.349) [-824.963] -- 0:00:10
851500 -- (-829.566) (-825.005) [-824.084] (-825.278) * (-828.600) (-828.420) (-829.974) [-824.865] -- 0:00:10
852000 -- (-824.029) (-825.168) [-825.188] (-826.023) * [-826.625] (-829.101) (-827.981) (-825.109) -- 0:00:10
852500 -- [-826.926] (-825.386) (-824.878) (-825.436) * (-825.855) (-825.575) (-833.029) [-828.486] -- 0:00:10
853000 -- (-826.130) (-828.749) (-826.102) [-826.894] * (-828.054) (-832.622) [-830.897] (-824.642) -- 0:00:10
853500 -- (-824.805) (-827.739) (-827.766) [-825.243] * (-831.074) (-827.853) [-833.160] (-825.858) -- 0:00:10
854000 -- [-825.705] (-826.551) (-826.703) (-832.297) * [-826.500] (-827.800) (-833.365) (-825.771) -- 0:00:10
854500 -- [-825.244] (-827.768) (-826.179) (-826.828) * (-825.974) [-827.453] (-825.612) (-825.083) -- 0:00:10
855000 -- (-826.273) [-824.485] (-825.668) (-828.116) * (-826.756) (-825.027) (-825.607) [-824.173] -- 0:00:10
Average standard deviation of split frequencies: 0.004853
855500 -- (-831.144) (-826.838) [-825.146] (-826.220) * (-828.350) (-824.626) [-825.166] (-825.236) -- 0:00:10
856000 -- [-830.205] (-828.497) (-825.188) (-827.174) * (-828.472) (-824.948) (-824.939) [-826.886] -- 0:00:10
856500 -- (-828.315) [-824.950] (-824.020) (-827.901) * (-830.471) (-825.591) [-825.327] (-826.063) -- 0:00:10
857000 -- (-826.173) [-824.931] (-824.933) (-830.988) * (-828.671) (-825.495) (-825.372) [-825.269] -- 0:00:10
857500 -- (-824.076) (-826.515) [-825.474] (-827.019) * (-824.626) [-824.694] (-824.419) (-826.504) -- 0:00:10
858000 -- [-825.187] (-826.026) (-826.390) (-830.454) * (-827.201) (-824.530) (-825.425) [-826.591] -- 0:00:10
858500 -- (-824.613) (-825.326) [-824.574] (-825.108) * (-827.290) [-825.151] (-825.487) (-826.477) -- 0:00:10
859000 -- (-826.174) (-824.584) (-825.238) [-825.203] * (-826.546) (-827.114) (-824.529) [-825.445] -- 0:00:10
859500 -- (-825.385) (-826.877) (-826.624) [-824.686] * (-824.580) (-824.934) [-825.380] (-823.830) -- 0:00:09
860000 -- (-826.066) [-824.109] (-826.768) (-824.196) * (-824.868) (-825.193) [-826.338] (-828.239) -- 0:00:09
Average standard deviation of split frequencies: 0.004929
860500 -- [-826.630] (-823.805) (-825.963) (-824.661) * [-825.204] (-824.425) (-826.622) (-829.125) -- 0:00:09
861000 -- [-825.882] (-824.772) (-827.334) (-824.253) * (-828.325) [-824.320] (-826.780) (-826.169) -- 0:00:09
861500 -- (-826.943) (-824.918) [-827.920] (-827.612) * (-826.366) (-824.690) [-824.526] (-828.461) -- 0:00:09
862000 -- [-826.182] (-825.456) (-827.282) (-832.741) * (-824.786) (-824.253) [-824.036] (-828.276) -- 0:00:09
862500 -- (-826.174) [-827.083] (-827.020) (-826.476) * [-828.700] (-827.020) (-829.749) (-826.593) -- 0:00:09
863000 -- (-825.852) (-824.281) (-824.013) [-825.360] * (-828.318) [-826.252] (-824.592) (-825.114) -- 0:00:09
863500 -- (-826.803) [-824.184] (-824.331) (-826.967) * (-827.330) (-827.411) [-825.842] (-825.381) -- 0:00:09
864000 -- (-825.723) (-824.346) [-824.636] (-824.986) * (-827.974) (-825.614) (-828.780) [-825.675] -- 0:00:09
864500 -- (-825.107) (-824.391) (-825.467) [-824.047] * [-826.733] (-826.638) (-827.567) (-826.230) -- 0:00:09
865000 -- (-824.072) (-825.081) (-827.798) [-824.275] * [-827.851] (-827.676) (-826.509) (-824.735) -- 0:00:09
Average standard deviation of split frequencies: 0.005239
865500 -- [-824.556] (-828.040) (-826.901) (-824.631) * [-829.117] (-828.092) (-826.716) (-825.310) -- 0:00:09
866000 -- (-826.002) (-827.359) [-825.759] (-826.513) * (-827.369) (-829.427) (-832.179) [-827.203] -- 0:00:09
866500 -- (-826.093) (-829.950) [-825.947] (-825.646) * [-826.863] (-825.792) (-828.506) (-825.827) -- 0:00:09
867000 -- (-825.126) [-824.960] (-825.871) (-825.988) * [-829.852] (-824.976) (-824.822) (-825.669) -- 0:00:09
867500 -- (-824.535) [-827.884] (-828.151) (-829.378) * (-826.955) (-828.500) (-824.490) [-826.929] -- 0:00:09
868000 -- [-825.501] (-831.341) (-824.624) (-826.134) * (-828.126) (-829.090) (-825.644) [-827.545] -- 0:00:09
868500 -- (-827.658) (-825.284) [-824.599] (-825.207) * [-827.424] (-824.945) (-827.261) (-826.312) -- 0:00:09
869000 -- [-829.013] (-826.165) (-826.007) (-826.454) * [-824.702] (-827.413) (-826.491) (-824.811) -- 0:00:09
869500 -- (-826.098) [-824.530] (-826.588) (-825.852) * (-826.490) [-824.686] (-829.182) (-826.585) -- 0:00:09
870000 -- (-824.147) (-825.527) [-824.928] (-824.450) * [-825.122] (-825.269) (-825.270) (-825.861) -- 0:00:09
Average standard deviation of split frequencies: 0.005414
870500 -- (-826.110) (-824.431) (-825.764) [-824.856] * (-827.653) (-824.976) [-825.195] (-826.139) -- 0:00:09
871000 -- (-824.144) [-824.445] (-824.597) (-825.389) * (-828.407) [-825.019] (-824.715) (-825.258) -- 0:00:09
871500 -- [-827.044] (-826.273) (-829.584) (-827.776) * [-824.484] (-828.729) (-827.999) (-824.419) -- 0:00:09
872000 -- (-826.469) (-824.512) (-826.889) [-825.656] * (-825.518) [-825.660] (-828.832) (-826.297) -- 0:00:09
872500 -- (-825.187) (-824.338) (-828.690) [-823.933] * (-825.151) (-825.363) [-829.316] (-826.180) -- 0:00:09
873000 -- (-826.177) (-826.574) (-826.689) [-823.915] * [-824.583] (-827.053) (-831.286) (-827.384) -- 0:00:09
873500 -- [-827.125] (-827.088) (-825.159) (-823.932) * [-824.008] (-830.445) (-826.158) (-828.544) -- 0:00:08
874000 -- [-825.739] (-826.148) (-826.871) (-828.325) * [-824.274] (-827.888) (-824.740) (-826.897) -- 0:00:08
874500 -- (-824.728) (-825.605) [-825.543] (-824.714) * (-825.268) (-827.578) [-824.535] (-826.976) -- 0:00:08
875000 -- (-825.495) (-830.630) (-826.983) [-825.470] * [-827.419] (-832.152) (-830.843) (-824.790) -- 0:00:08
Average standard deviation of split frequencies: 0.005718
875500 -- (-826.604) (-831.951) (-826.970) [-825.801] * (-824.870) [-830.252] (-827.626) (-826.037) -- 0:00:08
876000 -- (-829.858) (-826.778) (-826.043) [-824.144] * (-824.731) [-826.724] (-824.133) (-824.468) -- 0:00:08
876500 -- (-827.167) (-832.203) (-826.114) [-826.505] * (-824.813) (-824.817) [-825.396] (-825.499) -- 0:00:08
877000 -- (-828.109) [-828.708] (-830.714) (-826.470) * (-825.742) [-824.669] (-824.808) (-828.442) -- 0:00:08
877500 -- (-829.525) (-823.992) [-824.971] (-824.739) * [-827.100] (-826.578) (-828.311) (-827.785) -- 0:00:08
878000 -- [-826.836] (-825.239) (-825.857) (-825.006) * (-824.938) (-827.754) [-828.971] (-825.242) -- 0:00:08
878500 -- (-827.682) (-825.741) [-825.526] (-824.847) * (-824.171) (-831.296) [-828.467] (-825.223) -- 0:00:08
879000 -- [-827.371] (-827.527) (-825.920) (-826.696) * [-824.824] (-831.868) (-828.398) (-825.695) -- 0:00:08
879500 -- (-825.665) (-825.821) (-827.670) [-826.231] * (-826.761) (-825.726) (-829.894) [-828.245] -- 0:00:08
880000 -- (-826.505) (-826.556) [-828.589] (-826.762) * [-825.931] (-825.834) (-828.881) (-835.193) -- 0:00:08
Average standard deviation of split frequencies: 0.006557
880500 -- (-825.161) (-826.016) [-826.982] (-827.426) * (-824.362) [-826.378] (-826.873) (-826.596) -- 0:00:08
881000 -- (-826.629) (-825.398) (-828.024) [-826.133] * [-824.302] (-828.040) (-824.183) (-824.501) -- 0:00:08
881500 -- (-826.430) (-829.594) (-825.510) [-827.242] * (-824.402) [-827.211] (-825.479) (-826.932) -- 0:00:08
882000 -- (-828.028) (-826.890) [-824.891] (-827.756) * (-825.459) [-825.239] (-824.381) (-828.453) -- 0:00:08
882500 -- (-827.245) (-825.679) [-824.253] (-825.695) * (-828.581) (-830.846) [-824.740] (-826.207) -- 0:00:08
883000 -- (-826.893) [-825.721] (-825.502) (-831.371) * [-825.967] (-832.339) (-826.079) (-824.871) -- 0:00:08
883500 -- (-827.642) (-827.589) (-825.852) [-825.725] * [-826.069] (-828.768) (-825.880) (-825.498) -- 0:00:08
884000 -- [-828.689] (-827.659) (-825.421) (-826.975) * (-828.844) (-827.003) [-827.961] (-831.054) -- 0:00:08
884500 -- (-827.054) [-825.809] (-832.411) (-825.343) * (-825.945) (-829.327) [-825.468] (-824.923) -- 0:00:08
885000 -- [-824.603] (-824.716) (-826.466) (-825.386) * (-825.777) (-826.776) (-827.972) [-827.888] -- 0:00:08
Average standard deviation of split frequencies: 0.006518
885500 -- (-824.605) (-825.097) (-825.831) [-824.827] * (-826.669) [-824.998] (-825.002) (-824.801) -- 0:00:08
886000 -- (-826.474) [-826.736] (-825.098) (-824.980) * (-825.636) [-826.879] (-825.978) (-824.677) -- 0:00:08
886500 -- [-824.889] (-826.438) (-827.417) (-825.084) * [-826.959] (-826.751) (-824.307) (-825.908) -- 0:00:08
887000 -- [-825.637] (-825.987) (-827.371) (-825.668) * [-827.059] (-826.713) (-828.046) (-825.324) -- 0:00:08
887500 -- [-825.868] (-828.434) (-826.870) (-824.601) * (-824.304) (-824.749) (-826.733) [-825.144] -- 0:00:07
888000 -- (-830.243) (-826.599) (-826.674) [-826.917] * (-825.100) (-825.481) (-829.015) [-824.813] -- 0:00:07
888500 -- (-827.072) (-825.633) [-824.885] (-826.422) * [-824.974] (-825.739) (-828.192) (-828.527) -- 0:00:07
889000 -- (-826.344) (-824.290) (-825.067) [-824.436] * (-826.272) (-827.800) (-827.504) [-828.500] -- 0:00:07
889500 -- (-825.076) [-825.673] (-826.218) (-824.313) * [-825.055] (-826.878) (-824.282) (-827.461) -- 0:00:07
890000 -- (-827.697) (-829.507) (-827.385) [-827.297] * (-825.138) (-826.970) [-826.717] (-828.746) -- 0:00:07
Average standard deviation of split frequencies: 0.005987
890500 -- (-825.780) (-825.565) [-826.249] (-828.189) * [-825.380] (-823.923) (-825.660) (-829.172) -- 0:00:07
891000 -- (-825.198) (-824.832) [-825.587] (-828.329) * [-826.241] (-827.361) (-827.943) (-828.516) -- 0:00:07
891500 -- (-831.021) (-826.726) [-825.009] (-827.047) * (-825.774) (-828.114) [-825.689] (-829.012) -- 0:00:07
892000 -- (-831.149) [-826.465] (-826.247) (-827.775) * (-825.147) [-825.293] (-829.194) (-830.426) -- 0:00:07
892500 -- (-826.051) (-829.144) [-828.326] (-827.458) * [-825.119] (-827.476) (-826.913) (-826.118) -- 0:00:07
893000 -- [-826.083] (-830.586) (-824.408) (-833.159) * [-825.382] (-827.255) (-827.378) (-824.714) -- 0:00:07
893500 -- (-826.985) (-830.240) (-824.427) [-825.971] * (-824.786) [-827.009] (-825.836) (-823.761) -- 0:00:07
894000 -- (-826.748) (-826.689) (-824.611) [-826.666] * [-824.815] (-826.049) (-825.259) (-826.481) -- 0:00:07
894500 -- (-826.149) (-825.196) (-824.651) [-826.730] * (-826.351) (-825.040) (-828.214) [-832.404] -- 0:00:07
895000 -- (-828.351) (-827.634) (-825.525) [-824.906] * [-825.236] (-825.997) (-827.296) (-828.728) -- 0:00:07
Average standard deviation of split frequencies: 0.005952
895500 -- [-829.214] (-825.370) (-827.486) (-827.587) * (-829.863) (-828.268) [-826.573] (-827.744) -- 0:00:07
896000 -- (-824.808) (-831.114) [-829.132] (-829.219) * (-826.036) (-827.893) (-830.951) [-833.562] -- 0:00:07
896500 -- (-828.063) (-829.471) [-824.556] (-827.461) * (-828.514) [-829.471] (-824.564) (-830.044) -- 0:00:07
897000 -- (-827.588) (-826.365) [-824.525] (-827.088) * (-828.327) [-828.783] (-826.477) (-825.384) -- 0:00:07
897500 -- (-825.062) (-830.692) [-824.405] (-824.873) * (-826.627) (-829.219) (-824.943) [-824.981] -- 0:00:07
898000 -- (-826.198) [-825.550] (-827.138) (-825.352) * (-828.485) (-824.613) (-832.755) [-829.300] -- 0:00:07
898500 -- (-826.365) (-825.334) (-827.538) [-825.058] * (-825.417) [-827.018] (-824.990) (-825.112) -- 0:00:07
899000 -- (-834.089) [-826.547] (-827.701) (-825.357) * (-825.262) (-824.988) (-824.264) [-824.954] -- 0:00:07
899500 -- (-830.341) [-825.052] (-830.004) (-830.231) * [-828.745] (-824.072) (-827.033) (-826.667) -- 0:00:07
900000 -- (-830.045) [-823.872] (-825.095) (-824.917) * [-827.057] (-825.774) (-826.407) (-826.554) -- 0:00:07
Average standard deviation of split frequencies: 0.005954
900500 -- [-826.885] (-824.129) (-824.334) (-825.463) * (-828.281) (-824.211) [-825.809] (-825.331) -- 0:00:07
901000 -- (-829.604) (-825.882) (-825.956) [-824.847] * [-826.861] (-825.867) (-830.288) (-826.485) -- 0:00:07
901500 -- (-829.972) [-824.859] (-827.174) (-825.738) * (-826.480) (-827.424) [-825.979] (-824.057) -- 0:00:06
902000 -- [-823.815] (-825.158) (-825.607) (-827.465) * (-828.588) [-825.636] (-828.788) (-824.043) -- 0:00:06
902500 -- (-824.701) (-824.761) [-825.340] (-828.571) * (-827.918) [-826.420] (-826.113) (-824.057) -- 0:00:06
903000 -- (-826.843) [-827.396] (-825.056) (-824.413) * (-826.361) [-826.452] (-825.857) (-824.381) -- 0:00:06
903500 -- (-828.604) (-827.976) [-824.318] (-827.616) * (-826.182) (-824.643) (-829.968) [-826.751] -- 0:00:06
904000 -- [-825.567] (-824.213) (-824.522) (-827.782) * (-824.605) (-824.971) (-826.334) [-826.230] -- 0:00:06
904500 -- [-825.251] (-824.823) (-825.493) (-827.756) * (-824.636) (-827.208) (-827.463) [-825.112] -- 0:00:06
905000 -- (-827.851) (-824.077) (-827.666) [-827.306] * (-824.458) (-826.261) (-827.021) [-825.219] -- 0:00:06
Average standard deviation of split frequencies: 0.006179
905500 -- (-831.475) (-826.870) [-824.588] (-825.359) * (-830.724) (-826.923) (-829.180) [-824.631] -- 0:00:06
906000 -- (-827.733) [-826.336] (-826.182) (-825.178) * (-825.231) (-825.856) (-826.628) [-830.753] -- 0:00:06
906500 -- (-825.805) (-825.652) (-826.148) [-826.412] * (-826.067) (-831.947) [-829.129] (-827.771) -- 0:00:06
907000 -- (-826.213) (-824.279) [-824.648] (-827.506) * (-828.877) (-828.287) [-827.440] (-832.056) -- 0:00:06
907500 -- (-827.517) (-825.340) (-828.343) [-828.703] * (-825.568) [-825.200] (-827.540) (-830.444) -- 0:00:06
908000 -- (-826.485) [-826.982] (-825.539) (-825.139) * (-827.794) (-825.947) [-827.004] (-827.678) -- 0:00:06
908500 -- (-827.800) (-824.914) (-825.599) [-825.490] * (-831.394) (-828.015) [-825.064] (-825.767) -- 0:00:06
909000 -- (-826.227) (-824.950) (-825.609) [-826.256] * (-830.696) [-825.375] (-824.906) (-825.681) -- 0:00:06
909500 -- (-828.624) (-828.231) (-828.243) [-825.298] * (-828.188) [-824.825] (-827.747) (-824.431) -- 0:00:06
910000 -- (-825.737) (-826.094) (-825.911) [-825.373] * [-828.954] (-830.294) (-827.965) (-825.762) -- 0:00:06
Average standard deviation of split frequencies: 0.006665
910500 -- (-826.562) (-824.427) [-825.213] (-827.975) * (-828.412) [-828.537] (-827.928) (-827.292) -- 0:00:06
911000 -- (-827.090) (-824.568) [-825.107] (-826.077) * (-830.150) (-825.975) (-828.404) [-826.146] -- 0:00:06
911500 -- (-828.547) (-823.792) [-829.506] (-832.904) * [-824.871] (-825.879) (-826.640) (-829.107) -- 0:00:06
912000 -- (-826.996) (-823.984) [-827.110] (-829.304) * (-824.135) (-824.862) (-830.339) [-826.776] -- 0:00:06
912500 -- [-825.150] (-824.128) (-827.156) (-830.385) * [-824.439] (-828.847) (-825.985) (-830.401) -- 0:00:06
913000 -- [-824.113] (-827.749) (-825.753) (-828.652) * (-824.151) (-826.481) [-826.739] (-825.145) -- 0:00:06
913500 -- (-824.859) [-825.873] (-828.470) (-830.491) * (-827.358) (-826.735) [-827.499] (-825.346) -- 0:00:06
914000 -- (-825.318) (-825.379) [-825.699] (-828.681) * (-824.336) (-826.124) (-826.627) [-824.452] -- 0:00:06
914500 -- (-827.538) (-829.344) [-825.278] (-834.978) * (-825.250) [-824.553] (-825.070) (-824.745) -- 0:00:06
915000 -- (-824.461) [-825.692] (-825.309) (-834.500) * [-825.104] (-824.462) (-835.962) (-826.031) -- 0:00:06
Average standard deviation of split frequencies: 0.006658
915500 -- (-825.101) (-824.432) (-824.581) [-826.921] * (-826.555) (-824.199) (-826.048) [-825.386] -- 0:00:05
916000 -- (-825.122) (-824.718) (-825.199) [-824.573] * [-824.434] (-830.255) (-834.881) (-830.356) -- 0:00:05
916500 -- (-826.219) [-825.482] (-825.936) (-825.308) * (-827.613) (-827.351) (-826.318) [-825.520] -- 0:00:05
917000 -- (-825.335) (-826.056) (-824.975) [-825.847] * [-825.586] (-826.499) (-824.805) (-831.015) -- 0:00:05
917500 -- (-827.047) [-827.059] (-825.648) (-826.925) * [-826.504] (-826.453) (-827.703) (-827.973) -- 0:00:05
918000 -- [-826.131] (-825.810) (-825.646) (-830.187) * (-830.303) (-824.517) [-826.088] (-825.346) -- 0:00:05
918500 -- [-826.775] (-827.201) (-824.179) (-824.338) * (-827.163) (-825.884) (-826.306) [-826.003] -- 0:00:05
919000 -- (-827.508) [-827.496] (-824.395) (-825.763) * (-826.855) (-824.500) [-826.072] (-825.231) -- 0:00:05
919500 -- [-827.544] (-828.963) (-824.089) (-827.104) * (-826.372) (-827.094) [-826.021] (-828.771) -- 0:00:05
920000 -- (-825.814) [-826.753] (-826.605) (-825.146) * [-824.886] (-827.024) (-825.933) (-826.824) -- 0:00:05
Average standard deviation of split frequencies: 0.007136
920500 -- (-824.940) (-824.637) (-827.379) [-824.534] * [-825.056] (-831.078) (-829.579) (-826.448) -- 0:00:05
921000 -- (-823.726) (-826.223) (-826.053) [-827.789] * (-826.384) [-826.503] (-825.380) (-827.427) -- 0:00:05
921500 -- [-824.652] (-828.195) (-825.895) (-825.908) * (-826.786) [-824.894] (-825.351) (-825.458) -- 0:00:05
922000 -- [-825.331] (-825.583) (-827.469) (-824.995) * (-827.006) (-824.933) (-827.966) [-828.249] -- 0:00:05
922500 -- [-825.141] (-825.663) (-827.538) (-824.672) * [-827.200] (-827.437) (-827.371) (-827.630) -- 0:00:05
923000 -- (-827.518) (-826.923) (-827.669) [-824.125] * [-826.898] (-824.436) (-828.003) (-826.925) -- 0:00:05
923500 -- (-829.845) (-825.551) (-826.647) [-824.326] * (-828.122) [-825.855] (-826.444) (-827.180) -- 0:00:05
924000 -- [-828.773] (-825.255) (-826.247) (-825.282) * (-827.545) (-826.729) (-830.095) [-824.769] -- 0:00:05
924500 -- (-825.603) [-826.220] (-826.657) (-826.955) * (-827.497) (-825.962) (-825.986) [-825.219] -- 0:00:05
925000 -- (-826.406) (-826.343) (-824.833) [-824.564] * (-825.078) (-826.655) (-826.302) [-826.019] -- 0:00:05
Average standard deviation of split frequencies: 0.006809
925500 -- (-836.157) [-826.218] (-828.799) (-826.381) * [-828.671] (-826.945) (-828.578) (-826.366) -- 0:00:05
926000 -- [-825.130] (-826.503) (-827.657) (-825.811) * (-829.564) (-825.929) [-823.982] (-828.356) -- 0:00:05
926500 -- [-827.796] (-824.513) (-827.088) (-826.310) * (-832.691) [-825.195] (-825.211) (-830.576) -- 0:00:05
927000 -- (-826.581) (-825.895) (-828.195) [-825.302] * (-829.357) (-825.149) [-828.456] (-825.596) -- 0:00:05
927500 -- (-824.149) [-824.529] (-828.987) (-826.654) * (-828.685) [-825.663] (-824.983) (-825.668) -- 0:00:05
928000 -- (-827.683) (-825.212) (-828.038) [-824.586] * (-824.426) (-826.021) [-825.382] (-828.928) -- 0:00:05
928500 -- (-825.898) [-823.899] (-827.405) (-830.248) * (-825.108) (-825.753) [-825.608] (-828.833) -- 0:00:05
929000 -- (-828.954) (-826.128) [-827.588] (-825.885) * (-826.395) (-825.354) [-825.026] (-826.250) -- 0:00:05
929500 -- [-826.329] (-829.011) (-826.106) (-825.932) * (-829.281) (-824.845) (-830.866) [-824.383] -- 0:00:05
930000 -- (-825.948) [-828.074] (-824.237) (-824.710) * (-827.747) (-825.590) (-831.302) [-826.467] -- 0:00:04
Average standard deviation of split frequencies: 0.006901
930500 -- (-827.689) (-828.146) [-823.900] (-825.249) * (-825.131) (-826.805) (-832.663) [-824.757] -- 0:00:04
931000 -- (-824.267) (-825.808) (-827.141) [-824.251] * [-826.416] (-824.741) (-826.312) (-826.158) -- 0:00:04
931500 -- (-824.655) [-824.438] (-825.746) (-825.127) * (-825.787) (-827.081) [-826.857] (-826.904) -- 0:00:04
932000 -- (-826.668) [-826.289] (-824.728) (-829.147) * (-826.817) (-829.447) [-826.769] (-830.089) -- 0:00:04
932500 -- (-825.653) (-825.423) (-825.769) [-827.121] * (-825.794) (-829.846) (-828.500) [-828.302] -- 0:00:04
933000 -- (-828.348) (-826.291) [-824.411] (-827.448) * (-825.040) (-826.177) [-825.332] (-825.259) -- 0:00:04
933500 -- (-825.393) [-824.442] (-827.027) (-826.546) * (-827.808) [-826.281] (-824.101) (-826.497) -- 0:00:04
934000 -- (-827.620) [-825.547] (-826.988) (-828.666) * [-828.379] (-824.566) (-824.315) (-827.343) -- 0:00:04
934500 -- (-826.596) (-824.187) (-826.753) [-827.684] * [-830.993] (-825.179) (-824.667) (-826.608) -- 0:00:04
935000 -- [-825.151] (-827.078) (-824.339) (-833.996) * (-825.057) [-825.872] (-826.777) (-827.344) -- 0:00:04
Average standard deviation of split frequencies: 0.007051
935500 -- (-827.753) [-824.562] (-824.245) (-826.124) * [-824.908] (-825.458) (-829.649) (-826.166) -- 0:00:04
936000 -- (-832.377) (-825.469) [-826.873] (-827.374) * (-825.934) (-824.717) (-825.785) [-824.736] -- 0:00:04
936500 -- [-827.059] (-825.899) (-826.067) (-828.138) * (-825.805) (-828.178) (-828.066) [-825.492] -- 0:00:04
937000 -- (-830.054) [-825.289] (-826.563) (-829.541) * [-825.575] (-826.148) (-824.390) (-830.191) -- 0:00:04
937500 -- [-826.295] (-827.452) (-823.930) (-830.212) * [-825.367] (-826.115) (-824.672) (-827.688) -- 0:00:04
938000 -- (-826.109) (-826.853) (-824.039) [-831.132] * (-828.894) (-826.078) (-824.270) [-828.277] -- 0:00:04
938500 -- (-829.229) (-825.645) (-825.093) [-825.424] * (-827.484) (-825.890) [-824.847] (-827.918) -- 0:00:04
939000 -- (-825.851) (-828.583) [-824.453] (-826.032) * (-825.361) [-826.924] (-824.162) (-827.323) -- 0:00:04
939500 -- (-824.321) (-829.955) [-825.645] (-824.964) * (-828.367) (-825.785) (-823.887) [-831.087] -- 0:00:04
940000 -- (-825.721) [-827.472] (-825.667) (-824.762) * (-825.434) (-824.882) [-825.186] (-828.234) -- 0:00:04
Average standard deviation of split frequencies: 0.006985
940500 -- (-827.275) [-825.304] (-825.030) (-826.352) * [-826.517] (-825.864) (-824.818) (-827.551) -- 0:00:04
941000 -- (-824.742) (-825.446) [-825.349] (-828.383) * (-825.582) (-824.616) (-828.364) [-826.497] -- 0:00:04
941500 -- (-825.102) [-828.322] (-825.515) (-827.129) * (-824.198) (-824.496) [-825.222] (-828.121) -- 0:00:04
942000 -- (-826.417) [-826.025] (-824.792) (-824.018) * (-825.411) (-832.002) [-827.907] (-826.757) -- 0:00:04
942500 -- (-827.632) (-832.794) (-828.563) [-826.479] * [-824.284] (-829.655) (-825.508) (-826.137) -- 0:00:04
943000 -- [-827.375] (-825.385) (-828.712) (-828.997) * [-825.512] (-825.684) (-828.755) (-826.588) -- 0:00:04
943500 -- (-827.637) [-825.852] (-827.919) (-828.399) * (-826.341) (-827.614) [-828.768] (-831.931) -- 0:00:04
944000 -- [-825.131] (-825.566) (-825.744) (-828.562) * (-827.161) [-825.765] (-827.162) (-824.803) -- 0:00:03
944500 -- (-825.251) (-828.022) (-825.625) [-825.981] * (-828.625) (-827.634) (-826.205) [-826.650] -- 0:00:03
945000 -- (-826.399) [-824.408] (-828.361) (-825.922) * (-825.412) (-824.124) [-824.344] (-827.264) -- 0:00:03
Average standard deviation of split frequencies: 0.006914
945500 -- (-827.785) (-824.042) [-829.735] (-825.991) * (-825.095) [-825.647] (-824.567) (-825.453) -- 0:00:03
946000 -- (-826.876) [-824.345] (-827.774) (-825.795) * (-827.418) (-828.982) (-827.297) [-824.634] -- 0:00:03
946500 -- (-827.146) (-825.513) (-825.274) [-824.728] * (-825.527) (-824.509) (-826.524) [-824.762] -- 0:00:03
947000 -- (-827.236) [-824.288] (-829.305) (-825.341) * (-829.429) [-826.878] (-828.660) (-826.572) -- 0:00:03
947500 -- (-824.747) (-824.217) (-825.401) [-824.978] * (-825.398) (-826.435) (-825.866) [-828.456] -- 0:00:03
948000 -- (-829.156) [-825.573] (-825.905) (-828.963) * (-826.112) (-826.378) [-825.029] (-825.159) -- 0:00:03
948500 -- (-832.170) (-825.806) [-824.784] (-827.583) * (-826.556) (-824.877) (-824.395) [-826.397] -- 0:00:03
949000 -- (-825.440) [-825.285] (-826.096) (-825.189) * [-826.089] (-830.185) (-827.782) (-826.695) -- 0:00:03
949500 -- [-824.436] (-824.988) (-824.019) (-826.655) * (-825.982) (-825.267) [-827.106] (-827.303) -- 0:00:03
950000 -- (-825.275) (-824.236) [-827.904] (-826.152) * (-825.798) [-827.520] (-825.176) (-825.788) -- 0:00:03
Average standard deviation of split frequencies: 0.007035
950500 -- (-827.594) (-827.480) [-824.145] (-825.462) * [-825.567] (-824.933) (-824.942) (-823.986) -- 0:00:03
951000 -- (-827.136) (-825.008) [-826.277] (-824.731) * (-826.551) (-825.452) (-825.246) [-823.993] -- 0:00:03
951500 -- (-826.484) (-825.043) [-827.970] (-828.435) * (-824.482) (-825.225) (-826.306) [-825.563] -- 0:00:03
952000 -- (-825.801) (-828.566) (-825.364) [-825.823] * (-825.963) [-826.730] (-828.846) (-826.318) -- 0:00:03
952500 -- [-823.979] (-826.460) (-827.203) (-824.142) * [-824.389] (-825.914) (-828.646) (-828.389) -- 0:00:03
953000 -- (-824.978) (-825.391) (-826.093) [-824.467] * (-825.421) [-828.154] (-827.352) (-825.800) -- 0:00:03
953500 -- [-825.935] (-824.182) (-826.280) (-824.468) * (-826.499) [-825.120] (-827.868) (-825.588) -- 0:00:03
954000 -- (-825.631) (-824.171) [-828.421] (-824.861) * (-825.015) (-824.819) (-825.988) [-824.340] -- 0:00:03
954500 -- (-826.250) (-824.605) [-827.406] (-825.884) * (-827.879) (-826.067) (-825.001) [-826.213] -- 0:00:03
955000 -- (-825.335) [-826.254] (-829.049) (-827.873) * [-825.482] (-827.495) (-829.398) (-825.770) -- 0:00:03
Average standard deviation of split frequencies: 0.006842
955500 -- (-826.714) (-825.290) [-826.174] (-825.174) * (-825.509) [-825.629] (-827.792) (-824.034) -- 0:00:03
956000 -- (-827.849) (-826.292) [-829.083] (-824.531) * (-825.493) (-829.061) [-824.695] (-825.822) -- 0:00:03
956500 -- (-827.071) (-826.052) (-828.382) [-827.599] * [-824.950] (-827.362) (-826.713) (-823.987) -- 0:00:03
957000 -- (-827.650) (-825.570) [-827.033] (-826.166) * (-826.260) (-828.394) (-825.936) [-824.753] -- 0:00:03
957500 -- [-826.847] (-829.046) (-827.191) (-824.000) * [-824.495] (-826.484) (-827.722) (-825.113) -- 0:00:03
958000 -- (-828.832) (-828.808) (-825.477) [-825.028] * (-825.975) [-826.027] (-827.744) (-827.866) -- 0:00:02
958500 -- (-825.991) (-827.184) [-825.416] (-824.172) * (-826.305) [-824.563] (-825.092) (-827.185) -- 0:00:02
959000 -- (-825.668) (-825.913) (-825.659) [-824.363] * (-826.766) (-827.165) (-828.400) [-827.440] -- 0:00:02
959500 -- (-825.316) (-825.808) [-824.633] (-825.872) * [-824.678] (-825.750) (-826.319) (-829.334) -- 0:00:02
960000 -- (-830.258) (-824.683) [-823.818] (-825.194) * (-824.509) (-826.049) [-829.710] (-826.334) -- 0:00:02
Average standard deviation of split frequencies: 0.006809
960500 -- (-825.994) [-826.222] (-823.965) (-825.659) * (-825.924) (-825.177) (-826.590) [-824.467] -- 0:00:02
961000 -- [-824.569] (-825.053) (-825.863) (-825.302) * [-825.296] (-826.784) (-828.122) (-825.276) -- 0:00:02
961500 -- [-828.157] (-824.180) (-826.358) (-827.148) * (-831.142) (-826.932) (-827.675) [-825.811] -- 0:00:02
962000 -- (-830.816) (-825.072) (-826.504) [-828.604] * (-827.506) [-830.784] (-831.921) (-824.079) -- 0:00:02
962500 -- (-826.007) (-827.402) (-826.988) [-826.871] * [-828.259] (-825.910) (-827.240) (-827.837) -- 0:00:02
963000 -- (-829.354) [-825.892] (-830.973) (-830.385) * (-831.646) (-825.176) [-824.579] (-826.501) -- 0:00:02
963500 -- [-823.887] (-826.490) (-828.753) (-827.305) * (-829.251) [-827.797] (-824.285) (-824.373) -- 0:00:02
964000 -- [-824.463] (-825.631) (-827.295) (-825.743) * (-825.285) (-826.542) (-824.099) [-824.308] -- 0:00:02
964500 -- (-829.314) [-825.811] (-825.982) (-825.597) * [-825.035] (-825.057) (-827.118) (-826.265) -- 0:00:02
965000 -- [-825.136] (-823.751) (-824.990) (-824.288) * (-826.696) [-828.411] (-826.655) (-828.320) -- 0:00:02
Average standard deviation of split frequencies: 0.007167
965500 -- (-824.982) (-826.421) [-826.089] (-824.056) * [-825.278] (-825.503) (-826.376) (-828.487) -- 0:00:02
966000 -- [-825.529] (-824.421) (-824.679) (-824.623) * [-826.149] (-826.237) (-826.019) (-827.401) -- 0:00:02
966500 -- [-824.763] (-824.629) (-825.023) (-826.729) * (-824.321) (-827.474) [-827.674] (-827.110) -- 0:00:02
967000 -- [-825.706] (-827.045) (-825.579) (-825.786) * (-826.357) (-827.975) [-825.082] (-829.147) -- 0:00:02
967500 -- (-826.305) (-824.785) [-825.255] (-825.496) * (-826.596) [-828.558] (-824.505) (-826.476) -- 0:00:02
968000 -- (-828.078) (-823.928) (-825.564) [-824.947] * [-826.745] (-826.058) (-826.298) (-827.107) -- 0:00:02
968500 -- (-825.743) (-824.284) (-832.376) [-826.756] * [-826.551] (-825.669) (-826.264) (-825.616) -- 0:00:02
969000 -- (-824.144) (-824.581) [-826.555] (-826.748) * [-826.115] (-825.650) (-824.313) (-826.212) -- 0:00:02
969500 -- (-824.454) [-824.650] (-824.972) (-824.349) * [-825.183] (-825.298) (-824.739) (-826.231) -- 0:00:02
970000 -- [-825.032] (-825.865) (-824.457) (-828.193) * [-827.025] (-826.743) (-828.428) (-824.426) -- 0:00:02
Average standard deviation of split frequencies: 0.007072
970500 -- [-826.316] (-826.947) (-827.685) (-826.574) * [-825.622] (-829.058) (-827.546) (-827.925) -- 0:00:02
971000 -- (-825.291) [-823.822] (-823.907) (-824.177) * (-826.860) (-829.139) [-827.334] (-825.123) -- 0:00:02
971500 -- (-824.854) [-823.820] (-824.704) (-824.891) * [-827.288] (-828.436) (-826.404) (-828.128) -- 0:00:02
972000 -- [-827.582] (-824.680) (-829.280) (-829.489) * [-827.608] (-827.108) (-826.287) (-825.907) -- 0:00:01
972500 -- [-831.266] (-826.105) (-825.310) (-825.189) * [-826.498] (-826.571) (-825.880) (-826.791) -- 0:00:01
973000 -- (-826.499) (-826.890) (-828.066) [-828.476] * (-826.024) (-827.651) (-826.506) [-825.745] -- 0:00:01
973500 -- (-825.300) (-825.527) (-829.960) [-824.439] * (-831.051) (-826.998) (-825.943) [-825.245] -- 0:00:01
974000 -- (-825.826) [-825.168] (-825.842) (-828.664) * (-832.006) [-827.305] (-826.260) (-824.731) -- 0:00:01
974500 -- (-827.419) (-825.733) (-830.516) [-825.824] * (-824.909) (-827.605) [-825.455] (-827.635) -- 0:00:01
975000 -- (-828.233) [-827.502] (-825.207) (-826.561) * [-825.597] (-826.911) (-825.131) (-827.717) -- 0:00:01
Average standard deviation of split frequencies: 0.007034
975500 -- (-827.680) (-826.499) [-825.561] (-827.552) * [-827.734] (-825.251) (-825.007) (-825.373) -- 0:00:01
976000 -- (-827.100) (-825.476) [-825.962] (-830.588) * (-831.177) (-828.706) [-825.289] (-825.339) -- 0:00:01
976500 -- (-826.202) (-824.121) (-828.176) [-826.385] * (-828.587) [-825.495] (-826.108) (-827.224) -- 0:00:01
977000 -- (-825.061) [-825.032] (-829.298) (-825.466) * (-825.767) [-824.761] (-826.173) (-827.505) -- 0:00:01
977500 -- (-829.042) [-826.175] (-825.402) (-828.453) * (-826.802) [-826.383] (-828.228) (-824.844) -- 0:00:01
978000 -- (-824.680) (-826.650) [-825.923] (-830.134) * (-826.199) (-824.738) (-828.126) [-826.295] -- 0:00:01
978500 -- (-825.060) [-828.814] (-825.118) (-828.696) * (-826.536) (-824.572) (-826.979) [-827.116] -- 0:00:01
979000 -- (-823.822) (-827.549) [-825.463] (-826.518) * [-829.421] (-828.974) (-830.949) (-828.967) -- 0:00:01
979500 -- [-825.622] (-825.398) (-825.391) (-826.821) * (-828.143) (-826.321) (-826.884) [-827.066] -- 0:00:01
980000 -- [-825.329] (-824.438) (-824.732) (-824.626) * (-830.604) (-824.325) [-826.646] (-825.085) -- 0:00:01
Average standard deviation of split frequencies: 0.007000
980500 -- (-825.055) [-825.425] (-824.544) (-827.797) * (-826.554) (-830.677) [-825.449] (-825.457) -- 0:00:01
981000 -- (-826.971) [-829.224] (-826.201) (-828.110) * [-827.267] (-829.354) (-824.400) (-827.455) -- 0:00:01
981500 -- [-827.784] (-825.343) (-824.641) (-828.276) * (-826.141) (-828.944) [-824.791] (-824.607) -- 0:00:01
982000 -- [-825.182] (-826.651) (-823.924) (-828.849) * [-826.087] (-829.158) (-827.049) (-827.164) -- 0:00:01
982500 -- (-825.588) [-824.447] (-826.758) (-828.207) * (-825.601) [-827.224] (-827.940) (-826.409) -- 0:00:01
983000 -- (-825.101) (-827.237) (-826.891) [-829.077] * (-827.244) (-827.542) (-828.356) [-827.017] -- 0:00:01
983500 -- (-827.180) (-824.661) [-825.300] (-828.554) * (-825.714) (-828.856) (-826.291) [-830.270] -- 0:00:01
984000 -- (-829.503) (-825.190) (-825.890) [-824.732] * (-824.992) (-825.469) [-825.244] (-827.679) -- 0:00:01
984500 -- (-829.536) (-824.967) [-825.481] (-825.018) * (-832.348) [-825.545] (-825.556) (-824.922) -- 0:00:01
985000 -- (-829.448) [-824.137] (-827.916) (-825.306) * (-825.610) [-826.461] (-826.189) (-826.403) -- 0:00:01
Average standard deviation of split frequencies: 0.007082
985500 -- [-829.602] (-825.609) (-826.546) (-826.898) * (-824.087) (-825.591) (-826.755) [-824.108] -- 0:00:01
986000 -- (-828.174) (-825.396) [-825.632] (-824.517) * [-824.380] (-825.427) (-828.996) (-824.037) -- 0:00:00
986500 -- (-827.978) (-826.041) [-829.650] (-827.655) * (-825.764) (-826.503) (-827.442) [-829.382] -- 0:00:00
987000 -- (-825.188) [-824.577] (-829.524) (-825.842) * (-828.792) [-824.721] (-827.201) (-826.155) -- 0:00:00
987500 -- (-825.690) [-825.570] (-829.654) (-826.942) * (-826.745) (-826.104) [-830.083] (-825.919) -- 0:00:00
988000 -- (-825.278) (-829.900) (-825.659) [-825.959] * (-829.000) [-827.573] (-826.542) (-829.382) -- 0:00:00
988500 -- [-825.195] (-827.742) (-828.113) (-827.011) * (-824.433) (-826.098) (-825.188) [-825.635] -- 0:00:00
989000 -- (-825.413) (-824.296) [-826.053] (-827.568) * (-824.290) (-826.522) (-826.428) [-824.893] -- 0:00:00
989500 -- (-824.914) (-825.427) (-829.733) [-826.473] * (-826.245) (-825.095) (-826.404) [-824.756] -- 0:00:00
990000 -- (-824.527) (-825.275) (-826.690) [-827.598] * (-824.811) [-824.939] (-826.345) (-824.828) -- 0:00:00
Average standard deviation of split frequencies: 0.007316
990500 -- (-825.263) [-825.238] (-825.017) (-828.857) * (-826.594) [-824.904] (-825.114) (-824.791) -- 0:00:00
991000 -- [-825.695] (-825.773) (-825.460) (-826.276) * [-825.596] (-827.311) (-824.644) (-824.955) -- 0:00:00
991500 -- (-828.815) (-826.689) [-824.794] (-827.021) * (-825.065) (-825.904) [-824.601] (-824.936) -- 0:00:00
992000 -- [-830.463] (-827.173) (-825.283) (-826.090) * (-824.701) (-825.890) (-825.654) [-825.162] -- 0:00:00
992500 -- (-827.143) (-826.937) (-825.962) [-825.275] * [-826.922] (-825.676) (-826.954) (-824.615) -- 0:00:00
993000 -- [-830.552] (-825.775) (-824.362) (-825.790) * (-828.964) (-826.672) [-828.138] (-827.747) -- 0:00:00
993500 -- (-830.774) (-824.837) (-824.171) [-826.203] * (-824.981) (-826.254) [-827.661] (-827.792) -- 0:00:00
994000 -- (-826.257) (-831.046) [-824.712] (-827.576) * (-831.056) [-826.118] (-828.880) (-826.950) -- 0:00:00
994500 -- (-826.670) (-825.126) [-826.241] (-828.253) * (-827.445) [-826.029] (-827.275) (-829.376) -- 0:00:00
995000 -- (-832.652) [-824.157] (-826.670) (-829.421) * (-825.161) (-827.090) (-825.685) [-833.708] -- 0:00:00
Average standard deviation of split frequencies: 0.007218
995500 -- (-828.530) [-829.123] (-826.643) (-824.763) * (-829.146) (-829.286) [-826.426] (-828.901) -- 0:00:00
996000 -- (-824.654) (-825.596) (-824.787) [-824.664] * (-828.267) [-826.369] (-825.420) (-827.549) -- 0:00:00
996500 -- [-824.396] (-828.042) (-824.960) (-831.809) * (-824.804) (-824.909) [-826.373] (-824.092) -- 0:00:00
997000 -- (-824.369) (-827.102) (-825.602) [-829.809] * (-832.077) (-827.237) (-827.480) [-824.379] -- 0:00:00
997500 -- (-825.003) (-827.853) (-828.763) [-825.723] * (-829.635) (-827.829) (-828.490) [-825.955] -- 0:00:00
998000 -- (-827.448) (-825.272) (-827.188) [-824.560] * (-824.644) [-830.403] (-825.131) (-825.472) -- 0:00:00
998500 -- (-826.683) (-825.607) [-824.858] (-824.838) * (-825.444) (-832.299) [-825.148] (-825.369) -- 0:00:00
999000 -- [-828.150] (-825.009) (-827.044) (-827.455) * (-826.937) [-828.744] (-824.618) (-824.518) -- 0:00:00
999500 -- (-824.833) (-830.116) [-828.442] (-824.433) * (-824.006) (-825.355) [-825.490] (-826.325) -- 0:00:00
1000000 -- (-825.672) (-827.033) [-830.979] (-824.345) * (-824.210) (-826.143) [-825.412] (-828.470) -- 0:00:00
Average standard deviation of split frequencies: 0.007007
Analysis completed in 1 mins 11 seconds
Analysis used 69.62 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -823.66
Likelihood of best state for "cold" chain of run 2 was -823.66
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.3 % ( 22 %) Dirichlet(Pi{all})
31.1 % ( 29 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.8 % ( 55 %) Multiplier(Alpha{3})
24.9 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 85 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 94 %) Nodeslider(V{all})
30.9 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.1 % ( 22 %) Dirichlet(Pi{all})
31.1 % ( 31 %) Slider(Pi{all})
79.0 % ( 48 %) Multiplier(Alpha{1,2})
77.7 % ( 51 %) Multiplier(Alpha{3})
21.5 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166375 0.82 0.67
3 | 166309 167049 0.84
4 | 165989 167635 166643
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166673 0.82 0.67
3 | 167398 166365 0.84
4 | 166628 166672 166264
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -825.42
| 2 1 |
| 2 2 2 |
| 1 * 1 |
| 2 22 1 1 1 2 1 1 2 1 |
| 1 2 2 2 12 1 11 2 |
| 1 2 2 2* 1 1 |
|1 2 1 1 11 * 2 1 2 1 1 2 2 11 |
|2 2 *1 1 * |
| 2 2 2 21* 2 * 2 2 1 |
| 1 2 1 1 2 2 * |
| 2 1 2 21 1 1 2 2 1 2 2 |
| 1 1 1 1 12 1 *|
| * 12 1 2 22 2 |
| 2 1 |
| 1 2 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -826.89
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.38 -828.35
2 -825.42 -828.56
--------------------------------------
TOTAL -825.40 -828.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901604 0.088183 0.396747 1.500094 0.868948 1409.32 1455.16 1.002
r(A<->C){all} 0.171104 0.021076 0.000518 0.461898 0.131141 205.47 257.64 1.000
r(A<->G){all} 0.164637 0.020718 0.000059 0.459948 0.124544 136.36 186.17 1.005
r(A<->T){all} 0.161592 0.019414 0.000052 0.449335 0.121403 134.20 193.38 1.000
r(C<->G){all} 0.172399 0.021348 0.000011 0.465222 0.134683 208.29 245.02 1.000
r(C<->T){all} 0.166758 0.020073 0.000129 0.442985 0.126408 140.97 216.17 1.000
r(G<->T){all} 0.163510 0.019377 0.000043 0.434731 0.126592 246.98 248.48 1.001
pi(A){all} 0.180132 0.000233 0.151356 0.210085 0.179543 1483.92 1492.46 1.000
pi(C){all} 0.252540 0.000301 0.218274 0.287209 0.251898 1419.45 1460.23 1.000
pi(G){all} 0.341257 0.000365 0.300246 0.374221 0.341106 1229.98 1239.71 1.000
pi(T){all} 0.226071 0.000287 0.193696 0.260033 0.225589 1317.24 1409.12 1.000
alpha{1,2} 0.422840 0.237587 0.000144 1.390076 0.248059 1349.01 1356.67 1.000
alpha{3} 0.468720 0.252501 0.000185 1.393501 0.309036 1153.43 1220.59 1.000
pinvar{all} 0.997365 0.000010 0.991328 0.999999 0.998384 1066.75 1199.47 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*.*..
9 -- .***.*
10 -- .*.***
11 -- .*...*
12 -- ....**
13 -- .****.
14 -- ...*.*
15 -- ...**.
16 -- .**.**
17 -- ..****
18 -- ..*..*
19 -- ..**..
20 -- .**...
21 -- .*..*.
22 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.001884 0.152565 0.155230 2
8 455 0.151566 0.008009 0.145903 0.157229 2
9 454 0.151233 0.016017 0.139907 0.162558 2
10 454 0.151233 0.007537 0.145903 0.156562 2
11 447 0.148901 0.008009 0.143238 0.154564 2
12 426 0.141905 0.007537 0.136576 0.147235 2
13 424 0.141239 0.017901 0.128581 0.153897 2
14 422 0.140573 0.007537 0.135243 0.145903 2
15 418 0.139241 0.001884 0.137908 0.140573 2
16 418 0.139241 0.010364 0.131912 0.146569 2
17 417 0.138907 0.001413 0.137908 0.139907 2
18 409 0.136243 0.003298 0.133911 0.138574 2
19 409 0.136243 0.003298 0.133911 0.138574 2
20 408 0.135909 0.002827 0.133911 0.137908 2
21 403 0.134244 0.005182 0.130580 0.137908 2
22 306 0.101932 0.009422 0.095270 0.108594 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097782 0.009639 0.000050 0.288700 0.068212 1.000 2
length{all}[2] 0.100015 0.010078 0.000007 0.299214 0.069996 1.000 2
length{all}[3] 0.101929 0.010722 0.000032 0.295819 0.071364 1.000 2
length{all}[4] 0.100075 0.009754 0.000001 0.297177 0.071093 1.000 2
length{all}[5] 0.101274 0.010023 0.000001 0.291594 0.072829 1.000 2
length{all}[6] 0.102824 0.011009 0.000058 0.313890 0.069028 1.000 2
length{all}[7] 0.098170 0.010544 0.000483 0.287020 0.068987 0.998 2
length{all}[8] 0.091753 0.008472 0.000028 0.284994 0.064358 1.001 2
length{all}[9] 0.099755 0.010965 0.000254 0.299030 0.067451 1.000 2
length{all}[10] 0.107988 0.011164 0.000006 0.316877 0.075107 0.998 2
length{all}[11] 0.096533 0.008417 0.000151 0.277065 0.070507 1.007 2
length{all}[12] 0.095122 0.009670 0.000067 0.294954 0.068518 1.007 2
length{all}[13] 0.100374 0.009679 0.000152 0.325678 0.071822 0.998 2
length{all}[14] 0.094879 0.008890 0.000639 0.281905 0.068433 1.006 2
length{all}[15] 0.102645 0.010292 0.000032 0.276367 0.077930 0.998 2
length{all}[16] 0.095580 0.009008 0.000748 0.286619 0.065767 0.998 2
length{all}[17] 0.099608 0.009179 0.000108 0.297403 0.073838 0.999 2
length{all}[18] 0.106353 0.010704 0.000112 0.321504 0.073842 1.000 2
length{all}[19] 0.099362 0.010220 0.000113 0.282988 0.070341 0.999 2
length{all}[20] 0.101480 0.011847 0.000003 0.294812 0.065899 1.000 2
length{all}[21] 0.105823 0.011997 0.000119 0.284347 0.077520 0.999 2
length{all}[22] 0.101357 0.007961 0.000025 0.271876 0.074078 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007007
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 609
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
3 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
2 sites are removed. 1 203
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 201 / 201 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 201 / 201 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095407 0.078817 0.106307 0.025157 0.021327 0.050965 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -868.717106
Iterating by ming2
Initial: fx= 868.717106
x= 0.09541 0.07882 0.10631 0.02516 0.02133 0.05096 0.30000 1.30000
1 h-m-p 0.0000 0.0001 483.0895 ++ 843.631088 m 0.0001 13 | 1/8
2 h-m-p 0.0012 0.0330 40.6912 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 442.0594 ++ 839.860994 m 0.0000 44 | 2/8
4 h-m-p 0.0002 0.0394 34.0835 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 394.8129 ++ 819.460758 m 0.0001 74 | 3/8
6 h-m-p 0.0016 0.0489 27.5544 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 342.8831 ++ 802.764202 m 0.0001 105 | 4/8
8 h-m-p 0.0018 0.0632 21.9314 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 281.0376 ++ 796.068761 m 0.0001 137 | 5/8
10 h-m-p 0.0010 0.0922 16.0362 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 199.1383 ++ 793.856644 m 0.0001 168 | 6/8
12 h-m-p 0.2437 8.0000 0.0000 +++ 793.856644 m 8.0000 180 | 6/8
13 h-m-p 0.7442 8.0000 0.0000 ++ 793.856644 m 8.0000 193 | 6/8
14 h-m-p 0.0134 6.7204 0.0515 ----------N 793.856644 0 0.0000 216 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 Y 793.856644 0 0.0040 229 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 ------------Y 793.856644 0 0.0000 254
Out..
lnL = -793.856644
255 lfun, 255 eigenQcodon, 1530 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094073 0.067854 0.059728 0.062771 0.059528 0.071505 0.300336 0.542783 0.316124
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.235416
np = 9
lnL0 = -873.129303
Iterating by ming2
Initial: fx= 873.129303
x= 0.09407 0.06785 0.05973 0.06277 0.05953 0.07151 0.30034 0.54278 0.31612
1 h-m-p 0.0000 0.0003 450.7070 +++ 805.470040 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0000 195.6238 ++ 805.270968 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0001 411.0987 ++ 802.189448 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 1243.8290 ++ 798.764208 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 856.0257 ++ 797.278079 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3024.3274 ++ 793.856588 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 793.856588 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.1040 -----------N 793.856588 0 0.0000 113 | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856588 m 8.0000 131 | 6/9
10 h-m-p 0.0033 1.3164 0.5111 ---------Y 793.856588 0 0.0000 155 | 6/9
11 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856587 m 8.0000 173 | 6/9
12 h-m-p 0.0002 0.0648 9.1429 ----------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856587 m 8.0000 211 | 6/9
14 h-m-p 0.0068 3.4167 0.2298 ---------C 793.856587 0 0.0000 235 | 6/9
15 h-m-p 0.0160 8.0000 0.0007 +++++ 793.856586 m 8.0000 253 | 6/9
16 h-m-p 0.0179 2.0331 0.3231 -----------Y 793.856586 0 0.0000 279 | 6/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 793.856586 m 8.0000 297 | 6/9
18 h-m-p 0.0030 1.5132 0.4508 ------------.. | 6/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856586 m 8.0000 340 | 6/9
20 h-m-p 0.0062 3.0857 0.2583 ---------C 793.856586 0 0.0000 364 | 6/9
21 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856586 m 8.0000 382 | 6/9
22 h-m-p 0.0018 0.5271 0.8864 ---------Y 793.856586 0 0.0000 406 | 6/9
23 h-m-p 0.0160 8.0000 0.0008 +++++ 793.856585 m 8.0000 424 | 6/9
24 h-m-p 0.0036 0.1527 1.8677 ---------Y 793.856585 0 0.0000 448 | 6/9
25 h-m-p 0.0160 8.0000 0.0000 -----Y 793.856585 0 0.0000 465 | 6/9
26 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
27 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856585 m 8.0000 509 | 6/9
28 h-m-p 0.0062 3.1016 0.2617 ---------C 793.856585 0 0.0000 533 | 6/9
29 h-m-p 0.0160 8.0000 0.0007 +++++ 793.856584 m 8.0000 551 | 6/9
30 h-m-p 0.0189 2.3091 0.3142 -------------.. | 6/9
31 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856584 m 8.0000 595 | 6/9
32 h-m-p 0.0064 3.1808 0.2584 -----------Y 793.856584 0 0.0000 621 | 6/9
33 h-m-p 0.0160 8.0000 0.0026 +++++ 793.856581 m 8.0000 639 | 6/9
34 h-m-p 0.0736 2.7078 0.2789 --------------.. | 6/9
35 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856580 m 8.0000 684 | 6/9
36 h-m-p 0.0069 3.4384 0.2477 -------------.. | 6/9
37 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856580 m 8.0000 728 | 6/9
38 h-m-p 0.0068 3.3796 0.2525 ----------C 793.856580 0 0.0000 753 | 6/9
39 h-m-p 0.0160 8.0000 0.0010 +++++ 793.856579 m 8.0000 771 | 6/9
40 h-m-p 0.0282 3.2086 0.2831 --------------.. | 6/9
41 h-m-p 0.0160 8.0000 0.0002 +++++ 793.856579 m 8.0000 816 | 6/9
42 h-m-p 0.0070 3.5000 0.2470 ----------C 793.856579 0 0.0000 841 | 6/9
43 h-m-p 0.0160 8.0000 0.0141 +++++ 793.856551 m 8.0000 859 | 6/9
44 h-m-p 0.3942 3.7402 0.2861 ---------------.. | 6/9
45 h-m-p 0.0160 8.0000 0.0003 +++++ 793.856550 m 8.0000 905 | 6/9
46 h-m-p 0.0122 4.7520 0.2056 ----------C 793.856550 0 0.0000 930 | 6/9
47 h-m-p 0.0160 8.0000 0.0021 +++++ 793.856545 m 8.0000 948 | 6/9
48 h-m-p 0.0724 6.0498 0.2296 --------------.. | 6/9
49 h-m-p 0.0160 8.0000 0.0003 +++++ 793.856544 m 8.0000 993 | 6/9
50 h-m-p 0.0138 4.9695 0.1990 ---------Y 793.856544 0 0.0000 1017 | 6/9
51 h-m-p 0.0160 8.0000 0.0024 +++++ 793.856538 m 8.0000 1035 | 6/9
52 h-m-p 0.0839 4.1955 0.2282 ------------Y 793.856538 0 0.0000 1062 | 6/9
53 h-m-p 0.0049 2.4347 0.0110 +++++ 793.856528 m 2.4347 1080 | 7/9
54 h-m-p 0.1180 4.1044 0.2164 ------------Y 793.856528 0 0.0000 1107 | 7/9
55 h-m-p 0.0160 8.0000 0.0007 +++++ 793.856526 m 8.0000 1124 | 7/9
56 h-m-p 0.0187 2.8425 0.2824 ----------C 793.856526 0 0.0000 1148 | 7/9
57 h-m-p 0.0160 8.0000 0.0002 ---------C 793.856526 0 0.0000 1171 | 7/9
58 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
59 h-m-p 0.0160 8.0000 0.0004 +++++ 793.856525 m 8.0000 1213 | 7/9
60 h-m-p 0.0111 3.3111 0.2566 ----------C 793.856525 0 0.0000 1237 | 7/9
61 h-m-p 0.0160 8.0000 0.0014 +++++ 793.856521 m 8.0000 1254 | 7/9
62 h-m-p 0.0385 2.8869 0.2840 ----------Y 793.856521 0 0.0000 1278 | 7/9
63 h-m-p 0.0160 8.0000 0.0015 +++++ 793.856517 m 8.0000 1295 | 7/9
64 h-m-p 0.0457 3.0658 0.2692 ----------Y 793.856517 0 0.0000 1319 | 7/9
65 h-m-p 0.0160 8.0000 0.0035 -------------.. | 7/9
66 h-m-p 0.0160 8.0000 0.0004 +++++ 793.856516 m 8.0000 1361 | 7/9
67 h-m-p 0.0127 3.5643 0.2460 ----------Y 793.856516 0 0.0000 1385 | 7/9
68 h-m-p 0.0160 8.0000 0.0006 +++++ 793.856514 m 8.0000 1402 | 7/9
69 h-m-p 0.0152 1.2931 0.3378 -------------.. | 7/9
70 h-m-p 0.0160 8.0000 0.0004 +++++ 793.856513 m 8.0000 1444 | 7/9
71 h-m-p 0.0132 3.6423 0.2428 -----------N 793.856513 0 0.0000 1469 | 7/9
72 h-m-p 0.0160 8.0000 0.0016 +++++ 793.856508 m 8.0000 1486 | 7/9
73 h-m-p 0.0478 3.2104 0.2671 --------------.. | 7/9
74 h-m-p 0.0160 8.0000 0.0004 +++++ 793.856507 m 8.0000 1529 | 7/9
75 h-m-p 0.0145 3.8121 0.2362 -----------Y 793.856507 0 0.0000 1554 | 7/9
76 h-m-p 0.0160 8.0000 0.0024 +++++ 793.856499 m 8.0000 1571 | 7/9
77 h-m-p 0.0749 3.4564 0.2522 ------------Y 793.856499 0 0.0000 1597 | 7/9
78 h-m-p 0.0160 8.0000 0.0011 ------------Y 793.856499 0 0.0000 1623 | 7/9
79 h-m-p 0.0160 8.0000 0.0004 ------------Y 793.856499 0 0.0000 1649
Out..
lnL = -793.856499
1650 lfun, 4950 eigenQcodon, 19800 P(t)
Time used: 0:06
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010551 0.066640 0.064315 0.079576 0.047326 0.070979 0.203460 1.428537 0.307301 0.160416 1.349916
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.076653
np = 11
lnL0 = -856.258844
Iterating by ming2
Initial: fx= 856.258844
x= 0.01055 0.06664 0.06431 0.07958 0.04733 0.07098 0.20346 1.42854 0.30730 0.16042 1.34992
1 h-m-p 0.0000 0.0001 421.4855 ++ 845.380309 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 246.7951 ++ 811.497477 m 0.0007 30 | 2/11
3 h-m-p 0.0010 0.0049 42.8571 ++ 806.421553 m 0.0049 44 | 3/11
4 h-m-p 0.0000 0.0001 1715.6270 ++ 801.641494 m 0.0001 58 | 4/11
5 h-m-p 0.0000 0.0001 2904.0567 ++ 798.361772 m 0.0001 72 | 5/11
6 h-m-p 0.0001 0.0004 233.5076 ++ 797.029129 m 0.0004 86 | 6/11
7 h-m-p 0.0000 0.0000 2549.6089 ++ 796.181986 m 0.0000 100 | 7/11
8 h-m-p 0.0007 0.0036 30.9565 ++ 793.856561 m 0.0036 114 | 8/11
9 h-m-p 1.6000 8.0000 0.0002 ++ 793.856561 m 8.0000 128 | 8/11
10 h-m-p 0.0135 6.7471 0.1367 ---------N 793.856561 0 0.0000 154 | 8/11
11 h-m-p 0.0160 8.0000 0.0002 ----C 793.856561 0 0.0000 175 | 8/11
12 h-m-p 0.0160 8.0000 0.0004 +++++ 793.856561 m 8.0000 195 | 8/11
13 h-m-p 0.0028 1.3773 2.5502 -----------Y 793.856561 0 0.0000 223 | 8/11
14 h-m-p 0.0160 8.0000 0.0002 --------N 793.856561 0 0.0000 245 | 8/11
15 h-m-p 0.0160 8.0000 0.0024 +++++ 793.856560 m 8.0000 265 | 8/11
16 h-m-p 0.0160 8.0000 4.2689 -------------.. | 8/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 793.856560 m 8.0000 310 | 8/11
18 h-m-p 0.0151 7.5541 0.2247 +++++ 793.856425 m 7.5541 330 | 9/11
19 h-m-p 0.2251 8.0000 6.8290 ++Y 793.856358 0 3.6020 349 | 9/11
20 h-m-p 1.6000 8.0000 0.0000 Y 793.856358 0 1.6000 363 | 9/11
21 h-m-p 0.0160 8.0000 0.0000 N 793.856358 0 0.0160 379
Out..
lnL = -793.856358
380 lfun, 1520 eigenQcodon, 6840 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -793.894114 S = -793.857120 -0.014247
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:08
did 20 / 54 patterns 0:08
did 30 / 54 patterns 0:08
did 40 / 54 patterns 0:08
did 50 / 54 patterns 0:08
did 54 / 54 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052151 0.025865 0.064134 0.096987 0.016887 0.073869 0.000100 0.589481 1.083204
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.579101
np = 9
lnL0 = -855.350082
Iterating by ming2
Initial: fx= 855.350082
x= 0.05215 0.02586 0.06413 0.09699 0.01689 0.07387 0.00011 0.58948 1.08320
1 h-m-p 0.0000 0.0000 437.4306 ++ 854.978151 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0047 70.0341 +++++ 835.637826 m 0.0047 29 | 2/9
3 h-m-p 0.0000 0.0001 298.4206 ++ 832.939048 m 0.0001 41 | 3/9
4 h-m-p 0.0000 0.0003 854.8773 ++ 824.269612 m 0.0003 53 | 4/9
5 h-m-p 0.0001 0.0003 289.9571 ++ 807.238149 m 0.0003 65 | 5/9
6 h-m-p 0.0000 0.0002 72.7197 ++ 805.608373 m 0.0002 77 | 6/9
7 h-m-p 0.0001 0.0003 72.7448 ++ 801.089665 m 0.0003 89 | 7/9
8 h-m-p 0.0160 8.0000 1.0977 -------------.. | 7/9
9 h-m-p 0.0000 0.0002 179.9874 +++ 793.856358 m 0.0002 125 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ----Y 793.856358 0 0.0016 141 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 -Y 793.856358 0 0.1000 155
Out..
lnL = -793.856358
156 lfun, 1716 eigenQcodon, 9360 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089431 0.105101 0.034190 0.018586 0.016948 0.010849 0.000100 0.900000 0.591768 1.027954 1.300057
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.305958
np = 11
lnL0 = -845.111180
Iterating by ming2
Initial: fx= 845.111180
x= 0.08943 0.10510 0.03419 0.01859 0.01695 0.01085 0.00011 0.90000 0.59177 1.02795 1.30006
1 h-m-p 0.0000 0.0000 437.4384 ++ 844.591293 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0018 88.6233 ++++ 831.794190 m 0.0018 32 | 2/11
3 h-m-p 0.0000 0.0001 216.8797 ++ 826.351235 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0001 295.2575 ++ 824.790901 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0001 534.9736 ++ 816.732990 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0003 1330.7331 ++ 796.676358 m 0.0003 88 | 6/11
7 h-m-p 0.0000 0.0000 12033.8797 ++ 796.008718 m 0.0000 102 | 7/11
8 h-m-p 0.0025 0.0573 3.5454 ------------.. | 7/11
9 h-m-p 0.0000 0.0001 189.8839 ++ 793.856509 m 0.0001 140 | 8/11
10 h-m-p 0.6675 8.0000 0.0000 ++ 793.856509 m 8.0000 154 | 8/11
11 h-m-p 0.0200 8.0000 0.0106 ----------Y 793.856509 0 0.0000 181 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 793.856509 m 8.0000 201 | 8/11
13 h-m-p 0.0021 1.0665 1.2267 ----------N 793.856509 0 0.0000 228 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 793.856509 m 8.0000 245 | 8/11
15 h-m-p 0.0160 8.0000 0.0145 +++++ 793.856506 m 8.0000 265 | 8/11
16 h-m-p 0.0788 0.8986 1.4694 ------------N 793.856506 0 0.0000 294 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 --Y 793.856506 0 0.0003 310 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 -------N 793.856506 0 0.0000 334
Out..
lnL = -793.856506
335 lfun, 4020 eigenQcodon, 22110 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -793.883809 S = -793.854990 -0.012703
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:16
did 20 / 54 patterns 0:16
did 30 / 54 patterns 0:16
did 40 / 54 patterns 0:16
did 50 / 54 patterns 0:16
did 54 / 54 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=203
NC_011896_1_WP_010907477_1_27_MLBR_RS00145 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
NC_002677_1_NP_301152_1_24_ML0028 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
*************************************************
NC_011896_1_WP_010907477_1_27_MLBR_RS00145 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
NC_002677_1_NP_301152_1_24_ML0028 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
**************************************************
NC_011896_1_WP_010907477_1_27_MLBR_RS00145 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
NC_002677_1_NP_301152_1_24_ML0028 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
**************************************************
NC_011896_1_WP_010907477_1_27_MLBR_RS00145 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
NC_002677_1_NP_301152_1_24_ML0028 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
**************************************************
NC_011896_1_WP_010907477_1_27_MLBR_RS00145 RNo
NC_002677_1_NP_301152_1_24_ML0028 RNo
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 RNo
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 RNo
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 RN-
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 RN-
**
>NC_011896_1_WP_010907477_1_27_MLBR_RS00145 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC--- >NC_002677_1_NP_301152_1_24_ML0028 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC--- >NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC--- >NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC--- >NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC--- >NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT CGGAAC---
>NC_011896_1_WP_010907477_1_27_MLBR_RS00145 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN >NC_002677_1_NP_301152_1_24_ML0028 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN >NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN >NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795 -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN >NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN >NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150 VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS RN
#NEXUS
[ID: 0234010496]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907477_1_27_MLBR_RS00145
NC_002677_1_NP_301152_1_24_ML0028
NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105
NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795
NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150
NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907477_1_27_MLBR_RS00145,
2 NC_002677_1_NP_301152_1_24_ML0028,
3 NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105,
4 NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795,
5 NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150,
6 NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0682116,2:0.06999569,3:0.07136434,4:0.0710933,5:0.07282863,6:0.06902814);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0682116,2:0.06999569,3:0.07136434,4:0.0710933,5:0.07282863,6:0.06902814);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.38 -828.35
2 -825.42 -828.56
--------------------------------------
TOTAL -825.40 -828.46
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901604 0.088183 0.396747 1.500094 0.868948 1409.32 1455.16 1.002
r(A<->C){all} 0.171104 0.021076 0.000518 0.461898 0.131141 205.47 257.64 1.000
r(A<->G){all} 0.164637 0.020718 0.000059 0.459948 0.124544 136.36 186.17 1.005
r(A<->T){all} 0.161592 0.019414 0.000052 0.449335 0.121403 134.20 193.38 1.000
r(C<->G){all} 0.172399 0.021348 0.000011 0.465222 0.134683 208.29 245.02 1.000
r(C<->T){all} 0.166758 0.020073 0.000129 0.442985 0.126408 140.97 216.17 1.000
r(G<->T){all} 0.163510 0.019377 0.000043 0.434731 0.126592 246.98 248.48 1.001
pi(A){all} 0.180132 0.000233 0.151356 0.210085 0.179543 1483.92 1492.46 1.000
pi(C){all} 0.252540 0.000301 0.218274 0.287209 0.251898 1419.45 1460.23 1.000
pi(G){all} 0.341257 0.000365 0.300246 0.374221 0.341106 1229.98 1239.71 1.000
pi(T){all} 0.226071 0.000287 0.193696 0.260033 0.225589 1317.24 1409.12 1.000
alpha{1,2} 0.422840 0.237587 0.000144 1.390076 0.248059 1349.01 1356.67 1.000
alpha{3} 0.468720 0.252501 0.000185 1.393501 0.309036 1153.43 1220.59 1.000
pinvar{all} 0.997365 0.000010 0.991328 0.999999 0.998384 1066.75 1199.47 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0028/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 201
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 4 4 4 4 4 4 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 4 4 4 4 4 4 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4
CTC 2 2 2 2 2 2 | CCC 3 3 3 3 3 3 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 11 11 11 11 11 11 | CCG 9 9 9 9 9 9 | CAG 3 3 3 3 3 3 | CGG 9 9 9 9 9 9
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 8 8 8 8 8 8 | Gly GGT 6 6 6 6 6 6
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 7 7 7 7 7 7 | GGC 6 6 6 6 6 6
GTA 1 1 1 1 1 1 | GCA 6 6 6 6 6 6 | Glu GAA 5 5 5 5 5 5 | GGA 1 1 1 1 1 1
GTG 13 13 13 13 13 13 | GCG 8 8 8 8 8 8 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907477_1_27_MLBR_RS00145
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
#2: NC_002677_1_NP_301152_1_24_ML0028
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
#3: NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
#4: NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
#5: NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
#6: NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 12 | TCC 0 | TAC 12 | TGC 0
Leu L TTA 24 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 24 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 24
CTC 12 | CCC 18 | CAC 6 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 12 | CGA 0
CTG 66 | CCG 54 | CAG 18 | CGG 54
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 36 | ACC 18 | AAC 30 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 48 | Gly G GGT 36
GTC 30 | GCC 30 | GAC 42 | GGC 36
GTA 6 | GCA 36 | Glu E GAA 30 | GGA 6
GTG 78 | GCG 48 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13433 C:0.27363 A:0.17910 G:0.41294
position 2: T:0.33333 C:0.23383 A:0.23383 G:0.19900
position 3: T:0.20896 C:0.25373 A:0.12935 G:0.40796
Average T:0.22554 C:0.25373 A:0.18076 G:0.33997
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -793.856644 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300336 1.300057
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907477_1_27_MLBR_RS00145: 0.000004, NC_002677_1_NP_301152_1_24_ML0028: 0.000004, NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105: 0.000004, NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795: 0.000004, NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150: 0.000004, NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30034
omega (dN/dS) = 1.30006
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 451.0 152.0 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -793.856499 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.203460 0.868641 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907477_1_27_MLBR_RS00145: 0.000004, NC_002677_1_NP_301152_1_24_ML0028: 0.000004, NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105: 0.000004, NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795: 0.000004, NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150: 0.000004, NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.20346
MLEs of dN/dS (w) for site classes (K=2)
p: 0.86864 0.13136
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
7..2 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
7..3 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
7..4 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
7..5 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
7..6 0.000 452.7 150.3 0.1314 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -793.856358 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907477_1_27_MLBR_RS00145: 0.000004, NC_002677_1_NP_301152_1_24_ML0028: 0.000004, NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105: 0.000004, NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795: 0.000004, NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150: 0.000004, NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907477_1_27_MLBR_RS00145)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -793.856358 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.996675
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907477_1_27_MLBR_RS00145: 0.000004, NC_002677_1_NP_301152_1_24_ML0028: 0.000004, NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105: 0.000004, NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795: 0.000004, NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150: 0.000004, NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.99668
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 457.0 146.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -793.856506 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.861493 0.005000 1.285496 1.566879
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907477_1_27_MLBR_RS00145: 0.000004, NC_002677_1_NP_301152_1_24_ML0028: 0.000004, NZ_LVXE01000010_1_WP_010907477_1_292_A3216_RS05105: 0.000004, NZ_LYPH01000099_1_WP_010907477_1_2859_A8144_RS13795: 0.000004, NZ_CP029543_1_WP_111480934_1_27_DIJ64_RS00150: 0.000004, NZ_AP014567_1_WP_111480934_1_27_JK2ML_RS00150: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.86149 p = 0.00500 q = 1.28550
(p1 = 0.13851) w = 1.56688
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08615 0.08615 0.08615 0.08615 0.08615 0.08615 0.08615 0.08615 0.08615 0.08615 0.13851
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.56688
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
7..2 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
7..3 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
7..4 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
7..5 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
7..6 0.000 457.0 146.0 0.2170 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907477_1_27_MLBR_RS00145)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907477_1_27_MLBR_RS00145)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:17
Model 1: NearlyNeutral -793.856499 Model 2: PositiveSelection -793.856358 Model 0: one-ratio -793.856644 Model 7: beta -793.856358 Model 8: beta&w>1 -793.856506 Model 0 vs 1 2.899999999499414E-4 Model 2 vs 1 2.8199999997013947E-4 Model 8 vs 7 2.9599999993479287E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
