--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:18:05 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0028/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -825.38          -828.35
2       -825.42          -828.56
--------------------------------------
TOTAL     -825.40          -828.46
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.901604    0.088183    0.396747    1.500094    0.868948   1409.32   1455.16    1.002
r(A<->C){all}   0.171104    0.021076    0.000518    0.461898    0.131141    205.47    257.64    1.000
r(A<->G){all}   0.164637    0.020718    0.000059    0.459948    0.124544    136.36    186.17    1.005
r(A<->T){all}   0.161592    0.019414    0.000052    0.449335    0.121403    134.20    193.38    1.000
r(C<->G){all}   0.172399    0.021348    0.000011    0.465222    0.134683    208.29    245.02    1.000
r(C<->T){all}   0.166758    0.020073    0.000129    0.442985    0.126408    140.97    216.17    1.000
r(G<->T){all}   0.163510    0.019377    0.000043    0.434731    0.126592    246.98    248.48    1.001
pi(A){all}      0.180132    0.000233    0.151356    0.210085    0.179543   1483.92   1492.46    1.000
pi(C){all}      0.252540    0.000301    0.218274    0.287209    0.251898   1419.45   1460.23    1.000
pi(G){all}      0.341257    0.000365    0.300246    0.374221    0.341106   1229.98   1239.71    1.000
pi(T){all}      0.226071    0.000287    0.193696    0.260033    0.225589   1317.24   1409.12    1.000
alpha{1,2}      0.422840    0.237587    0.000144    1.390076    0.248059   1349.01   1356.67    1.000
alpha{3}        0.468720    0.252501    0.000185    1.393501    0.309036   1153.43   1220.59    1.000
pinvar{all}     0.997365    0.000010    0.991328    0.999999    0.998384   1066.75   1199.47    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-793.856499
Model 2: PositiveSelection	-793.856358
Model 0: one-ratio	-793.856644
Model 7: beta	-793.856358
Model 8: beta&w>1	-793.856506


Model 0 vs 1	2.899999999499414E-4

Model 2 vs 1	2.8199999997013947E-4

Model 8 vs 7	2.9599999993479287E-4
>C1
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C2
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C3
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C4
VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
No
>C5
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C6
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=203 

C1              -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C2              -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C3              -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C4              -VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C5              VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
C6              VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
                 *************************************************

C1              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C2              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C3              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C4              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C5              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
C6              TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
                **************************************************

C1              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C2              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C3              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C4              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C5              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
C6              GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
                **************************************************

C1              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C2              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C3              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C4              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C5              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
C6              KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
                **************************************************

C1              RNo
C2              RNo
C3              RNo
C4              RNo
C5              RN-
C6              RN-
                ** 




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  202 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  202 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6124]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6124]--->[6124]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.471 Mb, Max= 30.737 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C2              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C3              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C4              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C5              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
C6              VIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGGT
                **************************************************

C1              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C2              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C3              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C4              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C5              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
C6              LGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRIG
                **************************************************

C1              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C2              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C3              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C4              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C5              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
C6              ADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQLK
                **************************************************

C1              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C2              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C3              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C4              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C5              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
C6              GEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVSR
                **************************************************

C1              N
C2              N
C3              N
C4              N
C5              N
C6              N
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C2              ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C3              ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C4              ---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C5              GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
C6              GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
                   ***********************************************

C1              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C2              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C3              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C4              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C5              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
C6              GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
                **************************************************

C1              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C2              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C3              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C4              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C5              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
C6              CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
                **************************************************

C1              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C2              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C3              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C4              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C5              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
C6              ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
                **************************************************

C1              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C2              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C3              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C4              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C5              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
C6              GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
                **************************************************

C1              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C2              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C3              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C4              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C5              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
C6              GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
                **************************************************

C1              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C2              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C3              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C4              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C5              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
C6              GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
                **************************************************

C1              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C2              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C3              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C4              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C5              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
C6              GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
                **************************************************

C1              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C2              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C3              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C4              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C5              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
C6              ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
                **************************************************

C1              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C2              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C3              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C4              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C5              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
C6              AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
                **************************************************

C1              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C2              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C3              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C4              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C5              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
C6              TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
                **************************************************

C1              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C2              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C3              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C4              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C5              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
C6              GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
                **************************************************

C1              CGGAAC---
C2              CGGAAC---
C3              CGGAAC---
C4              CGGAAC---
C5              CGGAAC---
C6              CGGAAC---
                ******   



>C1
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C2
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C3
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C4
---GTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C5
GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C6
GTGGTGATCCGGCCTGAAGACCCCGAAGATTATGTTGCACCCGCCGCGCA
GAGGGTGCGTGCAGGTACGTTGCTGTTAGCCAACACTGATCTTCTTGAAC
CGACGTTTCGGCGTAGCGTGATCTACATAGTAGAGCATAACGAGGGCGGC
ACCTTGGGCGTGGTGCTCAACCGGCCAAGCGAGACCGCGGTCTATAACGT
GTTACCGCAATGGGCAAAACTGGCGGCCAAACCGAAAACGATGTTCATTG
GGGGTCCGGTGAAGCGTGACGCAGCCCTGTGTCTAGCGGTGTTGCGGATC
GGCGCTGATCCGGACGGTGTCGCGGGTTTACGGCATGTGGCGGGCCGGCT
GGTGATGGTCGATCTGGATGCCGAACCGGATTTGATCGCACCGCTGGTGG
ATGGTTTACGGATCTTCGTGGGGTACTCGGGCTGGACCATTGGTCAGCTC
AAAGGAGAAATTGAGCGTGACGACTGGATTGTGCTGTCGGCGTTGCCCTC
TGACGTCTTGGTTGGGAAGCGGGCTGATCTGTGGGCACAGGTTCTTCGCC
GCCAACCGCTGTTGCTGTCGCTGCTTGCGACTCACCCGATCGACGTCAGT
CGGAAC---
>C1
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C2
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C3
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C4
oVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C5
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN
>C6
VVIRPEDPEDYVAPAAQRVRAGTLLLANTDLLEPTFRRSVIYIVEHNEGG
TLGVVLNRPSETAVYNVLPQWAKLAAKPKTMFIGGPVKRDAALCLAVLRI
GADPDGVAGLRHVAGRLVMVDLDAEPDLIAPLVDGLRIFVGYSGWTIGQL
KGEIERDDWIVLSALPSDVLVGKRADLWAQVLRRQPLLLSLLATHPIDVS
RN


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 609 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788996
      Setting output file names to "/data/3res/ML0028/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1820691627
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0234010496
      Seed = 1032634463
      Swapseed = 1579788996
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 6 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 6 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1355.030149 -- -24.965149
         Chain 2 -- -1354.540462 -- -24.965149
         Chain 3 -- -1354.540463 -- -24.965149
         Chain 4 -- -1355.030228 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1355.030149 -- -24.965149
         Chain 2 -- -1354.792118 -- -24.965149
         Chain 3 -- -1354.792118 -- -24.965149
         Chain 4 -- -1354.274669 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1355.030] (-1354.540) (-1354.540) (-1355.030) * [-1355.030] (-1354.792) (-1354.792) (-1354.275) 
        500 -- (-846.834) [-835.297] (-835.803) (-837.852) * (-839.126) [-835.681] (-841.840) (-839.066) -- 0:00:00
       1000 -- (-845.234) (-840.883) (-841.571) [-828.987] * (-830.489) (-842.249) (-834.143) [-828.075] -- 0:00:00
       1500 -- (-838.391) (-836.877) [-837.765] (-839.048) * [-833.476] (-837.029) (-832.022) (-843.382) -- 0:00:00
       2000 -- (-833.344) [-837.393] (-830.683) (-835.724) * [-834.250] (-833.070) (-837.491) (-834.494) -- 0:00:00
       2500 -- [-830.336] (-834.715) (-833.079) (-841.305) * [-830.771] (-838.395) (-833.515) (-835.547) -- 0:00:00
       3000 -- (-832.402) (-833.385) [-842.762] (-834.221) * [-833.890] (-833.814) (-836.969) (-837.782) -- 0:05:32
       3500 -- (-836.201) (-833.149) (-833.902) [-831.366] * [-830.327] (-832.487) (-831.048) (-835.253) -- 0:04:44
       4000 -- (-842.252) [-831.517] (-831.864) (-838.959) * (-828.054) [-832.233] (-840.988) (-831.934) -- 0:04:09
       4500 -- (-845.714) (-840.417) [-832.704] (-831.537) * (-835.196) (-839.527) (-835.051) [-833.177] -- 0:03:41
       5000 -- (-829.154) (-838.100) (-842.669) [-831.226] * (-836.100) (-834.522) (-835.631) [-832.637] -- 0:03:19

      Average standard deviation of split frequencies: 0.071425

       5500 -- [-834.490] (-832.669) (-834.998) (-829.094) * (-836.749) (-838.547) (-834.567) [-837.461] -- 0:03:00
       6000 -- (-837.597) (-834.370) (-838.793) [-828.534] * (-836.582) (-834.696) [-833.873] (-832.400) -- 0:02:45
       6500 -- (-832.487) (-831.640) (-839.323) [-838.538] * [-834.077] (-837.770) (-837.877) (-836.021) -- 0:02:32
       7000 -- (-838.046) (-833.940) [-833.171] (-839.829) * (-836.460) (-837.210) (-837.619) [-840.578] -- 0:02:21
       7500 -- (-836.343) [-833.941] (-835.955) (-833.503) * (-838.826) (-836.548) [-833.532] (-830.215) -- 0:02:12
       8000 -- [-838.239] (-833.738) (-836.985) (-837.954) * (-842.115) (-836.796) (-836.529) [-835.634] -- 0:02:04
       8500 -- (-827.163) [-832.387] (-831.996) (-843.813) * (-834.977) (-833.095) (-832.808) [-834.323] -- 0:01:56
       9000 -- (-829.635) (-847.616) [-837.735] (-831.014) * (-833.501) [-835.186] (-841.095) (-828.315) -- 0:01:50
       9500 -- (-843.664) (-828.757) (-838.259) [-835.576] * (-831.801) (-837.986) [-835.455] (-839.520) -- 0:01:44
      10000 -- (-834.859) (-828.596) (-830.096) [-833.408] * (-839.449) (-837.435) [-835.651] (-839.828) -- 0:01:39

      Average standard deviation of split frequencies: 0.081759

      10500 -- [-836.428] (-837.850) (-848.003) (-837.770) * (-838.036) [-838.044] (-833.509) (-835.958) -- 0:01:34
      11000 -- [-832.647] (-834.730) (-830.259) (-831.939) * (-838.735) (-830.778) [-838.829] (-841.188) -- 0:01:29
      11500 -- (-838.456) (-832.876) [-830.252] (-853.535) * (-837.269) (-840.080) [-834.217] (-825.634) -- 0:01:25
      12000 -- (-828.938) [-830.209] (-832.778) (-842.286) * (-833.486) (-840.883) (-833.492) [-825.984] -- 0:01:22
      12500 -- (-837.999) (-841.438) (-834.932) [-839.001] * [-836.291] (-844.927) (-841.525) (-825.443) -- 0:01:19
      13000 -- [-836.616] (-832.956) (-840.795) (-840.426) * (-837.807) (-836.173) [-838.530] (-827.298) -- 0:01:15
      13500 -- [-829.521] (-834.986) (-839.960) (-836.312) * (-837.209) (-839.616) [-831.258] (-828.195) -- 0:01:13
      14000 -- [-836.759] (-833.632) (-839.679) (-836.866) * [-828.539] (-847.389) (-835.645) (-826.347) -- 0:01:10
      14500 -- (-839.413) [-840.442] (-837.985) (-836.118) * (-837.638) [-836.548] (-838.019) (-825.493) -- 0:01:07
      15000 -- (-835.100) [-830.360] (-829.422) (-835.674) * (-842.855) (-837.976) (-825.864) [-827.191] -- 0:01:05

      Average standard deviation of split frequencies: 0.057289

      15500 -- (-833.257) (-832.852) [-840.644] (-836.254) * (-836.026) (-836.049) [-827.850] (-827.016) -- 0:01:03
      16000 -- [-832.355] (-836.556) (-839.421) (-835.869) * (-835.104) [-835.866] (-826.639) (-829.149) -- 0:02:03
      16500 -- [-833.941] (-838.217) (-840.688) (-836.596) * (-835.459) [-830.725] (-827.464) (-825.780) -- 0:01:59
      17000 -- (-835.854) (-835.915) [-837.163] (-842.693) * (-834.810) (-843.128) [-826.240] (-826.657) -- 0:01:55
      17500 -- (-836.912) (-842.884) (-833.335) [-833.919] * (-837.684) (-843.361) [-825.988] (-826.519) -- 0:01:52
      18000 -- (-835.672) (-835.794) [-831.626] (-834.235) * (-839.212) (-836.456) [-827.012] (-825.035) -- 0:01:49
      18500 -- [-836.991] (-838.126) (-838.369) (-840.311) * (-832.846) (-836.365) [-824.038] (-828.852) -- 0:01:46
      19000 -- (-842.423) (-841.023) (-836.849) [-832.231] * (-835.281) (-837.452) (-824.370) [-833.750] -- 0:01:43
      19500 -- [-833.461] (-832.053) (-837.765) (-838.690) * (-837.871) (-836.835) [-824.506] (-828.445) -- 0:01:40
      20000 -- [-838.373] (-835.845) (-832.432) (-831.492) * (-836.656) (-836.390) [-826.966] (-824.412) -- 0:01:38

      Average standard deviation of split frequencies: 0.052329

      20500 -- [-838.451] (-836.816) (-838.378) (-835.601) * (-838.110) (-833.131) [-824.038] (-825.456) -- 0:01:35
      21000 -- [-836.300] (-832.147) (-838.005) (-832.248) * (-843.164) (-841.484) [-825.089] (-828.214) -- 0:01:33
      21500 -- (-835.531) [-832.634] (-834.086) (-837.834) * (-835.212) [-830.600] (-825.362) (-825.128) -- 0:01:31
      22000 -- [-835.467] (-840.473) (-840.357) (-830.119) * [-839.880] (-841.371) (-826.586) (-825.049) -- 0:01:28
      22500 -- (-835.534) (-836.750) (-832.875) [-831.899] * (-833.534) (-825.986) (-828.625) [-825.017] -- 0:01:26
      23000 -- (-838.924) [-835.693] (-832.754) (-826.771) * [-834.896] (-829.677) (-825.294) (-824.546) -- 0:01:24
      23500 -- (-832.443) (-837.254) [-832.537] (-830.283) * (-829.888) [-827.580] (-825.687) (-824.518) -- 0:01:23
      24000 -- (-834.341) (-838.216) (-832.473) [-830.678] * (-833.741) (-825.457) (-825.073) [-826.011] -- 0:01:21
      24500 -- (-837.523) [-829.345] (-838.136) (-837.656) * (-843.679) (-824.258) (-832.493) [-827.969] -- 0:01:19
      25000 -- [-832.587] (-839.184) (-831.961) (-833.748) * [-828.557] (-824.481) (-834.371) (-826.278) -- 0:01:18

      Average standard deviation of split frequencies: 0.041207

      25500 -- [-834.496] (-838.507) (-832.415) (-843.755) * (-838.994) [-824.414] (-825.934) (-827.089) -- 0:01:16
      26000 -- (-832.812) (-835.102) [-842.583] (-836.399) * [-835.872] (-824.712) (-826.129) (-824.679) -- 0:01:14
      26500 -- (-834.385) (-837.841) [-832.705] (-833.499) * (-841.094) [-827.296] (-824.669) (-824.621) -- 0:01:13
      27000 -- [-834.536] (-844.087) (-850.944) (-828.803) * [-831.599] (-828.035) (-829.050) (-826.440) -- 0:01:12
      27500 -- (-842.326) (-839.467) [-834.944] (-835.862) * (-830.545) [-826.860] (-827.850) (-824.499) -- 0:01:10
      28000 -- (-837.302) [-831.736] (-836.881) (-833.946) * (-837.169) (-825.190) (-825.566) [-829.532] -- 0:01:09
      28500 -- (-830.446) (-845.996) [-834.132] (-834.670) * (-833.589) (-828.457) [-825.711] (-828.359) -- 0:01:42
      29000 -- (-838.328) [-831.998] (-834.986) (-835.714) * (-835.445) (-828.628) (-825.692) [-828.208] -- 0:01:40
      29500 -- (-833.851) [-831.622] (-832.084) (-837.258) * (-839.592) [-825.150] (-831.956) (-827.867) -- 0:01:38
      30000 -- [-835.743] (-837.291) (-834.475) (-837.941) * (-831.189) [-825.706] (-824.969) (-832.391) -- 0:01:37

      Average standard deviation of split frequencies: 0.036124

      30500 -- (-841.505) (-836.624) [-832.841] (-829.589) * [-833.204] (-824.579) (-826.487) (-827.441) -- 0:01:35
      31000 -- (-835.184) [-830.331] (-839.014) (-835.956) * [-836.222] (-825.714) (-825.038) (-825.953) -- 0:01:33
      31500 -- (-834.267) (-832.598) [-835.346] (-833.341) * (-843.821) [-824.094] (-827.274) (-826.014) -- 0:01:32
      32000 -- [-839.159] (-844.719) (-842.474) (-833.417) * (-837.082) (-827.267) (-827.186) [-826.102] -- 0:01:30
      32500 -- (-833.765) (-842.302) [-835.191] (-840.312) * (-835.760) (-830.457) [-826.819] (-825.890) -- 0:01:29
      33000 -- (-831.033) (-843.665) [-839.510] (-833.577) * [-834.643] (-829.456) (-825.336) (-825.135) -- 0:01:27
      33500 -- (-831.248) (-826.853) [-838.845] (-830.898) * (-841.144) (-824.868) (-824.409) [-825.424] -- 0:01:26
      34000 -- (-840.927) (-825.741) (-837.976) [-835.696] * (-840.210) [-825.863] (-826.824) (-831.231) -- 0:01:25
      34500 -- [-836.345] (-824.567) (-837.410) (-840.369) * [-830.606] (-826.676) (-824.131) (-825.709) -- 0:01:23
      35000 -- (-834.895) (-825.695) (-835.882) [-832.906] * [-829.617] (-828.410) (-826.754) (-826.648) -- 0:01:22

      Average standard deviation of split frequencies: 0.040011

      35500 -- (-832.668) [-830.113] (-837.193) (-839.539) * (-840.169) [-826.018] (-827.551) (-827.256) -- 0:01:21
      36000 -- (-829.842) (-825.328) [-833.610] (-842.872) * (-836.738) (-827.424) (-825.105) [-828.065] -- 0:01:20
      36500 -- [-834.827] (-825.194) (-839.179) (-838.570) * (-834.892) (-824.827) (-829.948) [-832.052] -- 0:01:19
      37000 -- [-832.604] (-825.732) (-832.876) (-836.647) * (-840.798) [-826.271] (-824.772) (-832.922) -- 0:01:18
      37500 -- (-844.202) (-826.526) (-835.928) [-835.563] * (-826.738) [-826.175] (-824.810) (-826.454) -- 0:01:17
      38000 -- (-839.457) (-824.359) (-833.018) [-834.788] * (-824.951) [-827.670] (-824.181) (-825.667) -- 0:01:15
      38500 -- [-829.935] (-826.300) (-836.307) (-833.992) * (-833.628) [-825.809] (-824.231) (-825.456) -- 0:01:14
      39000 -- [-840.742] (-829.832) (-840.444) (-832.287) * (-830.576) (-827.103) (-827.101) [-826.887] -- 0:01:13
      39500 -- (-832.411) [-824.413] (-837.554) (-835.762) * [-827.587] (-828.798) (-827.519) (-830.116) -- 0:01:12
      40000 -- (-834.599) (-828.153) [-836.399] (-831.087) * [-830.436] (-825.188) (-825.692) (-831.347) -- 0:01:12

      Average standard deviation of split frequencies: 0.032945

      40500 -- (-837.206) [-824.784] (-843.219) (-829.486) * (-824.958) [-825.394] (-824.643) (-825.537) -- 0:01:11
      41000 -- (-844.166) (-825.916) [-830.304] (-835.272) * (-825.156) [-830.014] (-827.891) (-825.520) -- 0:01:10
      41500 -- (-833.259) (-827.388) (-837.592) [-838.045] * (-824.521) (-827.701) [-826.833] (-824.806) -- 0:01:32
      42000 -- [-830.810] (-825.057) (-836.807) (-841.735) * [-826.514] (-831.606) (-833.167) (-826.178) -- 0:01:31
      42500 -- (-836.651) (-826.468) (-833.031) [-832.666] * [-828.817] (-827.522) (-830.158) (-825.826) -- 0:01:30
      43000 -- (-835.013) (-825.150) [-832.660] (-835.906) * (-829.452) (-829.176) [-826.302] (-825.174) -- 0:01:29
      43500 -- [-830.237] (-827.810) (-832.484) (-842.447) * (-829.307) [-831.007] (-826.088) (-828.413) -- 0:01:27
      44000 -- (-839.375) [-825.173] (-833.710) (-836.302) * (-825.450) (-828.477) (-829.679) [-826.162] -- 0:01:26
      44500 -- (-847.241) (-825.238) [-835.703] (-831.815) * (-826.460) (-826.281) [-824.675] (-827.008) -- 0:01:25
      45000 -- (-839.429) (-827.227) [-831.002] (-836.116) * [-827.337] (-825.891) (-825.601) (-829.636) -- 0:01:24

      Average standard deviation of split frequencies: 0.031720

      45500 -- [-833.344] (-830.675) (-837.380) (-831.382) * (-825.502) (-825.727) [-825.155] (-825.784) -- 0:01:23
      46000 -- [-834.789] (-827.722) (-836.134) (-839.509) * (-824.435) (-826.319) (-825.925) [-824.124] -- 0:01:22
      46500 -- (-834.295) (-826.325) (-838.101) [-830.429] * (-825.595) (-826.241) [-826.577] (-824.052) -- 0:01:22
      47000 -- [-834.839] (-826.589) (-837.238) (-848.328) * (-826.089) (-827.824) [-824.836] (-823.748) -- 0:01:21
      47500 -- (-832.026) (-826.103) (-835.351) [-832.707] * (-824.883) [-827.756] (-824.000) (-825.829) -- 0:01:20
      48000 -- (-831.103) (-825.256) (-832.565) [-833.232] * (-825.265) (-825.988) (-824.214) [-825.405] -- 0:01:19
      48500 -- (-840.050) [-826.036] (-837.130) (-836.574) * (-825.309) (-826.128) [-825.466] (-824.833) -- 0:01:18
      49000 -- [-836.514] (-826.419) (-842.722) (-835.260) * (-827.486) (-826.877) [-825.680] (-827.659) -- 0:01:17
      49500 -- (-834.947) [-827.902] (-845.528) (-839.502) * [-829.658] (-825.496) (-825.034) (-826.399) -- 0:01:16
      50000 -- (-841.235) (-829.470) (-844.638) [-833.476] * [-826.785] (-825.954) (-824.347) (-824.583) -- 0:01:16

      Average standard deviation of split frequencies: 0.037681

      50500 -- (-842.034) (-826.002) (-837.415) [-832.996] * [-824.374] (-826.488) (-824.477) (-831.046) -- 0:01:15
      51000 -- (-842.561) (-824.513) (-835.911) [-835.893] * (-824.849) [-827.413] (-827.152) (-828.306) -- 0:01:14
      51500 -- [-832.923] (-824.009) (-834.162) (-839.690) * (-824.655) (-824.580) [-824.342] (-827.484) -- 0:01:13
      52000 -- (-835.826) (-826.556) (-835.485) [-833.713] * (-825.983) (-826.165) [-825.908] (-824.325) -- 0:01:12
      52500 -- (-834.751) (-827.203) (-834.864) [-832.451] * (-825.198) [-828.595] (-826.282) (-824.406) -- 0:01:12
      53000 -- (-834.800) (-826.374) [-828.752] (-835.587) * [-825.707] (-828.860) (-824.727) (-828.919) -- 0:01:11
      53500 -- (-840.250) (-828.227) (-832.382) [-836.458] * [-825.512] (-826.144) (-827.129) (-832.486) -- 0:01:10
      54000 -- (-831.591) [-824.701] (-837.049) (-834.678) * (-826.533) [-828.641] (-830.870) (-829.393) -- 0:01:10
      54500 -- (-832.249) [-825.202] (-834.517) (-841.207) * (-825.764) (-826.181) (-826.659) [-826.272] -- 0:01:26
      55000 -- (-835.262) [-826.656] (-833.540) (-834.768) * [-824.542] (-825.993) (-827.835) (-824.621) -- 0:01:25

      Average standard deviation of split frequencies: 0.030127

      55500 -- [-834.808] (-825.847) (-836.197) (-840.598) * [-829.930] (-825.300) (-825.663) (-829.752) -- 0:01:25
      56000 -- (-840.056) (-827.726) [-830.232] (-845.217) * (-828.738) [-825.153] (-827.953) (-828.091) -- 0:01:24
      56500 -- [-833.857] (-826.144) (-840.902) (-839.952) * (-827.516) (-825.894) [-829.068] (-829.301) -- 0:01:23
      57000 -- (-834.156) [-829.191] (-837.592) (-836.027) * [-828.749] (-825.207) (-827.813) (-827.214) -- 0:01:22
      57500 -- [-836.239] (-827.634) (-836.026) (-837.033) * (-824.548) (-829.551) (-825.853) [-825.135] -- 0:01:21
      58000 -- [-830.377] (-825.461) (-836.609) (-837.499) * (-824.770) [-825.118] (-825.279) (-827.227) -- 0:01:21
      58500 -- (-828.606) (-824.738) (-846.648) [-835.378] * [-825.278] (-830.949) (-827.046) (-824.484) -- 0:01:20
      59000 -- (-835.457) [-825.422] (-835.151) (-842.796) * [-826.513] (-832.363) (-827.503) (-828.666) -- 0:01:19
      59500 -- [-840.930] (-827.222) (-839.241) (-836.799) * (-826.974) [-824.068] (-828.490) (-826.806) -- 0:01:19
      60000 -- [-835.119] (-827.233) (-831.389) (-836.291) * (-828.844) [-827.123] (-829.176) (-824.250) -- 0:01:18

      Average standard deviation of split frequencies: 0.031900

      60500 -- (-842.721) (-826.589) [-832.348] (-837.982) * (-826.534) (-826.039) (-830.143) [-826.190] -- 0:01:17
      61000 -- (-836.072) [-829.503] (-833.347) (-839.210) * (-826.930) (-824.333) (-825.066) [-826.970] -- 0:01:16
      61500 -- [-835.789] (-827.430) (-846.929) (-830.777) * (-826.420) (-825.439) (-826.173) [-825.719] -- 0:01:16
      62000 -- (-839.470) (-827.632) [-838.804] (-838.537) * (-826.634) [-825.872] (-825.168) (-827.123) -- 0:01:15
      62500 -- (-833.735) (-825.576) [-836.762] (-835.189) * (-826.436) (-828.572) [-825.933] (-826.627) -- 0:01:15
      63000 -- [-830.550] (-824.762) (-831.866) (-845.999) * (-826.548) [-826.700] (-824.340) (-826.726) -- 0:01:14
      63500 -- (-829.818) [-826.937] (-836.753) (-832.174) * (-826.871) (-826.151) [-825.070] (-825.425) -- 0:01:13
      64000 -- [-834.045] (-827.418) (-836.686) (-836.077) * (-828.092) [-824.303] (-826.932) (-829.341) -- 0:01:13
      64500 -- [-835.651] (-826.771) (-835.979) (-836.767) * (-824.847) (-824.591) (-827.153) [-826.231] -- 0:01:12
      65000 -- [-831.004] (-825.886) (-830.028) (-834.805) * (-825.052) (-827.406) [-826.394] (-825.585) -- 0:01:11

      Average standard deviation of split frequencies: 0.026529

      65500 -- [-834.294] (-828.323) (-832.938) (-835.919) * [-826.232] (-828.790) (-827.422) (-825.536) -- 0:01:11
      66000 -- [-831.805] (-826.847) (-834.478) (-835.066) * (-832.105) (-829.732) [-827.677] (-829.926) -- 0:01:10
      66500 -- (-838.809) (-825.151) [-836.573] (-843.244) * (-826.843) (-826.941) [-826.282] (-823.996) -- 0:01:10
      67000 -- (-841.688) [-825.842] (-842.480) (-831.497) * [-824.762] (-825.450) (-823.751) (-824.504) -- 0:01:09
      67500 -- (-833.244) [-825.937] (-833.926) (-840.538) * (-827.874) [-827.209] (-825.315) (-823.799) -- 0:01:09
      68000 -- (-836.439) (-823.949) [-834.073] (-832.656) * [-831.250] (-825.008) (-827.807) (-827.059) -- 0:01:08
      68500 -- [-832.312] (-828.115) (-835.347) (-828.254) * (-825.395) (-824.810) [-825.759] (-824.074) -- 0:01:21
      69000 -- (-840.851) (-827.017) (-834.270) [-832.101] * [-825.868] (-827.049) (-826.378) (-832.626) -- 0:01:20
      69500 -- (-836.308) (-830.558) (-834.382) [-838.688] * (-829.370) (-825.845) (-831.101) [-826.625] -- 0:01:20
      70000 -- (-835.724) (-826.029) [-836.969] (-836.772) * (-829.356) (-826.327) [-824.471] (-829.813) -- 0:01:19

      Average standard deviation of split frequencies: 0.028685

      70500 -- (-834.652) [-827.712] (-842.876) (-844.543) * (-827.494) (-825.173) (-826.373) [-825.419] -- 0:01:19
      71000 -- [-834.700] (-826.704) (-842.962) (-836.157) * (-824.858) (-825.919) [-828.245] (-828.114) -- 0:01:18
      71500 -- [-835.926] (-826.068) (-834.665) (-838.482) * (-826.675) (-826.804) (-825.023) [-826.951] -- 0:01:17
      72000 -- (-829.991) (-826.177) [-837.841] (-832.515) * (-828.777) (-827.794) [-825.287] (-827.987) -- 0:01:17
      72500 -- (-833.494) (-826.877) [-833.180] (-827.144) * [-824.955] (-828.615) (-825.477) (-827.127) -- 0:01:16
      73000 -- [-836.475] (-824.513) (-846.610) (-831.528) * (-825.453) (-827.426) (-827.771) [-825.857] -- 0:01:16
      73500 -- (-833.720) (-825.507) [-837.138] (-828.096) * (-824.480) (-827.624) (-826.211) [-826.289] -- 0:01:15
      74000 -- (-834.253) (-825.728) (-835.129) [-828.515] * (-825.912) (-825.095) [-827.460] (-825.767) -- 0:01:15
      74500 -- (-843.999) (-824.874) [-831.713] (-826.647) * (-825.071) (-828.583) (-824.731) [-826.773] -- 0:01:14
      75000 -- (-838.677) (-824.089) [-836.237] (-827.578) * [-826.222] (-826.091) (-828.335) (-830.703) -- 0:01:14

      Average standard deviation of split frequencies: 0.021399

      75500 -- (-836.429) (-825.874) [-833.002] (-827.424) * (-826.362) [-826.237] (-825.681) (-825.073) -- 0:01:13
      76000 -- (-832.280) (-828.832) [-837.190] (-827.077) * (-826.541) (-825.058) (-828.465) [-824.244] -- 0:01:12
      76500 -- (-836.748) (-828.256) [-832.505] (-828.936) * (-826.215) (-825.220) (-827.942) [-825.709] -- 0:01:12
      77000 -- (-833.285) (-826.913) [-834.875] (-826.808) * (-825.252) (-824.260) [-827.653] (-823.967) -- 0:01:11
      77500 -- (-845.541) [-825.267] (-836.799) (-825.860) * (-826.422) (-824.402) [-828.457] (-827.319) -- 0:01:11
      78000 -- (-837.316) [-826.200] (-832.646) (-828.025) * [-826.505] (-825.728) (-827.349) (-824.501) -- 0:01:10
      78500 -- (-838.630) [-829.959] (-840.087) (-827.883) * (-825.448) [-826.405] (-827.923) (-824.773) -- 0:01:10
      79000 -- (-836.820) [-829.410] (-833.902) (-826.251) * [-825.384] (-829.026) (-825.202) (-824.187) -- 0:01:09
      79500 -- (-839.261) [-827.684] (-836.438) (-826.594) * (-824.293) (-829.014) (-825.686) [-826.323] -- 0:01:09
      80000 -- (-850.993) [-825.798] (-844.272) (-826.219) * (-825.687) (-827.858) (-829.603) [-826.785] -- 0:01:09

      Average standard deviation of split frequencies: 0.026297

      80500 -- (-833.464) (-827.552) [-831.915] (-824.773) * (-826.206) [-824.598] (-825.410) (-828.612) -- 0:01:08
      81000 -- (-828.128) (-830.681) (-832.345) [-827.106] * (-825.267) (-826.893) [-825.211] (-826.971) -- 0:01:08
      81500 -- [-825.298] (-825.930) (-827.529) (-825.473) * (-825.268) [-830.498] (-826.109) (-830.198) -- 0:01:07
      82000 -- (-829.020) (-825.091) (-829.169) [-825.606] * (-826.096) (-826.192) [-824.931] (-830.057) -- 0:01:07
      82500 -- [-827.978] (-827.803) (-826.838) (-824.575) * [-824.670] (-825.828) (-825.230) (-825.103) -- 0:01:17
      83000 -- (-825.879) (-827.042) (-824.189) [-824.621] * [-826.033] (-826.465) (-826.011) (-825.980) -- 0:01:17
      83500 -- (-824.916) (-824.926) (-823.815) [-824.648] * (-824.562) [-829.329] (-824.422) (-828.969) -- 0:01:16
      84000 -- (-826.193) [-825.269] (-824.397) (-824.533) * (-826.188) (-824.835) (-829.714) [-824.164] -- 0:01:16
      84500 -- [-830.039] (-828.023) (-824.765) (-829.194) * (-825.033) (-828.735) [-824.811] (-824.940) -- 0:01:15
      85000 -- (-830.773) (-825.856) [-823.887] (-827.406) * [-824.192] (-832.268) (-824.295) (-824.944) -- 0:01:15

      Average standard deviation of split frequencies: 0.021926

      85500 -- (-827.474) (-828.216) [-825.774] (-826.264) * (-826.109) (-831.698) (-827.447) [-825.290] -- 0:01:14
      86000 -- [-826.599] (-827.333) (-824.337) (-824.973) * (-828.674) (-825.356) [-825.596] (-826.127) -- 0:01:14
      86500 -- (-826.608) [-828.209] (-828.259) (-824.516) * (-824.245) (-825.080) [-826.207] (-826.575) -- 0:01:13
      87000 -- (-824.836) (-825.870) [-826.389] (-826.542) * [-825.455] (-824.786) (-826.982) (-829.488) -- 0:01:13
      87500 -- (-827.959) (-825.133) [-829.269] (-827.122) * [-825.808] (-824.760) (-827.815) (-825.115) -- 0:01:13
      88000 -- (-824.647) (-827.607) (-827.544) [-825.825] * (-826.690) (-824.849) (-826.710) [-827.331] -- 0:01:12
      88500 -- [-825.451] (-831.238) (-826.431) (-827.020) * (-824.859) (-825.714) (-824.522) [-827.288] -- 0:01:12
      89000 -- [-826.159] (-830.151) (-824.749) (-828.495) * (-827.161) [-824.520] (-825.365) (-827.293) -- 0:01:11
      89500 -- (-824.091) (-824.144) (-824.802) [-831.030] * (-827.330) (-826.817) (-824.577) [-824.201] -- 0:01:11
      90000 -- (-824.485) (-825.163) [-825.372] (-825.196) * (-827.306) (-832.491) (-824.820) [-824.369] -- 0:01:10

      Average standard deviation of split frequencies: 0.022617

      90500 -- (-825.787) (-826.276) [-824.842] (-824.839) * (-829.090) [-829.740] (-825.540) (-825.321) -- 0:01:10
      91000 -- (-824.920) (-825.415) (-827.181) [-825.641] * [-829.393] (-825.257) (-828.732) (-827.082) -- 0:01:09
      91500 -- (-826.296) (-827.613) (-826.181) [-824.785] * (-824.270) [-824.648] (-828.807) (-824.303) -- 0:01:09
      92000 -- [-826.063] (-825.973) (-827.810) (-824.963) * (-826.511) [-829.296] (-826.530) (-825.593) -- 0:01:09
      92500 -- (-829.365) (-826.993) [-825.658] (-826.802) * (-825.165) (-827.246) [-825.214] (-825.840) -- 0:01:08
      93000 -- (-827.519) (-827.339) (-825.695) [-825.908] * (-825.421) (-829.371) [-824.673] (-825.549) -- 0:01:08
      93500 -- (-826.305) [-826.791] (-824.805) (-825.325) * (-825.628) (-829.368) (-832.947) [-827.511] -- 0:01:07
      94000 -- (-826.253) (-829.796) (-825.396) [-825.221] * [-826.672] (-829.403) (-830.100) (-827.158) -- 0:01:07
      94500 -- (-826.690) [-827.411] (-825.085) (-827.306) * (-826.772) (-824.089) [-824.144] (-827.099) -- 0:01:07
      95000 -- (-825.482) (-825.536) [-824.468] (-831.960) * (-825.171) (-826.325) (-828.231) [-825.094] -- 0:01:06

      Average standard deviation of split frequencies: 0.022343

      95500 -- (-824.243) (-825.837) [-825.235] (-824.701) * [-824.412] (-826.166) (-826.915) (-826.426) -- 0:01:06
      96000 -- (-824.088) (-825.174) [-825.752] (-828.822) * (-824.205) (-825.362) (-823.992) [-824.604] -- 0:01:05
      96500 -- (-824.873) (-826.612) (-824.483) [-827.750] * [-824.588] (-827.606) (-829.524) (-826.002) -- 0:01:05
      97000 -- [-826.391] (-826.420) (-829.549) (-828.936) * (-824.660) (-824.825) [-831.342] (-825.294) -- 0:01:14
      97500 -- (-826.272) (-827.483) (-825.443) [-827.344] * (-825.738) (-824.938) [-828.620] (-823.720) -- 0:01:14
      98000 -- (-826.461) (-826.726) [-824.716] (-825.405) * (-826.653) [-824.403] (-825.159) (-824.950) -- 0:01:13
      98500 -- (-826.623) (-824.605) [-826.366] (-830.643) * (-826.683) [-825.588] (-824.572) (-824.301) -- 0:01:13
      99000 -- (-826.739) [-824.504] (-827.841) (-832.141) * (-825.216) (-824.278) (-829.282) [-824.449] -- 0:01:12
      99500 -- (-826.882) (-827.346) [-826.985] (-824.789) * (-825.092) (-825.843) [-825.461] (-827.327) -- 0:01:12
      100000 -- (-827.440) [-824.824] (-826.555) (-824.651) * (-825.946) [-824.180] (-825.571) (-827.890) -- 0:01:12

      Average standard deviation of split frequencies: 0.021935

      100500 -- (-827.307) (-826.891) (-826.995) [-824.998] * (-825.539) (-826.117) (-824.890) [-826.800] -- 0:01:11
      101000 -- (-834.745) [-825.836] (-826.008) (-825.833) * [-824.335] (-824.325) (-825.838) (-824.415) -- 0:01:11
      101500 -- [-837.010] (-826.231) (-826.458) (-826.176) * (-823.959) (-824.591) [-827.662] (-827.050) -- 0:01:10
      102000 -- [-831.120] (-826.362) (-826.029) (-824.259) * (-824.133) [-825.154] (-827.108) (-824.456) -- 0:01:10
      102500 -- [-826.404] (-825.096) (-829.165) (-824.412) * (-826.378) (-825.868) (-825.067) [-830.343] -- 0:01:10
      103000 -- (-828.784) [-824.570] (-825.822) (-824.381) * (-825.012) (-826.297) (-829.040) [-825.927] -- 0:01:09
      103500 -- (-824.366) (-824.666) [-825.772] (-828.844) * (-830.189) (-828.921) [-824.847] (-828.867) -- 0:01:09
      104000 -- (-824.353) (-825.190) [-825.098] (-825.339) * [-827.135] (-825.291) (-826.071) (-825.680) -- 0:01:08
      104500 -- [-827.766] (-827.710) (-824.031) (-825.422) * [-825.261] (-825.445) (-829.381) (-828.014) -- 0:01:08
      105000 -- (-826.190) [-825.439] (-825.915) (-824.837) * (-826.006) [-825.269] (-825.396) (-828.456) -- 0:01:08

      Average standard deviation of split frequencies: 0.024237

      105500 -- [-826.433] (-825.749) (-826.141) (-824.342) * [-827.416] (-826.914) (-828.213) (-829.311) -- 0:01:07
      106000 -- (-830.970) (-825.771) (-824.405) [-825.393] * (-827.226) (-827.689) (-830.427) [-824.867] -- 0:01:07
      106500 -- [-828.424] (-825.058) (-824.954) (-828.153) * (-827.289) (-824.538) [-827.852] (-826.746) -- 0:01:07
      107000 -- (-824.655) [-825.139] (-824.738) (-826.046) * (-824.711) (-826.752) [-825.003] (-829.054) -- 0:01:06
      107500 -- (-825.709) (-826.275) [-824.798] (-825.081) * (-825.742) [-824.863] (-826.103) (-830.024) -- 0:01:06
      108000 -- (-827.637) [-825.994] (-825.074) (-828.201) * (-824.752) [-826.281] (-824.850) (-825.336) -- 0:01:06
      108500 -- (-826.238) (-825.885) (-826.483) [-827.763] * [-823.748] (-826.168) (-824.778) (-826.905) -- 0:01:05
      109000 -- (-824.328) (-826.969) (-827.969) [-826.704] * [-825.484] (-826.859) (-826.300) (-824.057) -- 0:01:05
      109500 -- (-828.608) (-825.982) [-827.564] (-831.156) * (-823.845) (-830.619) (-826.222) [-827.792] -- 0:01:05
      110000 -- [-826.264] (-828.708) (-826.016) (-826.960) * [-823.926] (-827.692) (-828.910) (-829.729) -- 0:01:04

      Average standard deviation of split frequencies: 0.024375

      110500 -- [-825.677] (-825.637) (-825.807) (-824.671) * [-824.385] (-829.240) (-830.177) (-825.776) -- 0:01:04
      111000 -- [-828.850] (-826.762) (-825.782) (-828.292) * (-827.806) (-824.805) (-830.445) [-824.977] -- 0:01:12
      111500 -- (-825.111) [-824.865] (-827.156) (-825.601) * [-826.204] (-824.394) (-834.207) (-825.337) -- 0:01:11
      112000 -- [-824.218] (-825.878) (-831.463) (-826.087) * (-823.878) [-825.553] (-826.728) (-828.621) -- 0:01:11
      112500 -- [-826.114] (-827.234) (-832.080) (-825.776) * [-824.187] (-826.831) (-827.346) (-827.368) -- 0:01:11
      113000 -- (-829.412) (-824.651) (-828.340) [-825.110] * (-825.897) (-824.374) (-825.512) [-824.883] -- 0:01:10
      113500 -- (-829.578) (-826.619) (-825.608) [-826.671] * (-834.778) (-825.196) [-826.464] (-824.448) -- 0:01:10
      114000 -- (-824.952) [-825.054] (-824.697) (-826.214) * (-825.431) [-825.602] (-827.475) (-824.623) -- 0:01:09
      114500 -- (-825.918) (-825.460) (-827.302) [-824.949] * (-830.733) [-824.072] (-827.825) (-826.405) -- 0:01:09
      115000 -- (-826.989) (-825.376) (-826.551) [-827.498] * (-825.418) (-826.627) (-829.904) [-826.942] -- 0:01:09

      Average standard deviation of split frequencies: 0.025880

      115500 -- (-827.016) [-825.585] (-825.490) (-824.774) * (-828.334) (-826.125) (-826.885) [-828.175] -- 0:01:08
      116000 -- (-824.434) [-825.156] (-826.735) (-827.688) * (-827.468) (-826.867) (-828.019) [-826.266] -- 0:01:08
      116500 -- (-826.561) (-827.885) (-825.960) [-827.278] * (-824.796) [-828.600] (-826.511) (-825.440) -- 0:01:08
      117000 -- (-827.362) (-824.722) [-825.957] (-824.898) * (-829.423) [-828.071] (-825.754) (-826.947) -- 0:01:07
      117500 -- [-828.419] (-832.879) (-824.784) (-832.039) * (-829.146) (-826.488) [-826.167] (-826.123) -- 0:01:07
      118000 -- (-825.525) [-826.070] (-827.331) (-828.984) * (-825.275) [-826.960] (-827.799) (-825.723) -- 0:01:07
      118500 -- (-826.274) (-826.467) [-826.200] (-827.060) * (-825.156) (-825.726) [-825.531] (-827.533) -- 0:01:06
      119000 -- [-824.812] (-824.328) (-825.465) (-827.959) * [-824.464] (-826.209) (-825.077) (-828.243) -- 0:01:06
      119500 -- (-824.994) [-824.443] (-827.112) (-825.435) * [-825.728] (-826.600) (-825.184) (-829.125) -- 0:01:06
      120000 -- (-825.908) (-824.572) [-827.210] (-833.589) * (-824.991) [-824.972] (-826.252) (-826.169) -- 0:01:06

      Average standard deviation of split frequencies: 0.024057

      120500 -- (-828.355) [-825.857] (-824.838) (-826.209) * (-826.797) (-826.238) [-827.935] (-827.628) -- 0:01:05
      121000 -- [-827.872] (-829.018) (-824.802) (-827.457) * (-825.710) [-826.795] (-824.343) (-824.368) -- 0:01:05
      121500 -- (-826.378) [-826.936] (-824.763) (-826.656) * (-825.100) (-828.232) (-825.470) [-824.348] -- 0:01:05
      122000 -- (-830.686) (-826.489) [-825.105] (-828.050) * (-825.017) (-830.639) [-825.873] (-826.649) -- 0:01:04
      122500 -- [-830.831] (-824.953) (-824.100) (-825.393) * (-826.057) (-828.233) [-824.181] (-825.327) -- 0:01:04
      123000 -- (-830.180) (-830.828) (-828.574) [-825.831] * (-824.710) (-824.518) (-824.910) [-824.279] -- 0:01:04
      123500 -- (-828.530) (-825.843) (-829.091) [-824.949] * (-824.071) (-831.116) [-826.348] (-823.899) -- 0:01:03
      124000 -- (-826.939) (-825.818) [-827.935] (-825.210) * (-824.973) (-824.189) [-825.333] (-823.837) -- 0:01:03
      124500 -- [-833.226] (-825.550) (-826.060) (-824.824) * [-826.143] (-826.119) (-828.713) (-824.618) -- 0:01:03
      125000 -- [-825.657] (-826.389) (-826.733) (-829.033) * (-827.916) (-825.437) [-826.773] (-824.277) -- 0:01:03

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-824.681) (-826.174) (-824.714) [-827.048] * (-829.154) (-825.270) [-826.623] (-824.377) -- 0:01:09
      126000 -- (-831.124) (-825.851) [-824.954] (-827.303) * (-825.592) (-827.319) [-825.572] (-825.300) -- 0:01:09
      126500 -- [-827.005] (-827.259) (-826.435) (-828.150) * [-827.990] (-826.090) (-827.217) (-826.503) -- 0:01:09
      127000 -- [-825.877] (-825.485) (-824.937) (-827.554) * (-826.699) [-826.452] (-828.599) (-826.403) -- 0:01:08
      127500 -- (-826.445) (-824.905) [-824.937] (-824.744) * (-828.898) [-827.658] (-825.692) (-825.703) -- 0:01:08
      128000 -- (-832.163) (-825.529) (-826.359) [-824.658] * (-829.014) (-826.409) [-825.263] (-833.272) -- 0:01:08
      128500 -- (-831.104) (-828.383) (-829.716) [-825.749] * (-829.396) (-826.387) [-824.276] (-825.412) -- 0:01:07
      129000 -- (-831.286) [-824.121] (-827.668) (-826.435) * (-829.739) (-824.596) (-826.032) [-824.254] -- 0:01:07
      129500 -- [-826.595] (-824.847) (-826.631) (-825.374) * (-831.409) (-824.571) [-825.785] (-826.690) -- 0:01:07
      130000 -- (-827.108) (-828.762) (-824.438) [-824.869] * (-826.009) (-824.541) (-825.025) [-825.978] -- 0:01:06

      Average standard deviation of split frequencies: 0.020644

      130500 -- (-824.567) (-829.060) (-823.876) [-826.444] * [-826.304] (-824.635) (-826.107) (-829.352) -- 0:01:06
      131000 -- (-824.177) [-824.827] (-825.544) (-828.334) * (-826.327) (-823.961) [-825.018] (-824.119) -- 0:01:06
      131500 -- [-824.615] (-824.948) (-827.665) (-825.206) * [-826.774] (-828.357) (-825.399) (-831.978) -- 0:01:06
      132000 -- (-826.696) [-825.520] (-825.602) (-824.983) * (-826.549) [-824.657] (-826.923) (-830.713) -- 0:01:05
      132500 -- [-825.497] (-824.859) (-826.608) (-830.541) * (-827.768) (-827.549) [-826.666] (-829.373) -- 0:01:05
      133000 -- [-824.134] (-827.259) (-825.756) (-826.155) * (-824.974) [-828.491] (-824.938) (-827.195) -- 0:01:05
      133500 -- (-826.980) [-829.235] (-824.511) (-825.122) * [-827.161] (-826.238) (-824.837) (-824.864) -- 0:01:04
      134000 -- [-826.990] (-830.002) (-825.816) (-826.003) * (-828.179) (-827.246) [-825.345] (-829.582) -- 0:01:04
      134500 -- [-827.388] (-828.967) (-825.067) (-825.820) * (-827.024) (-827.255) [-824.801] (-827.141) -- 0:01:04
      135000 -- (-825.947) (-825.452) [-824.248] (-827.287) * (-826.965) (-826.242) [-825.230] (-826.487) -- 0:01:04

      Average standard deviation of split frequencies: 0.019257

      135500 -- (-825.772) [-825.345] (-825.024) (-825.695) * (-825.753) (-826.236) [-828.003] (-826.122) -- 0:01:03
      136000 -- (-826.495) (-825.241) [-824.318] (-827.417) * [-825.588] (-826.822) (-827.437) (-824.392) -- 0:01:03
      136500 -- (-826.574) (-826.212) (-824.697) [-827.037] * (-825.961) (-825.170) (-827.178) [-826.553] -- 0:01:03
      137000 -- [-829.033] (-824.830) (-824.535) (-826.511) * (-826.331) (-825.019) (-827.024) [-828.682] -- 0:01:02
      137500 -- (-834.659) (-826.510) [-829.039] (-826.328) * [-826.400] (-823.912) (-829.190) (-824.600) -- 0:01:02
      138000 -- (-830.664) (-825.745) [-824.504] (-827.018) * (-827.720) (-826.409) [-827.586] (-827.188) -- 0:01:02
      138500 -- (-829.611) [-827.651] (-824.967) (-827.318) * [-825.590] (-824.260) (-828.400) (-825.654) -- 0:01:02
      139000 -- (-827.490) (-830.940) [-824.977] (-826.921) * [-828.263] (-824.599) (-827.820) (-826.499) -- 0:01:01
      139500 -- (-828.234) (-827.152) [-829.083] (-826.662) * [-824.763] (-824.653) (-825.548) (-827.816) -- 0:01:01
      140000 -- (-827.537) (-826.477) [-824.828] (-829.528) * (-824.997) (-825.834) (-828.032) [-826.899] -- 0:01:07

      Average standard deviation of split frequencies: 0.019516

      140500 -- (-828.583) (-827.064) (-824.558) [-826.476] * (-828.481) [-827.967] (-824.824) (-830.925) -- 0:01:07
      141000 -- [-828.273] (-826.195) (-825.809) (-828.537) * (-827.643) [-825.366] (-826.219) (-829.968) -- 0:01:07
      141500 -- [-830.158] (-826.315) (-825.548) (-826.447) * (-831.193) (-827.323) (-824.529) [-826.495] -- 0:01:06
      142000 -- [-825.078] (-826.456) (-824.546) (-826.913) * (-825.069) (-827.745) (-823.901) [-826.596] -- 0:01:06
      142500 -- (-828.689) (-825.656) (-825.651) [-825.598] * (-825.646) (-827.388) [-825.979] (-825.136) -- 0:01:06
      143000 -- [-827.518] (-826.277) (-825.598) (-825.277) * (-826.419) (-827.521) (-823.998) [-824.125] -- 0:01:05
      143500 -- [-826.996] (-825.853) (-826.611) (-824.430) * [-826.553] (-826.253) (-827.450) (-826.878) -- 0:01:05
      144000 -- [-825.476] (-824.590) (-826.775) (-825.190) * (-825.588) (-826.283) (-826.719) [-824.078] -- 0:01:05
      144500 -- (-824.796) (-827.147) (-827.541) [-828.389] * [-824.656] (-829.361) (-825.977) (-828.756) -- 0:01:05
      145000 -- (-825.705) (-829.681) (-825.356) [-826.890] * (-829.504) (-825.108) (-825.142) [-823.822] -- 0:01:04

      Average standard deviation of split frequencies: 0.016682

      145500 -- [-825.692] (-824.277) (-825.935) (-824.278) * [-827.917] (-828.592) (-825.176) (-824.405) -- 0:01:04
      146000 -- (-826.921) (-826.026) (-827.790) [-824.514] * (-827.310) (-825.315) [-825.910] (-826.125) -- 0:01:04
      146500 -- (-825.918) (-826.901) (-826.734) [-825.199] * [-825.554] (-825.263) (-828.726) (-825.849) -- 0:01:04
      147000 -- (-825.672) [-824.671] (-827.158) (-828.860) * (-826.060) (-829.434) (-825.900) [-824.584] -- 0:01:03
      147500 -- (-828.625) [-825.355] (-827.108) (-829.120) * [-828.437] (-829.937) (-826.383) (-825.138) -- 0:01:03
      148000 -- (-828.077) (-828.045) [-827.135] (-830.195) * (-828.495) (-824.023) [-829.068] (-826.366) -- 0:01:03
      148500 -- (-825.645) [-826.708] (-825.659) (-828.556) * (-826.677) (-823.968) [-825.677] (-825.197) -- 0:01:03
      149000 -- (-826.305) (-827.009) [-824.492] (-827.058) * (-825.572) (-824.773) [-828.546] (-832.315) -- 0:01:02
      149500 -- (-827.492) (-824.575) (-824.493) [-824.591] * (-825.344) [-825.157] (-827.402) (-828.006) -- 0:01:02
      150000 -- (-826.194) (-825.247) (-828.701) [-824.720] * (-825.610) (-827.049) [-826.666] (-831.080) -- 0:01:02

      Average standard deviation of split frequencies: 0.015992

      150500 -- [-826.271] (-825.851) (-828.274) (-825.296) * (-825.670) (-825.874) (-825.333) [-823.946] -- 0:01:02
      151000 -- (-828.511) (-824.007) [-826.935] (-824.367) * (-826.018) (-829.668) (-825.103) [-824.820] -- 0:01:01
      151500 -- (-829.061) (-825.491) (-828.580) [-824.286] * (-826.080) (-827.745) [-825.229] (-824.481) -- 0:01:01
      152000 -- (-825.272) (-825.881) [-828.634] (-825.375) * [-825.646] (-828.559) (-826.877) (-826.498) -- 0:01:01
      152500 -- (-826.250) [-825.186] (-827.717) (-825.659) * (-830.988) (-828.251) (-824.727) [-824.699] -- 0:01:01
      153000 -- (-826.791) (-827.002) (-827.399) [-824.796] * (-827.238) (-830.508) [-825.092] (-824.276) -- 0:01:00
      153500 -- (-828.454) [-825.530] (-826.483) (-825.045) * (-825.849) [-830.327] (-829.831) (-827.431) -- 0:01:00
      154000 -- (-829.681) (-824.501) (-826.651) [-825.717] * [-826.983] (-827.372) (-825.014) (-828.566) -- 0:01:05
      154500 -- (-828.725) (-827.573) [-825.102] (-827.634) * [-824.338] (-825.369) (-831.317) (-828.566) -- 0:01:05
      155000 -- [-826.450] (-825.197) (-827.305) (-827.934) * (-828.248) [-829.389] (-827.917) (-830.733) -- 0:01:05

      Average standard deviation of split frequencies: 0.017177

      155500 -- (-827.288) [-824.541] (-826.398) (-824.240) * (-825.053) [-826.195] (-826.668) (-829.745) -- 0:01:05
      156000 -- (-829.358) (-825.640) [-826.757] (-829.022) * [-825.265] (-825.182) (-826.660) (-828.866) -- 0:01:04
      156500 -- (-828.994) (-825.375) [-825.939] (-832.595) * [-825.135] (-828.223) (-824.215) (-826.086) -- 0:01:04
      157000 -- (-831.181) (-825.117) (-829.594) [-827.577] * (-825.330) [-825.150] (-825.054) (-826.222) -- 0:01:04
      157500 -- (-826.935) [-825.573] (-830.355) (-826.892) * [-825.504] (-824.348) (-825.033) (-826.429) -- 0:01:04
      158000 -- (-826.416) [-824.474] (-828.010) (-824.930) * (-830.345) (-827.980) [-825.481] (-824.140) -- 0:01:03
      158500 -- (-826.576) [-825.082] (-829.746) (-830.095) * (-824.517) (-828.096) (-827.785) [-824.469] -- 0:01:03
      159000 -- (-827.140) (-828.797) (-828.337) [-827.135] * [-825.877] (-823.926) (-830.752) (-825.007) -- 0:01:03
      159500 -- (-827.723) [-824.398] (-833.495) (-825.024) * (-826.014) (-826.681) [-825.348] (-826.343) -- 0:01:03
      160000 -- (-830.506) (-824.379) [-825.645] (-825.598) * (-825.726) (-824.004) (-828.524) [-827.703] -- 0:01:02

      Average standard deviation of split frequencies: 0.017115

      160500 -- (-827.413) (-826.320) (-828.188) [-825.445] * [-825.233] (-825.250) (-829.666) (-824.836) -- 0:01:02
      161000 -- [-826.105] (-827.314) (-830.082) (-827.699) * (-826.603) (-825.414) [-825.612] (-824.364) -- 0:01:02
      161500 -- [-825.207] (-824.294) (-828.719) (-825.342) * [-830.462] (-825.318) (-828.163) (-825.963) -- 0:01:02
      162000 -- (-824.850) (-825.706) [-827.119] (-825.985) * (-828.373) (-826.094) (-824.089) [-826.406] -- 0:01:02
      162500 -- [-824.697] (-828.778) (-830.401) (-826.797) * (-826.399) (-825.095) [-825.223] (-825.789) -- 0:01:01
      163000 -- (-829.007) [-825.726] (-828.750) (-825.825) * (-827.223) (-824.899) [-824.920] (-827.979) -- 0:01:01
      163500 -- (-828.826) (-827.487) (-826.096) [-824.288] * (-824.264) [-824.164] (-828.392) (-824.304) -- 0:01:01
      164000 -- (-827.886) (-826.130) [-826.771] (-825.105) * (-825.810) [-824.162] (-824.355) (-824.925) -- 0:01:01
      164500 -- (-825.677) (-824.469) [-826.933] (-824.902) * (-826.470) [-828.374] (-828.289) (-824.220) -- 0:01:00
      165000 -- [-825.198] (-824.782) (-825.591) (-825.194) * [-827.168] (-825.601) (-829.335) (-824.220) -- 0:01:00

      Average standard deviation of split frequencies: 0.017039

      165500 -- [-827.824] (-824.673) (-825.220) (-825.837) * (-827.737) (-828.225) [-826.732] (-828.272) -- 0:01:00
      166000 -- [-825.311] (-826.856) (-824.422) (-831.794) * (-825.171) [-828.730] (-831.635) (-827.295) -- 0:01:00
      166500 -- (-825.684) (-826.299) [-824.590] (-827.896) * (-824.754) (-825.735) (-826.301) [-825.695] -- 0:01:00
      167000 -- (-825.714) (-825.221) [-825.411] (-829.284) * [-824.926] (-825.108) (-824.150) (-828.339) -- 0:00:59
      167500 -- (-826.363) [-825.714] (-826.957) (-832.178) * (-824.886) (-826.423) [-826.555] (-827.136) -- 0:00:59
      168000 -- [-824.961] (-825.836) (-825.353) (-826.450) * (-826.341) (-824.841) [-826.302] (-825.700) -- 0:01:04
      168500 -- (-826.147) (-829.083) (-825.079) [-825.721] * (-826.906) [-825.388] (-830.516) (-824.745) -- 0:01:04
      169000 -- (-824.755) [-828.102] (-826.484) (-825.627) * (-828.697) (-828.840) [-827.469] (-826.058) -- 0:01:03
      169500 -- (-825.714) (-824.844) [-825.965] (-825.400) * [-826.314] (-829.613) (-827.538) (-826.690) -- 0:01:03
      170000 -- [-826.191] (-825.454) (-826.672) (-824.729) * (-827.881) (-824.161) (-827.068) [-825.835] -- 0:01:03

      Average standard deviation of split frequencies: 0.015959

      170500 -- (-828.077) [-824.593] (-828.034) (-826.876) * [-826.193] (-825.261) (-827.589) (-830.130) -- 0:01:03
      171000 -- [-829.805] (-824.746) (-827.585) (-825.066) * [-826.243] (-830.073) (-827.143) (-827.029) -- 0:01:03
      171500 -- (-825.033) (-825.457) (-827.041) [-826.501] * (-826.581) (-826.351) [-826.392] (-825.369) -- 0:01:02
      172000 -- (-827.933) (-825.317) [-827.579] (-828.821) * (-826.158) (-826.037) [-825.464] (-825.782) -- 0:01:02
      172500 -- (-829.471) [-824.402] (-824.772) (-827.256) * (-824.531) [-824.474] (-824.974) (-824.100) -- 0:01:02
      173000 -- (-826.763) (-824.662) [-825.534] (-828.622) * (-827.190) [-824.218] (-825.482) (-824.100) -- 0:01:02
      173500 -- [-824.813] (-825.014) (-824.835) (-826.970) * (-826.358) [-824.277] (-828.397) (-824.624) -- 0:01:01
      174000 -- [-825.155] (-824.563) (-824.993) (-825.002) * (-827.703) (-824.696) (-827.329) [-826.798] -- 0:01:01
      174500 -- (-826.163) (-826.880) [-826.508] (-824.999) * (-825.574) [-827.353] (-828.709) (-827.773) -- 0:01:01
      175000 -- (-827.055) [-825.987] (-829.797) (-824.689) * [-826.224] (-824.143) (-828.019) (-827.716) -- 0:01:01

      Average standard deviation of split frequencies: 0.017112

      175500 -- [-824.469] (-827.310) (-827.448) (-825.699) * (-825.536) (-831.318) [-825.788] (-828.566) -- 0:01:01
      176000 -- [-824.181] (-829.600) (-826.584) (-823.660) * (-825.607) (-826.732) [-825.830] (-828.690) -- 0:01:00
      176500 -- (-824.350) (-825.869) [-827.755] (-825.562) * (-824.635) [-832.339] (-825.864) (-828.572) -- 0:01:00
      177000 -- (-825.596) [-826.236] (-825.458) (-826.364) * (-825.313) [-823.997] (-828.228) (-829.003) -- 0:01:00
      177500 -- [-826.502] (-825.725) (-826.921) (-826.494) * (-824.824) (-823.899) [-827.002] (-824.713) -- 0:01:00
      178000 -- [-825.897] (-824.991) (-827.759) (-826.793) * (-824.687) [-827.982] (-825.292) (-827.935) -- 0:01:00
      178500 -- [-824.599] (-825.723) (-827.527) (-825.752) * (-825.854) (-826.552) (-825.173) [-826.514] -- 0:00:59
      179000 -- [-824.576] (-826.100) (-828.162) (-825.619) * [-825.625] (-826.110) (-828.686) (-825.792) -- 0:00:59
      179500 -- [-825.172] (-825.539) (-825.018) (-824.353) * (-826.977) (-824.613) (-832.532) [-825.726] -- 0:00:59
      180000 -- (-824.775) [-825.036] (-825.037) (-824.867) * (-827.719) (-823.727) (-825.726) [-824.749] -- 0:00:59

      Average standard deviation of split frequencies: 0.016479

      180500 -- (-825.252) (-824.305) [-828.711] (-824.449) * [-827.843] (-826.160) (-825.287) (-828.336) -- 0:00:59
      181000 -- (-828.684) (-825.900) (-823.868) [-825.982] * [-827.373] (-826.704) (-828.650) (-823.958) -- 0:00:58
      181500 -- [-825.643] (-825.600) (-824.213) (-826.045) * (-824.584) (-828.897) [-827.541] (-823.948) -- 0:00:58
      182000 -- (-829.723) [-825.789] (-824.184) (-826.017) * [-825.629] (-825.072) (-829.264) (-824.030) -- 0:00:58
      182500 -- (-825.106) (-825.326) (-828.971) [-824.098] * (-826.613) (-824.919) (-831.579) [-825.997] -- 0:01:02
      183000 -- (-826.287) (-824.739) [-825.969] (-826.358) * [-824.923] (-824.905) (-828.385) (-826.757) -- 0:01:02
      183500 -- (-826.767) (-825.952) [-824.550] (-826.935) * (-824.350) [-825.451] (-828.092) (-826.148) -- 0:01:02
      184000 -- (-827.545) (-826.804) [-827.351] (-824.654) * (-825.856) [-827.445] (-825.254) (-826.311) -- 0:01:02
      184500 -- (-825.243) (-827.795) [-826.171] (-828.778) * [-825.488] (-825.109) (-825.329) (-827.836) -- 0:01:01
      185000 -- (-826.153) (-825.329) [-826.178] (-829.704) * (-825.565) [-826.202] (-824.548) (-826.695) -- 0:01:01

      Average standard deviation of split frequencies: 0.017107

      185500 -- [-827.294] (-823.993) (-824.473) (-828.689) * (-825.925) [-827.619] (-828.220) (-825.407) -- 0:01:01
      186000 -- (-827.453) [-824.522] (-824.453) (-828.419) * (-831.137) (-825.676) (-827.424) [-824.558] -- 0:01:01
      186500 -- (-827.347) (-825.763) [-824.935] (-829.227) * (-830.809) (-824.708) (-825.472) [-824.060] -- 0:01:01
      187000 -- (-825.157) (-824.169) (-824.049) [-825.399] * [-827.096] (-824.818) (-827.276) (-826.615) -- 0:01:00
      187500 -- (-826.945) (-825.486) (-825.246) [-827.054] * (-825.078) (-829.544) (-828.652) [-826.957] -- 0:01:00
      188000 -- [-827.748] (-823.999) (-831.785) (-827.651) * (-825.365) (-825.198) (-826.219) [-826.673] -- 0:01:00
      188500 -- (-827.155) [-825.560] (-828.016) (-825.272) * (-825.858) (-825.950) [-826.480] (-832.495) -- 0:01:00
      189000 -- (-828.839) [-825.340] (-829.991) (-826.012) * (-824.724) [-823.782] (-826.410) (-829.774) -- 0:01:00
      189500 -- (-825.633) [-825.434] (-825.926) (-828.357) * (-828.994) (-827.748) [-825.116] (-824.657) -- 0:00:59
      190000 -- (-825.758) (-827.007) [-826.492] (-823.905) * (-828.760) [-824.670] (-826.714) (-825.495) -- 0:00:59

      Average standard deviation of split frequencies: 0.016071

      190500 -- (-826.098) (-826.913) [-825.032] (-824.470) * (-824.178) [-826.188] (-827.363) (-829.105) -- 0:00:59
      191000 -- (-824.334) (-829.644) [-825.908] (-826.629) * (-825.752) (-824.982) (-824.579) [-824.428] -- 0:00:59
      191500 -- (-827.540) (-829.396) (-826.455) [-825.021] * [-824.786] (-826.294) (-824.014) (-824.280) -- 0:00:59
      192000 -- [-825.815] (-826.012) (-825.132) (-823.971) * (-825.707) (-825.422) [-826.912] (-827.265) -- 0:00:58
      192500 -- (-824.557) [-824.014] (-824.592) (-826.425) * (-827.274) (-827.301) (-826.738) [-828.065] -- 0:00:58
      193000 -- (-823.995) [-825.443] (-825.218) (-824.458) * [-826.273] (-828.473) (-827.307) (-827.643) -- 0:00:58
      193500 -- [-824.653] (-824.777) (-824.273) (-826.470) * (-828.011) (-827.952) [-827.136] (-827.884) -- 0:00:58
      194000 -- [-824.695] (-827.316) (-830.361) (-825.494) * (-832.081) [-825.689] (-827.048) (-827.988) -- 0:01:02
      194500 -- [-824.557] (-827.680) (-828.305) (-828.162) * (-828.419) (-825.702) [-827.551] (-828.309) -- 0:01:02
      195000 -- [-825.777] (-824.336) (-825.218) (-824.973) * (-828.317) [-825.267] (-826.542) (-824.474) -- 0:01:01

      Average standard deviation of split frequencies: 0.015500

      195500 -- [-826.424] (-825.526) (-826.518) (-827.190) * (-828.133) [-826.442] (-827.868) (-824.383) -- 0:01:01
      196000 -- [-826.060] (-826.678) (-824.488) (-828.974) * (-828.910) [-828.513] (-825.715) (-830.723) -- 0:01:01
      196500 -- (-826.855) (-827.999) [-826.281] (-829.607) * [-829.121] (-826.564) (-825.629) (-826.775) -- 0:01:01
      197000 -- (-827.579) (-830.507) [-828.271] (-825.982) * (-827.261) [-826.011] (-825.494) (-825.903) -- 0:01:01
      197500 -- (-824.420) (-824.089) [-825.137] (-824.190) * (-825.030) [-825.670] (-827.440) (-827.567) -- 0:01:00
      198000 -- [-826.268] (-828.580) (-826.387) (-824.188) * (-828.379) (-826.178) [-827.960] (-827.202) -- 0:01:00
      198500 -- (-829.162) (-827.745) (-825.949) [-826.281] * (-828.890) (-825.773) [-831.326] (-833.654) -- 0:01:00
      199000 -- (-827.731) [-826.375] (-825.716) (-828.333) * (-825.917) [-824.652] (-829.470) (-828.409) -- 0:01:00
      199500 -- (-829.523) [-826.597] (-825.185) (-826.035) * (-825.207) (-827.574) [-827.064] (-825.143) -- 0:01:00
      200000 -- (-833.551) (-826.774) [-825.200] (-826.586) * (-826.977) [-825.119] (-827.007) (-830.180) -- 0:00:59

      Average standard deviation of split frequencies: 0.016314

      200500 -- (-828.907) (-824.201) (-827.692) [-824.432] * [-825.164] (-827.266) (-824.939) (-829.749) -- 0:00:59
      201000 -- [-825.262] (-824.240) (-828.461) (-825.863) * (-824.200) (-826.220) (-826.135) [-824.485] -- 0:00:59
      201500 -- (-826.348) [-824.283] (-829.027) (-825.774) * [-826.070] (-825.411) (-824.958) (-824.280) -- 0:00:59
      202000 -- (-835.643) [-824.707] (-826.504) (-824.191) * [-825.008] (-829.363) (-827.517) (-829.812) -- 0:00:59
      202500 -- (-826.509) (-824.926) [-826.325] (-826.994) * [-824.225] (-828.548) (-826.553) (-829.824) -- 0:00:59
      203000 -- (-828.124) (-829.495) (-828.716) [-825.142] * (-825.895) [-826.286] (-824.185) (-834.376) -- 0:00:58
      203500 -- (-828.557) (-826.577) (-827.898) [-827.510] * [-825.550] (-827.598) (-825.785) (-827.878) -- 0:00:58
      204000 -- [-829.919] (-825.955) (-824.970) (-827.381) * (-828.638) [-827.357] (-827.918) (-827.464) -- 0:00:58
      204500 -- (-829.437) (-824.473) [-825.485] (-825.218) * [-829.902] (-828.217) (-827.292) (-827.399) -- 0:00:58
      205000 -- [-825.927] (-834.661) (-825.158) (-826.044) * (-825.454) (-824.119) [-824.715] (-829.397) -- 0:00:58

      Average standard deviation of split frequencies: 0.014620

      205500 -- (-827.891) [-826.759] (-824.888) (-826.858) * (-826.293) (-827.961) [-824.366] (-825.482) -- 0:00:57
      206000 -- (-830.102) (-827.230) [-826.322] (-825.050) * (-829.117) [-828.253] (-826.481) (-825.761) -- 0:00:57
      206500 -- (-828.077) (-831.445) (-825.368) [-826.141] * (-826.152) (-825.695) (-824.344) [-824.741] -- 0:00:57
      207000 -- (-826.922) [-832.610] (-826.357) (-825.639) * (-824.788) (-826.124) [-824.246] (-825.030) -- 0:00:57
      207500 -- (-824.434) (-826.118) (-824.323) [-825.764] * (-824.884) (-827.305) (-824.448) [-827.005] -- 0:00:57
      208000 -- [-823.922] (-825.241) (-827.957) (-825.011) * (-826.220) (-825.317) [-825.291] (-825.744) -- 0:01:00
      208500 -- (-824.283) [-829.978] (-824.903) (-824.921) * (-826.106) (-826.354) (-827.544) [-826.449] -- 0:01:00
      209000 -- (-826.101) (-830.499) (-826.663) [-826.251] * [-828.783] (-826.777) (-827.372) (-824.225) -- 0:01:00
      209500 -- (-827.924) (-826.272) [-826.621] (-824.258) * (-827.660) (-825.354) (-825.979) [-824.220] -- 0:01:00
      210000 -- (-826.816) (-826.439) (-824.780) [-824.514] * [-825.047] (-827.569) (-827.715) (-824.356) -- 0:01:00

      Average standard deviation of split frequencies: 0.015166

      210500 -- (-825.871) (-825.363) (-824.673) [-824.510] * (-825.761) (-826.184) [-828.324] (-826.418) -- 0:01:00
      211000 -- (-826.088) (-825.393) (-824.411) [-825.144] * (-827.210) (-829.245) [-826.497] (-825.507) -- 0:00:59
      211500 -- (-824.737) [-825.428] (-825.095) (-825.505) * (-827.497) [-825.660] (-825.554) (-827.555) -- 0:00:59
      212000 -- [-824.147] (-825.425) (-825.705) (-824.737) * (-828.448) (-825.098) [-827.504] (-827.828) -- 0:00:59
      212500 -- (-829.425) (-826.953) (-825.521) [-826.399] * (-826.394) (-832.026) [-826.283] (-827.286) -- 0:00:59
      213000 -- (-825.254) [-827.746] (-826.745) (-827.371) * (-826.330) (-825.049) [-825.080] (-825.113) -- 0:00:59
      213500 -- [-824.717] (-827.543) (-828.343) (-824.573) * (-825.016) (-824.379) (-828.394) [-824.963] -- 0:00:58
      214000 -- (-825.540) [-825.212] (-824.838) (-825.684) * [-826.097] (-825.564) (-824.502) (-832.246) -- 0:00:58
      214500 -- (-827.058) [-824.743] (-826.000) (-829.193) * (-825.435) (-825.327) (-824.943) [-825.245] -- 0:00:58
      215000 -- (-827.815) (-825.537) (-826.725) [-824.962] * (-825.224) (-826.339) (-824.444) [-826.729] -- 0:00:58

      Average standard deviation of split frequencies: 0.016853

      215500 -- [-824.355] (-828.067) (-828.808) (-824.962) * (-825.823) (-826.762) (-826.015) [-825.089] -- 0:00:58
      216000 -- [-824.653] (-830.418) (-826.636) (-828.683) * (-824.847) (-827.678) [-825.112] (-824.654) -- 0:00:58
      216500 -- (-824.572) [-828.475] (-824.104) (-828.072) * [-824.370] (-827.452) (-823.894) (-825.289) -- 0:00:57
      217000 -- (-827.403) [-824.875] (-826.057) (-828.340) * (-826.864) (-827.980) (-827.959) [-825.082] -- 0:00:57
      217500 -- (-826.743) [-826.031] (-824.413) (-826.121) * [-828.471] (-825.218) (-827.950) (-826.101) -- 0:00:57
      218000 -- (-825.460) (-826.940) (-824.867) [-826.422] * (-825.008) (-828.821) (-828.634) [-826.018] -- 0:00:57
      218500 -- (-825.594) (-824.669) [-824.439] (-825.322) * (-828.651) (-830.612) (-826.250) [-824.352] -- 0:00:57
      219000 -- (-825.726) (-828.162) [-824.891] (-824.722) * (-825.773) (-829.491) [-825.179] (-825.355) -- 0:00:57
      219500 -- [-828.452] (-825.649) (-824.983) (-825.114) * (-826.242) (-828.959) (-826.330) [-826.789] -- 0:00:56
      220000 -- (-826.950) (-825.514) [-824.903] (-824.114) * [-826.140] (-825.561) (-825.947) (-829.107) -- 0:00:56

      Average standard deviation of split frequencies: 0.017446

      220500 -- (-826.033) (-829.519) (-826.928) [-824.795] * (-826.362) (-830.494) [-824.967] (-831.593) -- 0:00:56
      221000 -- (-828.616) [-825.400] (-824.815) (-825.309) * [-829.625] (-825.988) (-824.987) (-829.200) -- 0:00:56
      221500 -- (-830.661) [-826.316] (-827.597) (-826.889) * (-829.938) (-824.100) [-825.665] (-828.668) -- 0:00:56
      222000 -- [-825.573] (-826.053) (-829.761) (-825.739) * (-828.652) (-825.281) [-827.957] (-829.526) -- 0:00:59
      222500 -- [-825.146] (-826.079) (-827.313) (-826.038) * [-826.615] (-831.910) (-825.229) (-825.908) -- 0:00:59
      223000 -- [-824.579] (-825.803) (-831.287) (-828.054) * (-829.916) [-826.216] (-826.246) (-825.770) -- 0:00:59
      223500 -- (-828.057) (-825.619) (-830.716) [-827.771] * (-829.655) (-826.592) [-825.831] (-829.511) -- 0:00:59
      224000 -- [-825.803] (-825.336) (-827.920) (-827.599) * (-827.956) [-825.366] (-832.244) (-825.516) -- 0:00:58
      224500 -- (-824.483) (-825.860) [-824.577] (-825.729) * (-828.476) (-825.348) (-824.835) [-827.108] -- 0:00:58
      225000 -- [-825.461] (-825.119) (-827.599) (-824.422) * [-825.600] (-826.194) (-828.110) (-826.824) -- 0:00:58

      Average standard deviation of split frequencies: 0.017498

      225500 -- [-825.295] (-825.666) (-827.118) (-830.240) * (-826.473) [-825.716] (-827.039) (-827.185) -- 0:00:58
      226000 -- [-826.356] (-828.040) (-827.296) (-832.539) * [-824.191] (-825.511) (-825.293) (-826.325) -- 0:00:58
      226500 -- [-825.063] (-828.746) (-825.489) (-829.708) * [-824.869] (-824.814) (-825.330) (-827.755) -- 0:00:58
      227000 -- [-825.226] (-826.135) (-828.725) (-828.023) * (-829.569) (-826.478) (-827.290) [-831.321] -- 0:00:57
      227500 -- [-824.883] (-826.601) (-827.832) (-829.591) * (-828.611) (-825.976) (-827.796) [-825.103] -- 0:00:57
      228000 -- (-824.296) [-827.103] (-825.093) (-833.823) * (-827.586) [-827.337] (-831.365) (-829.220) -- 0:00:57
      228500 -- [-825.960] (-829.015) (-828.318) (-830.329) * (-826.821) [-827.373] (-824.687) (-824.877) -- 0:00:57
      229000 -- [-823.986] (-832.083) (-829.461) (-824.855) * [-827.025] (-824.490) (-825.277) (-824.180) -- 0:00:57
      229500 -- (-825.777) [-831.716] (-827.077) (-825.177) * [-825.642] (-825.928) (-826.570) (-826.143) -- 0:00:57
      230000 -- (-828.783) (-824.504) (-828.482) [-824.282] * [-826.035] (-824.985) (-829.239) (-829.738) -- 0:00:56

      Average standard deviation of split frequencies: 0.018166

      230500 -- (-826.540) (-825.188) (-826.685) [-827.850] * (-826.473) (-826.908) [-824.586] (-825.650) -- 0:00:56
      231000 -- (-824.939) [-825.463] (-826.581) (-830.357) * [-826.394] (-825.475) (-824.821) (-826.054) -- 0:00:56
      231500 -- (-825.175) (-824.526) (-829.949) [-825.362] * (-825.789) [-826.579] (-824.736) (-826.034) -- 0:00:56
      232000 -- (-827.305) (-826.787) (-826.903) [-828.051] * (-825.051) (-826.756) [-824.943] (-827.009) -- 0:00:56
      232500 -- (-827.709) (-827.249) [-824.875] (-825.975) * (-824.928) (-826.138) (-829.030) [-828.140] -- 0:00:56
      233000 -- [-827.609] (-828.491) (-824.711) (-825.212) * [-824.884] (-826.078) (-826.992) (-826.036) -- 0:00:55
      233500 -- (-827.020) (-830.196) [-824.476] (-825.649) * (-825.953) (-826.588) [-826.034] (-824.507) -- 0:00:55
      234000 -- (-824.337) (-829.151) [-824.812] (-827.591) * (-826.666) [-824.174] (-825.807) (-825.829) -- 0:00:55
      234500 -- (-826.108) (-826.507) [-824.293] (-828.385) * (-826.898) (-827.751) [-824.946] (-827.004) -- 0:00:55
      235000 -- [-827.035] (-824.958) (-823.947) (-827.631) * (-824.857) (-830.495) [-826.328] (-824.372) -- 0:00:55

      Average standard deviation of split frequencies: 0.018532

      235500 -- [-824.278] (-826.204) (-824.644) (-824.862) * [-825.488] (-826.992) (-827.921) (-824.042) -- 0:00:55
      236000 -- [-824.958] (-824.800) (-826.512) (-828.357) * (-828.794) (-826.870) [-826.456] (-829.915) -- 0:00:58
      236500 -- (-824.298) (-826.436) [-826.279] (-827.219) * (-827.415) (-826.320) [-825.346] (-825.552) -- 0:00:58
      237000 -- (-824.299) (-825.979) [-828.526] (-828.481) * [-828.741] (-826.280) (-825.817) (-827.434) -- 0:00:57
      237500 -- (-825.133) [-824.996] (-824.643) (-826.977) * (-828.006) (-826.269) [-825.709] (-825.135) -- 0:00:57
      238000 -- (-827.126) [-825.397] (-825.925) (-828.422) * (-826.989) [-828.326] (-825.022) (-827.119) -- 0:00:57
      238500 -- (-825.489) (-829.684) [-825.057] (-825.709) * (-825.541) (-825.016) [-825.967] (-826.703) -- 0:00:57
      239000 -- (-827.015) (-829.106) [-825.824] (-824.091) * (-826.320) [-824.909] (-825.028) (-825.240) -- 0:00:57
      239500 -- (-826.709) [-826.787] (-827.428) (-825.816) * (-825.015) [-826.429] (-826.117) (-825.053) -- 0:00:57
      240000 -- (-826.368) (-827.051) (-827.771) [-825.535] * (-824.960) (-832.543) (-827.841) [-825.061] -- 0:00:56

      Average standard deviation of split frequencies: 0.017629

      240500 -- (-827.676) [-827.621] (-828.701) (-825.754) * [-825.485] (-826.801) (-824.668) (-825.877) -- 0:00:56
      241000 -- (-825.338) (-827.295) [-828.484] (-825.766) * [-825.309] (-826.983) (-824.132) (-824.975) -- 0:00:56
      241500 -- (-825.163) [-824.213] (-824.318) (-825.383) * (-833.959) (-826.665) (-825.945) [-826.791] -- 0:00:56
      242000 -- (-825.435) (-826.927) [-824.437] (-825.970) * (-825.276) [-826.065] (-829.296) (-827.341) -- 0:00:56
      242500 -- (-824.938) [-824.464] (-825.472) (-830.089) * (-826.184) [-826.461] (-827.683) (-825.895) -- 0:00:56
      243000 -- (-825.070) [-826.063] (-824.145) (-827.007) * (-824.901) (-828.641) (-828.510) [-826.156] -- 0:00:56
      243500 -- (-824.821) [-824.098] (-824.791) (-827.808) * (-825.185) [-825.892] (-826.081) (-829.446) -- 0:00:55
      244000 -- [-824.221] (-825.219) (-825.434) (-826.384) * (-825.776) (-825.982) (-824.973) [-825.898] -- 0:00:55
      244500 -- (-828.587) (-825.234) (-825.433) [-826.632] * (-824.039) (-824.835) [-825.422] (-826.147) -- 0:00:55
      245000 -- (-828.107) (-828.337) [-824.898] (-827.281) * [-826.443] (-824.989) (-824.506) (-835.356) -- 0:00:55

      Average standard deviation of split frequencies: 0.018737

      245500 -- (-826.222) (-826.712) (-826.724) [-828.615] * (-825.148) (-826.100) [-824.535] (-825.116) -- 0:00:55
      246000 -- (-825.360) (-825.415) [-823.838] (-824.373) * (-826.210) (-826.940) [-826.947] (-825.102) -- 0:00:55
      246500 -- (-824.176) (-825.160) [-827.088] (-824.925) * (-826.981) [-825.453] (-831.484) (-830.016) -- 0:00:55
      247000 -- [-825.031] (-826.084) (-824.945) (-827.081) * (-828.374) (-824.328) [-828.324] (-824.367) -- 0:00:54
      247500 -- (-824.769) (-827.784) [-829.603] (-824.819) * [-824.875] (-824.568) (-825.460) (-825.715) -- 0:00:54
      248000 -- (-827.080) [-826.468] (-826.925) (-825.326) * (-827.306) (-827.697) (-824.833) [-827.400] -- 0:00:54
      248500 -- [-827.738] (-825.469) (-825.685) (-825.117) * (-826.162) (-825.076) [-826.685] (-826.302) -- 0:00:54
      249000 -- [-824.642] (-825.741) (-828.575) (-832.288) * (-824.044) (-825.103) [-824.318] (-828.132) -- 0:00:54
      249500 -- [-826.806] (-826.347) (-827.126) (-829.209) * (-824.679) (-826.209) [-825.728] (-826.137) -- 0:00:54
      250000 -- [-827.078] (-826.856) (-824.164) (-824.939) * (-824.464) [-825.371] (-825.435) (-824.357) -- 0:00:54

      Average standard deviation of split frequencies: 0.018075

      250500 -- (-828.464) (-824.545) [-824.045] (-825.761) * (-825.160) (-826.830) (-825.135) [-827.582] -- 0:00:56
      251000 -- (-826.710) [-825.105] (-824.638) (-828.637) * (-825.097) (-826.431) [-825.249] (-824.819) -- 0:00:56
      251500 -- (-827.725) [-824.489] (-825.453) (-830.973) * (-826.042) (-828.955) [-826.476] (-825.965) -- 0:00:56
      252000 -- (-828.824) [-824.344] (-825.000) (-827.386) * (-825.537) (-826.805) [-825.520] (-830.100) -- 0:00:56
      252500 -- (-830.461) (-826.866) [-825.820] (-825.653) * [-826.464] (-830.001) (-825.179) (-826.302) -- 0:00:56
      253000 -- (-830.326) (-828.028) [-823.789] (-827.858) * (-826.028) (-827.624) [-824.412] (-826.026) -- 0:00:56
      253500 -- [-827.518] (-825.715) (-824.263) (-825.884) * (-825.105) (-827.762) [-825.128] (-825.890) -- 0:00:55
      254000 -- (-825.991) (-826.543) (-829.476) [-824.588] * (-825.669) (-829.313) (-825.879) [-824.930] -- 0:00:55
      254500 -- (-826.462) (-825.503) (-826.122) [-829.504] * (-828.407) [-827.090] (-825.485) (-825.841) -- 0:00:55
      255000 -- (-825.134) (-824.522) [-829.730] (-825.515) * [-828.266] (-825.731) (-828.692) (-830.911) -- 0:00:55

      Average standard deviation of split frequencies: 0.018517

      255500 -- (-824.825) (-827.019) [-826.354] (-826.406) * (-826.716) (-828.584) (-827.670) [-827.538] -- 0:00:55
      256000 -- (-826.674) (-824.713) (-827.409) [-824.961] * (-825.586) (-824.353) (-823.899) [-827.431] -- 0:00:55
      256500 -- (-826.058) [-825.047] (-827.336) (-829.293) * (-826.164) (-829.960) [-827.192] (-828.847) -- 0:00:55
      257000 -- (-824.706) (-823.995) (-828.592) [-829.274] * [-824.829] (-825.905) (-824.344) (-824.392) -- 0:00:54
      257500 -- (-827.555) [-825.608] (-825.397) (-826.098) * (-826.384) (-826.559) (-824.627) [-824.197] -- 0:00:54
      258000 -- [-827.482] (-825.082) (-826.970) (-826.913) * (-826.492) [-824.394] (-825.021) (-825.960) -- 0:00:54
      258500 -- (-825.897) (-826.589) [-826.041] (-828.235) * (-826.499) (-827.688) (-824.553) [-825.515] -- 0:00:54
      259000 -- (-826.179) (-827.387) [-827.415] (-827.164) * (-826.370) [-824.693] (-825.844) (-825.490) -- 0:00:54
      259500 -- [-825.228] (-825.868) (-826.660) (-826.389) * (-826.467) (-829.416) [-824.691] (-824.454) -- 0:00:54
      260000 -- (-827.792) (-825.863) (-825.013) [-825.172] * (-825.236) [-827.918] (-824.708) (-827.620) -- 0:00:54

      Average standard deviation of split frequencies: 0.017984

      260500 -- [-828.040] (-824.982) (-830.230) (-826.545) * (-829.056) [-824.038] (-825.043) (-828.523) -- 0:00:53
      261000 -- (-825.390) [-827.104] (-831.111) (-827.357) * [-832.123] (-828.779) (-826.932) (-825.860) -- 0:00:53
      261500 -- [-824.415] (-825.364) (-829.126) (-827.625) * (-827.175) [-826.411] (-828.601) (-825.605) -- 0:00:53
      262000 -- (-827.626) (-828.379) [-824.358] (-824.614) * (-824.231) (-825.304) (-834.839) [-825.976] -- 0:00:53
      262500 -- (-825.351) [-826.912] (-825.015) (-827.170) * [-828.269] (-826.171) (-828.984) (-823.759) -- 0:00:53
      263000 -- (-824.850) (-826.298) (-825.905) [-828.153] * (-824.796) [-826.547] (-825.643) (-826.197) -- 0:00:53
      263500 -- (-827.671) (-825.370) (-828.916) [-826.396] * (-824.261) (-825.797) (-825.460) [-825.407] -- 0:00:53
      264000 -- (-827.361) (-825.789) (-828.730) [-826.535] * (-824.162) (-829.027) (-826.582) [-825.688] -- 0:00:52
      264500 -- (-825.503) [-827.044] (-824.955) (-827.505) * (-827.078) [-830.684] (-827.349) (-826.718) -- 0:00:55
      265000 -- (-827.383) (-826.016) [-826.287] (-825.471) * [-827.530] (-825.617) (-826.323) (-828.613) -- 0:00:55

      Average standard deviation of split frequencies: 0.017131

      265500 -- (-824.680) (-825.306) (-823.856) [-825.258] * (-825.100) (-826.519) [-825.490] (-827.387) -- 0:00:55
      266000 -- (-826.205) (-832.511) (-829.213) [-828.198] * (-825.153) (-824.148) [-825.192] (-825.125) -- 0:00:55
      266500 -- [-826.021] (-825.281) (-832.372) (-827.416) * [-824.389] (-826.728) (-831.633) (-829.996) -- 0:00:55
      267000 -- [-826.229] (-825.623) (-828.448) (-832.763) * (-827.747) (-829.932) [-824.771] (-829.551) -- 0:00:54
      267500 -- (-828.316) (-824.077) (-825.741) [-825.307] * (-824.516) [-828.839] (-824.547) (-829.121) -- 0:00:54
      268000 -- [-829.680] (-827.007) (-825.663) (-828.386) * (-824.530) (-828.841) (-827.857) [-829.806] -- 0:00:54
      268500 -- [-829.020] (-830.185) (-824.674) (-825.965) * (-826.274) (-825.879) (-824.647) [-827.347] -- 0:00:54
      269000 -- [-829.575] (-830.240) (-825.877) (-825.351) * (-823.984) (-826.722) [-825.795] (-825.816) -- 0:00:54
      269500 -- (-827.494) (-827.992) [-825.082] (-826.149) * [-827.705] (-829.356) (-832.215) (-829.402) -- 0:00:54
      270000 -- (-825.403) (-826.358) [-825.090] (-827.134) * (-826.146) (-825.798) (-827.324) [-825.443] -- 0:00:54

      Average standard deviation of split frequencies: 0.016836

      270500 -- (-828.524) (-829.849) [-826.063] (-829.952) * [-824.807] (-824.471) (-824.609) (-826.107) -- 0:00:53
      271000 -- [-827.066] (-828.266) (-825.724) (-826.431) * (-824.104) (-825.920) (-825.706) [-826.467] -- 0:00:53
      271500 -- (-829.858) (-826.532) (-823.782) [-825.456] * [-824.511] (-833.200) (-824.970) (-827.726) -- 0:00:53
      272000 -- (-825.067) (-830.749) (-824.151) [-826.062] * (-824.164) [-827.335] (-824.061) (-827.694) -- 0:00:53
      272500 -- (-825.650) (-828.028) [-824.524] (-825.976) * (-825.679) (-828.885) (-829.811) [-825.616] -- 0:00:53
      273000 -- [-827.005] (-830.603) (-825.150) (-826.616) * [-825.357] (-825.642) (-827.129) (-825.584) -- 0:00:53
      273500 -- (-828.661) [-825.145] (-825.812) (-824.742) * [-826.103] (-826.856) (-827.603) (-828.996) -- 0:00:53
      274000 -- (-825.870) [-825.878] (-824.516) (-826.672) * (-826.406) (-825.849) (-826.746) [-827.042] -- 0:00:52
      274500 -- (-824.372) (-825.652) [-824.577] (-825.677) * (-825.333) [-824.017] (-826.574) (-825.617) -- 0:00:52
      275000 -- [-826.157] (-824.901) (-826.823) (-830.146) * (-825.466) (-825.162) [-825.299] (-828.678) -- 0:00:52

      Average standard deviation of split frequencies: 0.017365

      275500 -- (-828.714) [-826.650] (-825.836) (-829.002) * (-825.275) (-827.564) [-826.218] (-826.483) -- 0:00:52
      276000 -- (-824.846) (-825.094) (-826.630) [-826.885] * [-826.414] (-826.395) (-827.986) (-828.333) -- 0:00:52
      276500 -- [-824.236] (-829.201) (-826.737) (-826.820) * (-824.423) (-827.810) [-827.007] (-829.315) -- 0:00:52
      277000 -- (-825.314) (-828.796) (-824.750) [-825.831] * (-826.008) (-826.162) [-826.200] (-826.530) -- 0:00:52
      277500 -- [-824.975] (-827.832) (-832.241) (-826.716) * [-829.472] (-825.738) (-826.746) (-825.317) -- 0:00:52
      278000 -- (-826.596) (-825.796) [-828.962] (-824.798) * (-826.297) (-827.514) (-825.415) [-824.461] -- 0:00:51
      278500 -- (-833.858) [-826.573] (-827.747) (-825.444) * (-825.213) (-827.809) [-829.601] (-824.383) -- 0:00:54
      279000 -- (-828.385) [-825.789] (-827.548) (-827.795) * (-824.373) [-827.328] (-826.358) (-824.663) -- 0:00:54
      279500 -- (-830.346) [-826.014] (-829.159) (-829.416) * (-825.384) (-824.349) (-826.429) [-825.578] -- 0:00:54
      280000 -- (-827.221) (-825.277) [-823.949] (-830.682) * (-828.114) (-825.155) [-825.518] (-826.288) -- 0:00:53

      Average standard deviation of split frequencies: 0.018080

      280500 -- (-828.199) [-828.602] (-824.452) (-830.317) * (-826.577) (-825.378) [-825.732] (-824.279) -- 0:00:53
      281000 -- (-829.688) (-827.475) (-827.278) [-827.903] * (-827.633) (-824.202) (-825.215) [-825.275] -- 0:00:53
      281500 -- (-825.076) [-825.264] (-826.776) (-830.844) * (-824.686) [-833.117] (-826.342) (-825.323) -- 0:00:53
      282000 -- [-826.910] (-826.648) (-826.164) (-828.734) * (-824.530) [-827.955] (-824.532) (-828.193) -- 0:00:53
      282500 -- (-832.649) [-825.124] (-828.351) (-828.041) * (-827.659) (-828.290) (-825.312) [-824.319] -- 0:00:53
      283000 -- (-826.198) (-829.209) (-825.472) [-828.260] * (-827.876) [-825.437] (-828.455) (-825.945) -- 0:00:53
      283500 -- (-829.861) (-827.504) [-824.704] (-829.035) * (-827.773) [-826.472] (-830.081) (-828.650) -- 0:00:53
      284000 -- (-827.340) (-825.109) (-827.217) [-824.382] * (-827.503) (-824.291) (-825.832) [-825.416] -- 0:00:52
      284500 -- (-825.511) (-824.438) [-829.778] (-826.093) * (-826.494) (-824.916) (-825.687) [-826.017] -- 0:00:52
      285000 -- [-827.677] (-828.476) (-827.277) (-831.044) * [-827.267] (-830.420) (-825.787) (-825.230) -- 0:00:52

      Average standard deviation of split frequencies: 0.017398

      285500 -- [-826.448] (-824.821) (-823.872) (-826.534) * [-828.141] (-826.989) (-825.279) (-824.617) -- 0:00:52
      286000 -- (-829.767) (-826.475) (-834.016) [-830.458] * [-826.883] (-825.086) (-824.894) (-824.613) -- 0:00:52
      286500 -- (-828.458) (-828.802) (-825.374) [-828.866] * (-829.040) (-826.203) (-826.434) [-826.365] -- 0:00:52
      287000 -- (-825.729) (-827.908) (-824.663) [-825.997] * (-828.617) [-825.020] (-825.939) (-826.087) -- 0:00:52
      287500 -- [-826.354] (-826.531) (-825.442) (-827.567) * (-825.837) (-825.975) [-826.273] (-825.030) -- 0:00:52
      288000 -- [-829.058] (-827.005) (-825.486) (-829.187) * (-824.581) (-825.444) [-825.746] (-824.681) -- 0:00:51
      288500 -- (-829.304) (-827.092) [-829.651] (-826.229) * (-825.307) (-824.877) [-825.655] (-824.783) -- 0:00:51
      289000 -- [-825.518] (-824.957) (-825.645) (-825.681) * (-826.378) (-827.558) (-825.487) [-829.431] -- 0:00:51
      289500 -- [-826.103] (-832.094) (-825.156) (-826.201) * (-826.122) [-829.705] (-829.947) (-826.070) -- 0:00:51
      290000 -- (-825.421) (-826.451) [-826.987] (-825.123) * (-827.746) (-825.794) (-829.402) [-824.505] -- 0:00:51

      Average standard deviation of split frequencies: 0.016308

      290500 -- (-830.803) (-825.508) [-826.400] (-826.228) * (-825.289) (-826.911) (-829.905) [-824.012] -- 0:00:51
      291000 -- (-826.402) (-825.305) [-826.267] (-828.485) * (-825.361) (-825.297) (-829.277) [-825.542] -- 0:00:51
      291500 -- [-827.974] (-826.329) (-829.843) (-827.472) * [-826.166] (-826.940) (-827.270) (-825.643) -- 0:00:51
      292000 -- (-828.698) [-825.355] (-831.858) (-827.133) * [-825.235] (-828.396) (-826.884) (-825.435) -- 0:00:50
      292500 -- (-826.055) (-827.490) [-829.675] (-824.057) * (-826.767) [-826.518] (-825.540) (-831.273) -- 0:00:50
      293000 -- [-826.461] (-826.962) (-826.628) (-825.006) * (-825.310) (-825.495) [-825.330] (-828.020) -- 0:00:53
      293500 -- (-824.777) (-829.684) [-828.103] (-825.427) * (-824.448) (-824.843) (-823.982) [-826.545] -- 0:00:52
      294000 -- (-824.431) [-825.656] (-826.085) (-824.796) * (-824.895) (-825.407) (-830.442) [-826.872] -- 0:00:52
      294500 -- [-825.021] (-826.254) (-826.190) (-827.790) * [-827.162] (-829.098) (-826.293) (-825.448) -- 0:00:52
      295000 -- (-829.344) [-825.489] (-829.504) (-826.970) * (-827.956) (-828.275) (-824.546) [-824.923] -- 0:00:52

      Average standard deviation of split frequencies: 0.016457

      295500 -- [-827.372] (-836.983) (-828.067) (-827.794) * (-825.545) (-827.767) (-824.227) [-826.382] -- 0:00:52
      296000 -- [-825.353] (-826.529) (-824.695) (-825.773) * [-824.683] (-825.184) (-823.871) (-824.729) -- 0:00:52
      296500 -- (-825.768) (-825.768) (-824.348) [-826.257] * (-826.124) (-826.227) [-827.094] (-825.966) -- 0:00:52
      297000 -- (-826.082) (-825.400) [-827.436] (-828.527) * [-824.765] (-829.125) (-830.882) (-826.755) -- 0:00:52
      297500 -- (-824.726) [-824.523] (-824.890) (-826.435) * (-825.482) (-826.745) [-824.762] (-826.175) -- 0:00:51
      298000 -- (-826.889) (-826.012) (-824.241) [-825.091] * (-827.621) (-825.883) [-824.723] (-832.185) -- 0:00:51
      298500 -- (-829.065) [-824.024] (-825.005) (-825.742) * (-826.120) (-824.223) (-825.807) [-828.490] -- 0:00:51
      299000 -- (-828.238) [-825.851] (-828.314) (-826.079) * (-826.637) (-828.315) (-824.351) [-824.411] -- 0:00:51
      299500 -- [-824.570] (-827.588) (-828.276) (-825.519) * (-827.046) (-827.378) [-830.671] (-828.528) -- 0:00:51
      300000 -- (-827.483) [-824.359] (-825.196) (-825.719) * [-825.460] (-826.022) (-825.570) (-827.082) -- 0:00:51

      Average standard deviation of split frequencies: 0.016637

      300500 -- (-828.428) (-825.361) [-824.712] (-826.815) * (-825.241) (-828.755) (-825.470) [-824.922] -- 0:00:51
      301000 -- (-826.068) (-824.568) [-825.183] (-830.694) * [-825.305] (-825.869) (-824.943) (-827.023) -- 0:00:51
      301500 -- [-828.115] (-827.118) (-828.001) (-824.600) * (-824.096) (-826.440) (-826.066) [-825.990] -- 0:00:50
      302000 -- (-828.781) (-825.487) (-829.307) [-826.526] * (-826.312) [-825.190] (-829.274) (-827.664) -- 0:00:50
      302500 -- (-825.766) [-826.191] (-825.853) (-824.328) * (-826.296) (-824.768) (-828.129) [-824.506] -- 0:00:50
      303000 -- (-826.641) [-827.969] (-827.605) (-825.810) * [-825.990] (-824.270) (-826.634) (-826.398) -- 0:00:50
      303500 -- [-827.873] (-825.959) (-827.376) (-825.192) * (-829.381) (-824.772) [-828.602] (-827.596) -- 0:00:50
      304000 -- (-825.040) [-824.859] (-826.694) (-825.340) * (-828.398) [-827.654] (-830.567) (-825.008) -- 0:00:50
      304500 -- (-824.116) (-826.429) [-826.712] (-827.866) * (-825.880) (-825.210) [-824.255] (-825.666) -- 0:00:50
      305000 -- (-828.405) [-827.693] (-825.870) (-825.270) * [-826.177] (-824.776) (-825.135) (-825.445) -- 0:00:50

      Average standard deviation of split frequencies: 0.016261

      305500 -- (-826.318) (-824.985) (-827.506) [-826.555] * [-825.596] (-825.418) (-825.780) (-832.465) -- 0:00:50
      306000 -- (-827.226) [-826.015] (-825.721) (-825.449) * [-825.008] (-828.242) (-825.865) (-826.738) -- 0:00:49
      306500 -- (-826.548) (-825.776) [-826.386] (-827.281) * [-825.481] (-831.329) (-825.101) (-828.604) -- 0:00:49
      307000 -- [-825.042] (-825.665) (-828.275) (-827.121) * (-828.442) (-824.770) [-829.268] (-826.106) -- 0:00:51
      307500 -- (-825.232) (-824.547) [-827.451] (-827.828) * (-826.317) (-824.849) [-824.844] (-828.269) -- 0:00:51
      308000 -- (-825.873) (-827.822) [-826.522] (-827.652) * (-828.514) (-828.487) [-825.309] (-828.834) -- 0:00:51
      308500 -- (-825.873) (-829.005) (-828.622) [-826.857] * (-827.471) (-825.168) (-827.605) [-824.616] -- 0:00:51
      309000 -- (-828.113) [-830.536] (-833.887) (-824.681) * [-825.198] (-825.754) (-824.529) (-824.723) -- 0:00:51
      309500 -- [-825.725] (-825.006) (-828.670) (-826.115) * [-825.085] (-834.391) (-824.932) (-825.952) -- 0:00:51
      310000 -- (-828.350) (-825.143) [-828.236] (-826.265) * (-827.491) (-824.129) (-824.661) [-824.124] -- 0:00:51

      Average standard deviation of split frequencies: 0.014752

      310500 -- [-827.882] (-833.972) (-828.294) (-826.329) * (-826.144) [-824.708] (-828.147) (-824.728) -- 0:00:51
      311000 -- (-826.332) (-831.780) (-833.968) [-825.771] * (-827.357) (-826.830) (-829.529) [-824.228] -- 0:00:50
      311500 -- [-824.749] (-824.766) (-825.466) (-826.009) * (-827.627) (-827.085) [-827.550] (-825.515) -- 0:00:50
      312000 -- [-824.705] (-824.125) (-824.821) (-824.884) * (-827.602) [-829.089] (-826.846) (-825.831) -- 0:00:50
      312500 -- (-827.817) (-829.886) [-826.014] (-825.796) * (-825.325) [-824.690] (-826.840) (-826.118) -- 0:00:50
      313000 -- [-825.266] (-827.547) (-824.670) (-824.937) * (-825.511) (-824.334) [-826.602] (-825.830) -- 0:00:50
      313500 -- [-825.557] (-826.891) (-827.739) (-826.933) * (-828.323) (-825.773) [-826.812] (-824.884) -- 0:00:50
      314000 -- [-824.124] (-825.656) (-828.111) (-828.077) * (-829.593) [-827.851] (-826.777) (-824.762) -- 0:00:50
      314500 -- (-827.152) (-826.893) (-827.175) [-824.259] * (-826.399) [-824.892] (-825.637) (-824.871) -- 0:00:50
      315000 -- (-827.148) (-825.580) [-825.400] (-824.051) * (-826.626) [-825.174] (-824.527) (-825.735) -- 0:00:50

      Average standard deviation of split frequencies: 0.014835

      315500 -- (-825.467) (-826.141) (-825.763) [-825.769] * (-826.742) (-827.588) [-825.666] (-827.399) -- 0:00:49
      316000 -- (-826.091) (-827.960) (-828.147) [-825.925] * (-829.382) (-826.781) [-824.395] (-828.654) -- 0:00:49
      316500 -- (-825.566) (-829.475) [-827.520] (-827.071) * (-825.617) (-823.800) (-826.550) [-824.462] -- 0:00:49
      317000 -- [-824.887] (-827.889) (-825.591) (-824.013) * [-825.272] (-826.594) (-826.469) (-824.444) -- 0:00:49
      317500 -- [-824.857] (-825.423) (-825.999) (-825.422) * (-825.715) (-827.069) [-826.181] (-826.846) -- 0:00:49
      318000 -- (-829.173) (-824.569) (-826.060) [-825.111] * (-825.445) (-825.154) [-825.601] (-826.908) -- 0:00:49
      318500 -- (-829.717) (-827.140) [-825.412] (-827.695) * [-824.470] (-827.511) (-829.939) (-826.289) -- 0:00:49
      319000 -- (-827.232) (-826.931) (-827.164) [-824.924] * (-830.078) (-826.441) [-828.276] (-825.855) -- 0:00:49
      319500 -- (-824.685) (-826.327) (-828.928) [-826.615] * (-824.693) (-830.400) (-824.768) [-826.004] -- 0:00:48
      320000 -- (-824.953) [-825.078] (-835.650) (-824.079) * [-826.562] (-826.026) (-824.372) (-829.829) -- 0:00:48

      Average standard deviation of split frequencies: 0.014129

      320500 -- (-827.221) [-825.725] (-825.582) (-826.102) * (-825.335) [-826.405] (-825.151) (-825.632) -- 0:00:48
      321000 -- (-828.366) [-826.155] (-825.205) (-824.397) * (-824.804) [-826.658] (-826.130) (-823.731) -- 0:00:50
      321500 -- [-827.289] (-825.028) (-825.564) (-829.802) * (-827.000) [-828.214] (-825.223) (-826.298) -- 0:00:50
      322000 -- (-829.290) (-825.922) [-825.730] (-825.319) * (-825.961) (-829.558) [-827.614] (-827.781) -- 0:00:50
      322500 -- (-825.887) [-826.509] (-826.003) (-826.113) * (-824.729) [-826.342] (-830.348) (-829.994) -- 0:00:50
      323000 -- (-824.516) (-829.999) [-827.223] (-827.598) * (-825.072) (-828.765) (-831.721) [-825.264] -- 0:00:50
      323500 -- [-827.777] (-832.059) (-824.282) (-828.897) * (-825.981) [-830.368] (-827.936) (-825.394) -- 0:00:50
      324000 -- (-830.173) (-828.358) [-824.883] (-829.864) * (-825.895) (-827.228) (-828.347) [-827.732] -- 0:00:50
      324500 -- [-829.164] (-827.076) (-825.248) (-825.894) * (-825.766) [-829.225] (-827.167) (-827.267) -- 0:00:49
      325000 -- [-827.120] (-825.695) (-826.563) (-825.032) * (-826.237) (-824.930) (-827.603) [-827.410] -- 0:00:49

      Average standard deviation of split frequencies: 0.013577

      325500 -- (-824.231) [-824.101] (-828.066) (-833.025) * (-826.429) (-826.529) [-825.324] (-826.277) -- 0:00:49
      326000 -- (-832.176) [-827.781] (-828.211) (-829.304) * [-827.482] (-826.220) (-825.776) (-824.564) -- 0:00:49
      326500 -- (-832.102) [-825.175] (-825.374) (-827.086) * (-825.882) (-830.511) (-831.589) [-825.776] -- 0:00:49
      327000 -- (-826.884) (-825.667) [-824.868] (-827.967) * (-824.076) (-825.384) (-828.867) [-825.515] -- 0:00:49
      327500 -- (-828.567) (-826.973) (-825.389) [-829.248] * [-824.670] (-824.767) (-829.751) (-824.093) -- 0:00:49
      328000 -- [-827.235] (-831.004) (-825.087) (-825.878) * (-824.333) (-830.376) (-825.445) [-826.414] -- 0:00:49
      328500 -- (-825.767) (-829.600) [-830.096] (-826.572) * (-824.252) (-830.670) [-826.462] (-829.752) -- 0:00:49
      329000 -- (-825.450) (-825.525) (-827.201) [-826.710] * [-826.000] (-830.459) (-827.715) (-829.919) -- 0:00:48
      329500 -- (-826.229) [-828.233] (-824.643) (-825.496) * (-825.951) (-828.540) (-828.593) [-826.026] -- 0:00:48
      330000 -- (-825.548) (-827.384) (-824.503) [-827.647] * (-825.850) [-826.120] (-825.971) (-824.101) -- 0:00:48

      Average standard deviation of split frequencies: 0.012910

      330500 -- [-825.329] (-826.824) (-825.777) (-826.165) * [-825.683] (-824.331) (-826.140) (-826.685) -- 0:00:48
      331000 -- [-825.325] (-825.617) (-825.039) (-828.179) * [-824.973] (-825.158) (-829.342) (-826.239) -- 0:00:48
      331500 -- (-826.711) [-825.147] (-831.841) (-828.674) * (-825.237) [-824.916] (-827.403) (-825.113) -- 0:00:48
      332000 -- (-828.085) [-826.652] (-826.129) (-825.442) * (-826.820) (-824.794) [-831.220] (-824.358) -- 0:00:48
      332500 -- (-824.061) (-830.360) (-826.057) [-825.481] * (-826.571) [-825.435] (-824.265) (-826.885) -- 0:00:48
      333000 -- (-826.016) (-825.947) (-827.318) [-828.918] * (-825.138) [-826.144] (-825.048) (-826.264) -- 0:00:48
      333500 -- (-826.503) (-825.624) (-825.063) [-824.720] * (-827.965) (-827.374) (-827.759) [-824.015] -- 0:00:47
      334000 -- (-825.792) (-826.489) (-828.847) [-825.879] * [-829.232] (-825.599) (-832.354) (-826.442) -- 0:00:47
      334500 -- (-826.087) (-827.850) (-827.132) [-826.201] * (-825.319) [-824.443] (-826.478) (-826.832) -- 0:00:47
      335000 -- (-824.603) (-826.395) (-826.776) [-826.777] * [-825.149] (-826.900) (-824.581) (-825.780) -- 0:00:47

      Average standard deviation of split frequencies: 0.013017

      335500 -- (-826.717) (-830.117) (-824.603) [-828.121] * (-824.659) (-826.014) (-825.370) [-827.272] -- 0:00:49
      336000 -- [-825.893] (-825.473) (-825.802) (-826.349) * (-828.945) (-825.977) (-826.263) [-829.309] -- 0:00:49
      336500 -- [-826.125] (-825.823) (-825.792) (-825.845) * (-825.343) (-826.164) [-825.131] (-825.453) -- 0:00:49
      337000 -- (-825.723) (-825.461) [-825.711] (-825.545) * (-826.288) [-824.410] (-828.501) (-826.215) -- 0:00:49
      337500 -- (-827.946) (-826.373) (-825.836) [-827.095] * (-828.356) (-825.532) [-826.662] (-827.143) -- 0:00:49
      338000 -- [-825.362] (-827.147) (-824.856) (-827.339) * (-828.940) (-825.393) [-826.673] (-825.031) -- 0:00:48
      338500 -- [-827.423] (-826.903) (-826.678) (-828.450) * (-826.513) (-827.072) (-825.858) [-824.175] -- 0:00:48
      339000 -- [-825.648] (-829.798) (-831.522) (-824.915) * (-832.228) (-824.099) (-826.051) [-824.044] -- 0:00:48
      339500 -- (-825.007) (-830.125) [-830.240] (-825.136) * (-827.247) (-825.595) (-826.632) [-824.302] -- 0:00:48
      340000 -- (-825.089) [-829.500] (-827.592) (-824.796) * (-826.804) (-825.933) [-826.906] (-826.239) -- 0:00:48

      Average standard deviation of split frequencies: 0.012210

      340500 -- (-824.255) (-827.525) [-825.396] (-825.686) * (-825.269) (-825.810) [-825.584] (-825.627) -- 0:00:48
      341000 -- [-825.139] (-828.797) (-828.960) (-825.686) * [-824.582] (-826.045) (-826.543) (-825.610) -- 0:00:48
      341500 -- [-824.936] (-829.087) (-827.015) (-826.546) * (-824.670) (-826.523) [-825.686] (-825.679) -- 0:00:48
      342000 -- (-824.823) [-824.690] (-828.935) (-826.013) * (-826.964) (-830.052) (-824.455) [-825.229] -- 0:00:48
      342500 -- (-824.773) [-824.538] (-832.111) (-825.971) * (-826.162) (-827.046) (-824.708) [-826.382] -- 0:00:47
      343000 -- (-826.239) (-824.550) [-826.610] (-827.098) * (-829.184) [-825.794] (-826.165) (-826.220) -- 0:00:47
      343500 -- (-825.240) (-826.438) [-826.330] (-827.435) * [-826.567] (-825.161) (-827.114) (-826.375) -- 0:00:47
      344000 -- (-831.032) (-824.417) [-825.191] (-824.951) * (-829.353) (-825.239) [-825.387] (-827.271) -- 0:00:47
      344500 -- [-824.993] (-825.694) (-826.907) (-824.966) * (-825.593) (-826.876) [-825.068] (-830.061) -- 0:00:47
      345000 -- (-825.877) (-827.787) (-825.289) [-826.705] * (-827.001) [-827.418] (-830.650) (-829.456) -- 0:00:47

      Average standard deviation of split frequencies: 0.011959

      345500 -- [-825.859] (-827.301) (-825.512) (-826.156) * [-827.587] (-827.003) (-825.552) (-826.071) -- 0:00:47
      346000 -- (-824.866) (-827.377) [-827.476] (-826.092) * (-827.022) (-825.094) (-826.550) [-825.585] -- 0:00:47
      346500 -- (-825.724) (-824.569) (-826.660) [-827.603] * (-824.830) [-825.940] (-827.647) (-826.030) -- 0:00:47
      347000 -- (-824.427) (-826.290) [-827.584] (-826.882) * [-827.672] (-825.475) (-828.620) (-826.292) -- 0:00:47
      347500 -- (-824.585) [-827.387] (-824.796) (-824.139) * (-825.361) (-824.618) (-825.176) [-827.448] -- 0:00:46
      348000 -- (-826.305) (-828.114) (-826.455) [-824.857] * [-825.689] (-826.320) (-826.810) (-827.210) -- 0:00:46
      348500 -- [-825.015] (-831.086) (-827.794) (-826.544) * (-825.590) (-825.429) [-829.058] (-825.998) -- 0:00:46
      349000 -- (-825.061) [-828.556] (-828.129) (-824.872) * [-827.236] (-829.184) (-826.182) (-825.626) -- 0:00:46
      349500 -- [-825.747] (-828.953) (-826.467) (-826.427) * (-825.320) (-827.891) (-825.281) [-825.418] -- 0:00:48
      350000 -- [-824.700] (-825.350) (-827.141) (-827.351) * (-827.581) (-826.332) [-824.780] (-825.572) -- 0:00:48

      Average standard deviation of split frequencies: 0.011150

      350500 -- (-825.385) [-827.104] (-826.373) (-824.398) * (-826.354) (-827.465) (-826.080) [-823.842] -- 0:00:48
      351000 -- (-825.334) (-826.867) (-825.395) [-825.801] * (-830.706) (-828.359) (-825.013) [-828.795] -- 0:00:48
      351500 -- (-824.620) (-826.919) [-825.817] (-825.367) * (-833.110) (-826.649) [-829.287] (-824.544) -- 0:00:47
      352000 -- (-825.525) (-831.491) [-825.633] (-826.800) * (-829.063) [-826.675] (-826.390) (-825.615) -- 0:00:47
      352500 -- (-825.871) (-824.522) [-826.534] (-830.984) * (-827.731) (-824.384) (-826.434) [-827.066] -- 0:00:47
      353000 -- (-825.756) (-824.082) [-830.035] (-827.904) * (-825.172) (-828.991) (-824.990) [-826.365] -- 0:00:47
      353500 -- (-825.871) (-824.784) (-825.460) [-827.291] * (-825.921) [-827.293] (-825.886) (-825.315) -- 0:00:47
      354000 -- (-826.396) (-824.789) [-828.679] (-824.820) * [-828.298] (-828.663) (-826.883) (-836.688) -- 0:00:47
      354500 -- (-829.005) [-825.456] (-825.242) (-825.098) * (-829.886) (-827.689) [-825.650] (-831.492) -- 0:00:47
      355000 -- (-828.149) (-829.840) [-826.109] (-823.848) * [-824.737] (-827.752) (-827.933) (-825.274) -- 0:00:47

      Average standard deviation of split frequencies: 0.011061

      355500 -- (-825.756) (-829.197) (-823.922) [-825.508] * (-827.492) (-828.951) (-828.039) [-825.144] -- 0:00:47
      356000 -- [-824.297] (-825.753) (-827.117) (-825.155) * [-830.490] (-826.607) (-826.919) (-827.977) -- 0:00:47
      356500 -- (-828.178) [-823.948] (-824.499) (-828.668) * (-827.204) (-824.206) [-825.544] (-829.827) -- 0:00:46
      357000 -- (-827.937) (-828.101) (-825.620) [-826.152] * (-825.488) (-826.370) (-825.161) [-824.503] -- 0:00:46
      357500 -- (-825.207) (-825.259) [-824.580] (-823.994) * [-825.471] (-827.744) (-826.304) (-828.228) -- 0:00:46
      358000 -- (-831.306) (-825.252) [-823.954] (-826.705) * (-825.498) [-825.562] (-825.159) (-824.766) -- 0:00:46
      358500 -- [-824.925] (-826.680) (-824.761) (-829.075) * (-824.809) [-826.955] (-825.916) (-824.526) -- 0:00:46
      359000 -- (-825.368) [-825.555] (-825.633) (-827.447) * (-827.701) (-827.270) [-824.951] (-824.750) -- 0:00:46
      359500 -- (-826.117) (-829.217) [-824.990] (-826.156) * (-825.767) [-825.602] (-825.198) (-827.768) -- 0:00:46
      360000 -- (-826.041) [-825.146] (-826.731) (-825.311) * [-826.113] (-824.601) (-826.326) (-824.452) -- 0:00:46

      Average standard deviation of split frequencies: 0.010687

      360500 -- (-828.605) (-825.558) (-824.418) [-826.255] * [-826.153] (-825.413) (-827.136) (-829.169) -- 0:00:46
      361000 -- (-825.935) [-827.124] (-826.177) (-831.822) * (-828.380) [-825.285] (-824.625) (-826.658) -- 0:00:46
      361500 -- [-825.908] (-827.003) (-826.384) (-828.802) * (-825.852) [-824.185] (-828.925) (-828.144) -- 0:00:45
      362000 -- (-830.836) (-829.331) [-826.563] (-827.255) * (-826.361) (-824.202) [-826.569] (-830.559) -- 0:00:45
      362500 -- (-826.587) [-829.915] (-829.287) (-827.363) * (-827.541) [-824.676] (-824.437) (-826.834) -- 0:00:45
      363000 -- [-828.436] (-830.751) (-832.989) (-826.253) * (-824.646) (-826.188) (-824.860) [-825.527] -- 0:00:45
      363500 -- (-825.919) [-826.490] (-831.039) (-825.267) * (-825.929) (-827.259) [-825.269] (-824.516) -- 0:00:45
      364000 -- (-823.912) [-825.730] (-824.286) (-826.478) * (-826.663) (-831.253) (-828.054) [-824.345] -- 0:00:47
      364500 -- (-825.275) [-825.855] (-824.239) (-826.478) * [-824.603] (-829.389) (-829.648) (-824.643) -- 0:00:47
      365000 -- (-828.727) (-826.396) [-825.044] (-824.815) * (-826.307) (-829.287) [-826.556] (-824.116) -- 0:00:46

      Average standard deviation of split frequencies: 0.010228

      365500 -- [-826.691] (-824.522) (-826.717) (-828.372) * [-828.568] (-827.457) (-824.840) (-826.573) -- 0:00:46
      366000 -- (-827.219) (-824.351) (-828.725) [-828.009] * (-826.623) [-824.810] (-826.350) (-825.621) -- 0:00:46
      366500 -- [-824.907] (-825.482) (-828.505) (-824.539) * [-827.207] (-827.610) (-831.871) (-825.983) -- 0:00:46
      367000 -- (-824.468) (-824.135) (-827.315) [-825.614] * [-826.427] (-827.623) (-827.809) (-825.899) -- 0:00:46
      367500 -- (-826.425) (-824.537) [-824.442] (-825.564) * (-824.798) (-827.999) [-826.598] (-824.787) -- 0:00:46
      368000 -- (-825.123) (-825.774) (-825.608) [-826.319] * (-827.769) (-828.596) [-830.394] (-825.058) -- 0:00:46
      368500 -- (-825.059) (-824.693) (-825.596) [-824.213] * (-824.846) (-826.663) (-826.204) [-829.221] -- 0:00:46
      369000 -- (-825.540) [-825.225] (-825.002) (-824.984) * [-826.796] (-826.459) (-827.156) (-826.128) -- 0:00:46
      369500 -- (-826.677) (-824.339) [-826.648] (-824.894) * (-826.428) [-826.777] (-826.294) (-826.361) -- 0:00:46
      370000 -- (-826.760) (-825.904) (-825.923) [-825.413] * (-827.102) (-824.603) (-825.211) [-826.185] -- 0:00:45

      Average standard deviation of split frequencies: 0.009276

      370500 -- (-826.365) [-826.166] (-825.080) (-826.244) * [-824.673] (-826.438) (-829.698) (-826.218) -- 0:00:45
      371000 -- (-824.285) [-825.792] (-826.506) (-824.245) * (-826.480) [-824.721] (-826.270) (-828.274) -- 0:00:45
      371500 -- (-825.613) [-823.825] (-825.931) (-825.627) * [-828.587] (-823.950) (-829.295) (-825.774) -- 0:00:45
      372000 -- (-824.218) (-825.901) [-825.152] (-829.252) * (-826.896) (-823.947) (-826.344) [-823.860] -- 0:00:45
      372500 -- (-824.242) [-825.974] (-827.095) (-830.318) * (-827.128) (-825.113) (-834.329) [-831.388] -- 0:00:45
      373000 -- (-824.800) (-827.131) [-825.946] (-826.839) * (-829.372) (-824.812) (-825.567) [-826.779] -- 0:00:45
      373500 -- (-828.289) [-828.220] (-827.530) (-825.068) * (-825.887) (-825.034) [-827.795] (-826.170) -- 0:00:45
      374000 -- [-827.251] (-824.372) (-824.853) (-826.283) * (-826.375) [-825.106] (-828.075) (-825.680) -- 0:00:45
      374500 -- (-826.548) [-824.430] (-824.422) (-826.748) * (-825.217) (-825.850) [-824.965] (-829.294) -- 0:00:45
      375000 -- (-825.211) [-825.097] (-825.724) (-833.323) * (-824.239) [-825.096] (-824.747) (-824.943) -- 0:00:45

      Average standard deviation of split frequencies: 0.008924

      375500 -- (-825.086) [-825.091] (-826.013) (-827.002) * (-825.115) [-827.577] (-831.064) (-826.993) -- 0:00:44
      376000 -- (-826.414) (-825.646) [-826.293] (-828.211) * (-825.836) (-826.926) (-826.962) [-823.890] -- 0:00:44
      376500 -- (-825.634) (-828.507) [-826.298] (-828.090) * (-825.179) (-825.405) (-827.889) [-824.387] -- 0:00:44
      377000 -- (-827.188) (-828.721) [-823.922] (-825.934) * (-829.883) [-828.876] (-826.559) (-826.105) -- 0:00:44
      377500 -- (-826.020) [-826.088] (-824.629) (-824.799) * (-826.194) (-829.204) [-827.362] (-824.766) -- 0:00:44
      378000 -- [-826.962] (-826.258) (-826.130) (-826.354) * (-827.995) (-826.053) [-826.405] (-826.618) -- 0:00:46
      378500 -- (-826.606) (-826.808) (-825.812) [-824.785] * [-826.758] (-826.654) (-825.178) (-828.616) -- 0:00:45
      379000 -- (-826.388) [-824.752] (-824.036) (-824.983) * [-826.993] (-825.305) (-827.648) (-830.292) -- 0:00:45
      379500 -- [-825.462] (-824.511) (-826.012) (-826.232) * (-826.296) (-824.723) (-825.320) [-825.070] -- 0:00:45
      380000 -- [-827.432] (-829.511) (-827.359) (-828.325) * (-827.103) (-825.835) (-827.095) [-827.362] -- 0:00:45

      Average standard deviation of split frequencies: 0.008450

      380500 -- (-824.219) (-829.374) (-828.296) [-828.450] * (-826.571) (-826.307) (-826.393) [-827.703] -- 0:00:45
      381000 -- (-824.734) (-826.179) (-829.448) [-827.392] * (-825.541) (-825.092) (-825.346) [-825.172] -- 0:00:45
      381500 -- (-825.723) (-824.680) (-826.665) [-826.891] * (-827.198) (-824.584) [-826.505] (-825.134) -- 0:00:45
      382000 -- [-824.753] (-825.442) (-825.849) (-827.824) * [-825.620] (-826.875) (-826.451) (-827.387) -- 0:00:45
      382500 -- [-826.991] (-827.408) (-826.030) (-825.779) * (-824.954) (-827.216) [-827.752] (-825.797) -- 0:00:45
      383000 -- [-825.515] (-827.103) (-825.723) (-832.738) * [-827.801] (-824.924) (-829.870) (-825.296) -- 0:00:45
      383500 -- (-825.891) [-825.017] (-825.458) (-825.902) * (-826.421) (-826.423) (-824.876) [-825.369] -- 0:00:45
      384000 -- (-826.698) (-826.630) [-829.906] (-829.435) * (-825.852) (-827.321) (-828.635) [-825.545] -- 0:00:44
      384500 -- (-825.836) [-826.552] (-830.646) (-825.841) * (-825.497) (-824.922) (-827.481) [-825.147] -- 0:00:44
      385000 -- (-825.978) [-827.630] (-830.327) (-825.017) * (-825.828) [-825.523] (-825.683) (-827.163) -- 0:00:44

      Average standard deviation of split frequencies: 0.008405

      385500 -- (-826.410) [-826.054] (-824.848) (-828.786) * (-825.645) [-827.123] (-826.825) (-826.646) -- 0:00:44
      386000 -- (-826.406) (-826.934) (-824.480) [-831.623] * (-826.380) [-825.957] (-824.614) (-827.855) -- 0:00:44
      386500 -- (-828.103) (-824.875) [-824.956] (-828.993) * [-825.994] (-826.148) (-829.255) (-827.777) -- 0:00:44
      387000 -- (-827.418) [-826.130] (-824.555) (-828.241) * (-826.789) (-827.646) [-825.869] (-825.818) -- 0:00:44
      387500 -- (-825.345) (-825.710) (-824.128) [-827.187] * (-827.265) [-824.690] (-825.038) (-826.202) -- 0:00:44
      388000 -- (-827.692) (-825.165) [-824.523] (-826.757) * (-824.488) (-825.728) [-825.148] (-824.926) -- 0:00:44
      388500 -- (-826.123) [-827.717] (-825.186) (-827.312) * (-825.741) (-828.076) (-825.813) [-824.166] -- 0:00:44
      389000 -- [-826.091] (-826.026) (-824.775) (-826.279) * [-824.433] (-827.513) (-829.315) (-827.773) -- 0:00:43
      389500 -- (-828.089) [-825.289] (-825.107) (-826.995) * (-830.444) (-825.972) (-824.094) [-828.411] -- 0:00:43
      390000 -- [-826.921] (-824.421) (-826.628) (-826.847) * [-824.694] (-824.211) (-824.353) (-826.077) -- 0:00:43

      Average standard deviation of split frequencies: 0.008092

      390500 -- (-827.845) [-826.619] (-828.142) (-827.170) * (-824.987) (-824.678) (-826.201) [-829.819] -- 0:00:43
      391000 -- [-827.836] (-824.731) (-824.859) (-832.043) * (-825.071) [-824.668] (-824.108) (-830.163) -- 0:00:43
      391500 -- (-824.601) (-826.631) [-825.408] (-825.330) * (-829.122) [-826.129] (-827.634) (-830.868) -- 0:00:43
      392000 -- [-825.832] (-825.544) (-825.531) (-826.982) * (-828.393) (-827.692) [-826.012] (-830.239) -- 0:00:43
      392500 -- (-826.310) (-827.989) (-830.038) [-826.874] * (-828.053) [-825.814] (-829.162) (-825.719) -- 0:00:44
      393000 -- (-824.857) (-826.518) [-825.790] (-825.999) * (-826.072) (-825.063) [-825.003] (-826.195) -- 0:00:44
      393500 -- (-825.078) (-830.332) (-827.221) [-825.974] * [-827.079] (-826.145) (-824.930) (-825.272) -- 0:00:44
      394000 -- [-824.377] (-827.563) (-827.659) (-829.298) * (-826.018) (-824.402) (-824.587) [-825.863] -- 0:00:44
      394500 -- (-827.175) (-826.291) (-828.231) [-825.994] * (-825.526) [-825.900] (-829.415) (-824.799) -- 0:00:44
      395000 -- (-824.567) (-826.539) (-828.798) [-826.434] * (-825.721) [-825.198] (-826.313) (-824.350) -- 0:00:44

      Average standard deviation of split frequencies: 0.008963

      395500 -- [-828.042] (-826.269) (-825.491) (-824.909) * (-833.965) (-827.293) (-828.794) [-826.059] -- 0:00:44
      396000 -- (-825.968) (-825.092) [-827.535] (-824.686) * (-824.959) (-828.514) (-829.599) [-824.618] -- 0:00:44
      396500 -- (-827.271) (-824.158) (-825.721) [-824.959] * [-824.959] (-826.638) (-827.508) (-826.230) -- 0:00:44
      397000 -- (-824.717) [-824.236] (-828.148) (-824.462) * (-828.253) [-828.684] (-825.444) (-824.951) -- 0:00:44
      397500 -- (-824.021) [-824.590] (-828.043) (-824.160) * [-827.004] (-827.803) (-824.668) (-826.530) -- 0:00:43
      398000 -- (-826.141) [-825.248] (-824.429) (-826.415) * [-824.539] (-826.368) (-824.501) (-827.947) -- 0:00:43
      398500 -- (-825.638) (-824.114) [-828.659] (-826.383) * (-828.472) (-827.784) (-825.154) [-828.798] -- 0:00:43
      399000 -- (-823.957) (-824.591) (-832.537) [-824.068] * (-827.114) (-826.440) (-827.308) [-825.943] -- 0:00:43
      399500 -- (-825.419) [-824.645] (-826.054) (-824.978) * [-824.662] (-827.270) (-827.041) (-828.248) -- 0:00:43
      400000 -- (-826.051) (-825.719) [-825.599] (-826.961) * (-825.851) (-827.511) (-826.877) [-825.296] -- 0:00:43

      Average standard deviation of split frequencies: 0.008374

      400500 -- [-825.999] (-825.298) (-824.665) (-828.027) * (-825.634) (-827.850) [-825.628] (-827.625) -- 0:00:43
      401000 -- [-826.359] (-825.434) (-824.972) (-827.085) * [-828.196] (-824.213) (-825.164) (-826.148) -- 0:00:43
      401500 -- (-828.466) (-824.994) (-828.881) [-828.249] * (-824.117) (-823.958) [-824.905] (-826.869) -- 0:00:43
      402000 -- (-825.654) (-824.373) [-826.314] (-826.458) * [-825.982] (-826.219) (-827.488) (-823.959) -- 0:00:43
      402500 -- [-824.552] (-825.122) (-827.276) (-825.232) * (-826.206) [-825.779] (-825.491) (-825.721) -- 0:00:43
      403000 -- (-824.304) [-827.234] (-826.720) (-828.792) * (-824.795) (-824.734) [-825.328] (-827.351) -- 0:00:42
      403500 -- [-827.604] (-825.722) (-825.653) (-827.361) * (-824.384) (-828.743) [-824.455] (-825.221) -- 0:00:42
      404000 -- [-827.529] (-825.713) (-824.768) (-826.167) * (-825.419) (-827.467) [-824.140] (-825.533) -- 0:00:42
      404500 -- (-826.948) (-828.234) [-824.411] (-827.133) * [-826.382] (-824.484) (-827.879) (-825.407) -- 0:00:42
      405000 -- (-824.524) (-826.948) [-824.404] (-826.222) * (-825.600) (-824.885) [-826.955] (-827.822) -- 0:00:42

      Average standard deviation of split frequencies: 0.009357

      405500 -- [-824.284] (-825.416) (-826.154) (-825.173) * (-824.772) (-824.525) (-824.611) [-825.233] -- 0:00:42
      406000 -- (-826.862) (-826.506) [-827.122] (-826.316) * (-832.045) (-826.424) (-824.987) [-826.863] -- 0:00:42
      406500 -- (-827.479) (-826.083) (-827.661) [-827.719] * (-825.531) (-827.947) [-827.795] (-825.364) -- 0:00:43
      407000 -- (-825.240) [-826.019] (-828.704) (-827.579) * [-824.101] (-826.246) (-824.526) (-824.915) -- 0:00:43
      407500 -- (-827.538) (-826.361) [-827.670] (-827.272) * (-825.049) (-824.774) [-823.950] (-827.048) -- 0:00:43
      408000 -- (-825.467) [-829.696] (-828.195) (-826.069) * [-824.827] (-824.454) (-824.409) (-827.605) -- 0:00:43
      408500 -- [-825.009] (-825.511) (-827.989) (-826.485) * [-825.061] (-825.884) (-827.650) (-825.266) -- 0:00:43
      409000 -- (-824.959) [-831.251] (-828.619) (-826.126) * (-827.256) [-826.125] (-824.143) (-824.125) -- 0:00:43
      409500 -- (-824.801) [-828.600] (-825.666) (-827.185) * [-824.818] (-824.366) (-825.803) (-828.092) -- 0:00:43
      410000 -- (-829.725) [-827.853] (-825.202) (-826.091) * (-825.492) (-827.766) [-824.729] (-829.222) -- 0:00:43

      Average standard deviation of split frequencies: 0.009791

      410500 -- (-825.996) [-826.477] (-830.465) (-826.858) * (-827.038) (-826.710) [-827.182] (-826.840) -- 0:00:43
      411000 -- (-824.601) (-829.409) [-826.289] (-826.296) * [-825.704] (-825.700) (-825.832) (-826.298) -- 0:00:42
      411500 -- (-827.235) (-825.432) [-825.327] (-826.208) * (-825.705) (-830.481) (-826.185) [-825.278] -- 0:00:42
      412000 -- [-825.405] (-824.064) (-824.755) (-824.988) * (-828.850) (-825.248) [-825.596] (-826.941) -- 0:00:42
      412500 -- [-825.673] (-828.634) (-826.694) (-826.308) * [-827.077] (-823.881) (-829.281) (-825.304) -- 0:00:42
      413000 -- [-827.935] (-825.816) (-828.553) (-826.733) * (-825.422) (-826.772) [-827.149] (-825.605) -- 0:00:42
      413500 -- [-829.326] (-828.682) (-826.523) (-834.187) * (-826.276) (-826.522) (-827.585) [-825.314] -- 0:00:42
      414000 -- [-825.217] (-825.355) (-825.907) (-828.982) * (-827.452) (-825.785) (-824.643) [-825.614] -- 0:00:42
      414500 -- (-824.552) (-824.607) (-825.230) [-824.503] * (-824.969) [-825.492] (-824.924) (-826.812) -- 0:00:42
      415000 -- (-824.350) [-826.769] (-826.586) (-826.139) * [-827.159] (-825.486) (-827.864) (-826.335) -- 0:00:42

      Average standard deviation of split frequencies: 0.007999

      415500 -- (-826.638) (-825.985) (-826.522) [-826.192] * (-828.132) [-825.114] (-830.016) (-827.921) -- 0:00:42
      416000 -- (-827.469) (-826.452) (-827.227) [-825.467] * (-828.085) (-831.534) (-825.092) [-824.695] -- 0:00:42
      416500 -- [-827.139] (-828.050) (-825.042) (-826.952) * [-826.230] (-825.867) (-826.790) (-824.489) -- 0:00:42
      417000 -- (-828.014) (-828.742) (-825.914) [-826.632] * (-827.090) (-824.617) [-828.342] (-825.438) -- 0:00:41
      417500 -- (-828.468) (-826.876) (-828.644) [-828.659] * (-828.193) (-827.807) [-828.533] (-828.027) -- 0:00:41
      418000 -- [-825.990] (-826.127) (-827.650) (-826.340) * (-828.733) (-825.663) [-826.433] (-827.796) -- 0:00:41
      418500 -- (-825.786) (-828.443) [-826.825] (-829.380) * (-827.601) [-824.200] (-829.017) (-829.256) -- 0:00:41
      419000 -- [-831.668] (-828.053) (-828.009) (-825.616) * [-825.675] (-824.989) (-827.082) (-824.491) -- 0:00:41
      419500 -- (-829.904) (-832.990) (-827.502) [-825.705] * (-824.472) (-826.906) [-825.073] (-824.826) -- 0:00:41
      420000 -- (-827.348) [-824.447] (-825.191) (-827.109) * (-829.150) (-824.449) (-824.863) [-827.198] -- 0:00:41

      Average standard deviation of split frequencies: 0.007383

      420500 -- (-824.958) (-825.655) [-827.570] (-824.526) * [-825.549] (-824.372) (-825.821) (-824.725) -- 0:00:42
      421000 -- [-825.361] (-826.688) (-826.798) (-826.238) * (-824.688) (-827.646) (-826.887) [-832.976] -- 0:00:42
      421500 -- (-825.821) [-825.910] (-824.775) (-827.607) * (-830.152) [-825.292] (-825.928) (-832.600) -- 0:00:42
      422000 -- (-826.750) (-824.240) [-824.017] (-825.735) * (-825.315) (-825.025) (-826.544) [-828.618] -- 0:00:42
      422500 -- (-824.035) (-826.040) (-825.207) [-824.335] * (-828.275) [-826.010] (-825.732) (-825.136) -- 0:00:42
      423000 -- (-823.777) (-826.710) (-828.051) [-828.610] * (-829.285) (-825.178) [-827.529] (-826.099) -- 0:00:42
      423500 -- (-825.049) (-831.210) (-828.211) [-825.164] * [-829.573] (-824.502) (-826.127) (-828.335) -- 0:00:42
      424000 -- (-825.707) (-831.274) [-826.719] (-825.226) * (-829.619) [-825.631] (-824.917) (-826.419) -- 0:00:42
      424500 -- (-824.782) (-828.832) [-827.950] (-824.644) * (-827.185) (-824.064) (-825.242) [-825.579] -- 0:00:42
      425000 -- (-826.856) (-829.332) [-824.466] (-824.571) * (-826.557) (-827.233) [-825.304] (-824.868) -- 0:00:41

      Average standard deviation of split frequencies: 0.007681

      425500 -- (-825.147) (-827.472) (-828.695) [-825.794] * [-824.071] (-826.114) (-824.807) (-829.556) -- 0:00:41
      426000 -- [-825.372] (-826.635) (-826.922) (-826.160) * (-825.194) (-826.357) [-824.847] (-828.318) -- 0:00:41
      426500 -- (-825.027) (-826.562) (-824.380) [-825.890] * (-824.085) [-826.567] (-824.757) (-825.200) -- 0:00:41
      427000 -- (-828.089) (-832.087) [-825.622] (-828.262) * [-825.520] (-825.270) (-825.275) (-827.050) -- 0:00:41
      427500 -- [-825.809] (-831.053) (-827.037) (-827.181) * (-825.336) [-826.860] (-826.562) (-827.786) -- 0:00:41
      428000 -- (-825.400) (-826.449) (-832.953) [-826.801] * (-829.285) (-825.186) (-825.671) [-825.389] -- 0:00:41
      428500 -- (-832.337) (-824.307) (-825.289) [-825.642] * [-827.414] (-824.774) (-825.319) (-827.447) -- 0:00:41
      429000 -- (-826.188) (-825.716) (-824.204) [-831.963] * (-826.183) [-823.773] (-824.508) (-827.822) -- 0:00:41
      429500 -- [-828.158] (-823.796) (-824.114) (-829.419) * (-825.135) (-825.510) [-827.749] (-829.251) -- 0:00:41
      430000 -- (-825.904) (-824.600) (-825.509) [-828.350] * [-824.811] (-824.212) (-825.007) (-826.780) -- 0:00:41

      Average standard deviation of split frequencies: 0.007405

      430500 -- [-825.020] (-828.781) (-825.756) (-827.262) * [-824.629] (-824.008) (-824.637) (-824.488) -- 0:00:41
      431000 -- (-829.038) (-825.737) [-826.144] (-826.822) * (-826.815) (-826.174) [-825.448] (-825.232) -- 0:00:40
      431500 -- (-824.793) (-825.343) [-825.822] (-826.028) * (-825.776) (-826.043) [-824.321] (-826.741) -- 0:00:40
      432000 -- (-825.592) (-828.405) [-827.887] (-827.774) * (-826.224) (-824.101) (-825.123) [-824.698] -- 0:00:40
      432500 -- (-824.669) (-828.253) [-825.716] (-825.642) * (-826.924) (-824.713) (-825.116) [-825.854] -- 0:00:40
      433000 -- [-823.968] (-826.239) (-826.586) (-825.248) * (-824.242) (-823.940) (-832.011) [-824.668] -- 0:00:40
      433500 -- [-824.426] (-828.286) (-826.856) (-826.539) * (-829.448) [-823.837] (-832.729) (-826.644) -- 0:00:40
      434000 -- [-829.858] (-827.367) (-824.797) (-824.549) * (-826.505) [-825.034] (-826.309) (-826.959) -- 0:00:40
      434500 -- (-825.045) (-826.496) [-826.221] (-827.109) * (-824.458) (-824.979) (-826.325) [-829.570] -- 0:00:40
      435000 -- (-826.791) [-825.881] (-828.402) (-826.845) * [-825.394] (-824.947) (-826.525) (-825.995) -- 0:00:41

      Average standard deviation of split frequencies: 0.007696

      435500 -- [-825.987] (-824.916) (-825.447) (-827.002) * (-826.203) (-828.557) [-824.755] (-828.523) -- 0:00:41
      436000 -- (-824.618) (-827.235) (-827.591) [-826.281] * (-825.143) (-828.816) [-825.591] (-825.419) -- 0:00:41
      436500 -- (-826.733) (-824.975) [-826.450] (-825.418) * (-825.001) (-828.396) [-824.332] (-827.924) -- 0:00:41
      437000 -- (-826.721) (-825.013) (-825.263) [-826.681] * (-824.384) [-825.083] (-825.368) (-828.566) -- 0:00:41
      437500 -- (-825.093) (-827.356) [-826.362] (-826.814) * (-829.560) (-825.603) [-825.656] (-828.088) -- 0:00:41
      438000 -- [-825.661] (-831.236) (-829.413) (-827.482) * (-831.884) (-827.895) [-828.987] (-824.289) -- 0:00:41
      438500 -- (-825.738) [-825.197] (-826.630) (-825.642) * [-825.825] (-825.236) (-826.275) (-824.010) -- 0:00:40
      439000 -- (-824.573) (-825.379) [-825.543] (-825.294) * (-825.574) [-825.236] (-824.308) (-828.886) -- 0:00:40
      439500 -- [-823.872] (-824.953) (-825.631) (-825.795) * (-825.152) [-825.465] (-828.049) (-827.037) -- 0:00:40
      440000 -- (-826.022) [-828.820] (-825.011) (-824.984) * (-828.615) (-825.648) [-825.494] (-831.002) -- 0:00:40

      Average standard deviation of split frequencies: 0.007889

      440500 -- (-826.500) (-828.754) (-824.128) [-829.776] * [-825.838] (-828.722) (-826.548) (-827.436) -- 0:00:40
      441000 -- [-826.364] (-825.251) (-824.282) (-825.264) * (-824.497) [-826.882] (-827.594) (-825.442) -- 0:00:40
      441500 -- [-825.676] (-827.549) (-826.468) (-828.976) * (-825.344) [-827.421] (-827.068) (-826.469) -- 0:00:40
      442000 -- (-831.174) [-828.418] (-828.220) (-827.029) * [-828.424] (-833.139) (-828.171) (-827.112) -- 0:00:40
      442500 -- (-824.677) (-828.508) (-829.799) [-825.414] * (-826.344) (-827.091) (-825.873) [-826.099] -- 0:00:40
      443000 -- (-827.093) [-826.480] (-826.211) (-827.749) * (-824.853) (-827.387) [-828.289] (-824.285) -- 0:00:40
      443500 -- (-826.025) (-824.558) (-826.319) [-824.789] * (-825.918) (-827.553) [-824.505] (-825.356) -- 0:00:40
      444000 -- (-826.211) (-825.704) [-827.323] (-827.981) * [-825.025] (-824.565) (-824.389) (-826.925) -- 0:00:40
      444500 -- [-825.746] (-827.041) (-824.454) (-826.163) * [-826.149] (-827.597) (-825.025) (-824.636) -- 0:00:39
      445000 -- (-831.601) (-826.074) (-828.246) [-825.499] * (-826.875) (-823.749) (-827.543) [-826.815] -- 0:00:39

      Average standard deviation of split frequencies: 0.008588

      445500 -- (-828.700) [-825.475] (-826.174) (-826.225) * (-824.333) [-825.476] (-827.457) (-824.761) -- 0:00:39
      446000 -- (-826.111) (-825.475) (-826.189) [-826.871] * (-826.976) [-824.200] (-825.861) (-829.043) -- 0:00:39
      446500 -- (-826.985) [-829.232] (-826.372) (-824.462) * (-826.834) (-826.226) [-833.089] (-825.774) -- 0:00:39
      447000 -- (-824.498) (-827.103) (-824.165) [-824.737] * (-825.840) [-825.639] (-824.459) (-825.652) -- 0:00:39
      447500 -- (-826.810) (-828.783) (-824.948) [-825.639] * (-825.312) (-826.022) (-825.066) [-825.669] -- 0:00:39
      448000 -- (-831.981) (-825.893) [-825.087] (-828.829) * (-825.952) (-826.581) [-824.218] (-828.442) -- 0:00:39
      448500 -- (-829.007) (-826.907) [-824.299] (-831.232) * (-825.991) (-831.582) [-828.329] (-824.837) -- 0:00:39
      449000 -- (-827.336) (-829.144) [-825.124] (-828.342) * (-826.589) (-827.081) (-825.160) [-824.677] -- 0:00:39
      449500 -- (-828.841) (-824.355) (-824.298) [-824.925] * (-826.078) (-825.200) [-824.997] (-824.816) -- 0:00:40
      450000 -- (-824.484) (-824.966) (-824.314) [-825.252] * [-827.147] (-827.298) (-825.243) (-825.186) -- 0:00:40

      Average standard deviation of split frequencies: 0.008676

      450500 -- (-824.705) (-827.408) (-826.575) [-826.132] * (-826.918) [-826.986] (-824.469) (-826.600) -- 0:00:40
      451000 -- (-829.648) (-826.386) (-827.422) [-827.267] * (-825.166) (-824.131) [-826.701] (-825.797) -- 0:00:40
      451500 -- (-829.258) [-826.600] (-826.760) (-825.552) * (-825.543) [-825.743] (-826.232) (-826.924) -- 0:00:40
      452000 -- [-828.298] (-825.739) (-825.665) (-827.715) * (-827.571) (-826.401) [-824.130] (-826.156) -- 0:00:40
      452500 -- (-828.358) (-826.451) [-824.320] (-827.490) * (-829.037) [-824.793] (-827.401) (-826.839) -- 0:00:39
      453000 -- [-828.395] (-824.577) (-827.122) (-831.093) * (-824.541) [-824.327] (-828.721) (-826.533) -- 0:00:39
      453500 -- (-826.723) [-827.047] (-827.839) (-825.169) * [-826.570] (-826.180) (-825.444) (-826.874) -- 0:00:39
      454000 -- (-824.551) [-827.208] (-826.409) (-824.519) * (-826.796) (-824.604) (-826.041) [-824.515] -- 0:00:39
      454500 -- (-825.448) (-830.718) [-825.033] (-826.236) * (-824.009) [-825.806] (-826.469) (-825.215) -- 0:00:39
      455000 -- [-824.660] (-828.173) (-824.086) (-825.777) * (-824.362) (-827.561) [-826.584] (-825.425) -- 0:00:39

      Average standard deviation of split frequencies: 0.008149

      455500 -- (-824.222) (-825.395) (-827.709) [-827.555] * (-824.516) (-825.412) (-827.132) [-825.030] -- 0:00:39
      456000 -- [-826.831] (-825.418) (-825.618) (-825.797) * (-824.041) (-826.581) (-826.268) [-825.532] -- 0:00:39
      456500 -- [-824.506] (-824.125) (-826.081) (-825.226) * (-824.136) [-828.809] (-826.907) (-828.752) -- 0:00:39
      457000 -- (-823.997) [-824.630] (-825.532) (-826.264) * [-824.071] (-828.345) (-831.356) (-827.618) -- 0:00:39
      457500 -- (-828.868) (-827.005) [-827.048] (-830.117) * (-826.123) (-829.409) (-826.510) [-830.320] -- 0:00:39
      458000 -- [-825.522] (-827.441) (-825.513) (-826.064) * (-825.069) (-831.706) (-825.645) [-827.331] -- 0:00:39
      458500 -- (-824.541) (-824.936) [-827.915] (-829.223) * [-825.397] (-826.197) (-826.498) (-825.980) -- 0:00:38
      459000 -- [-825.925] (-826.894) (-829.345) (-825.635) * (-827.179) (-825.054) [-825.828] (-824.624) -- 0:00:38
      459500 -- [-823.977] (-824.708) (-826.495) (-826.943) * (-829.650) (-825.522) (-825.162) [-825.068] -- 0:00:38
      460000 -- [-825.900] (-825.774) (-824.145) (-827.244) * (-829.191) (-826.810) [-824.667] (-825.457) -- 0:00:38

      Average standard deviation of split frequencies: 0.006843

      460500 -- [-827.282] (-824.322) (-824.324) (-826.393) * (-824.837) (-833.618) (-824.839) [-825.213] -- 0:00:38
      461000 -- (-829.656) (-824.571) (-824.555) [-825.850] * (-825.760) (-826.693) (-824.355) [-825.244] -- 0:00:38
      461500 -- [-824.657] (-825.527) (-827.468) (-824.558) * (-827.826) [-824.628] (-824.718) (-825.084) -- 0:00:38
      462000 -- (-825.188) [-824.642] (-825.276) (-824.761) * (-825.208) (-825.768) [-825.039] (-826.041) -- 0:00:38
      462500 -- (-827.806) [-825.364] (-827.628) (-824.392) * (-826.225) (-825.073) [-827.788] (-826.491) -- 0:00:38
      463000 -- (-826.128) (-824.776) (-825.848) [-824.022] * (-825.955) (-826.450) (-830.834) [-825.568] -- 0:00:38
      463500 -- (-827.619) (-824.731) (-826.897) [-827.454] * (-826.048) [-826.150] (-828.793) (-827.801) -- 0:00:39
      464000 -- (-828.324) (-824.435) (-828.604) [-828.274] * (-827.185) (-826.404) (-830.883) [-825.859] -- 0:00:39
      464500 -- (-824.476) [-824.993] (-827.481) (-828.190) * (-826.620) [-827.697] (-828.405) (-827.953) -- 0:00:39
      465000 -- (-826.606) (-824.492) [-825.323] (-831.775) * (-825.721) [-825.246] (-828.094) (-825.935) -- 0:00:39

      Average standard deviation of split frequencies: 0.007438

      465500 -- [-826.696] (-824.251) (-829.024) (-828.725) * [-824.452] (-824.731) (-828.461) (-825.793) -- 0:00:39
      466000 -- (-824.928) (-825.868) (-828.695) [-825.028] * (-825.580) (-824.981) [-827.538] (-826.851) -- 0:00:38
      466500 -- [-827.551] (-825.765) (-825.728) (-827.305) * (-825.463) (-827.744) [-826.897] (-825.446) -- 0:00:38
      467000 -- [-829.226] (-826.258) (-827.194) (-825.388) * (-825.138) (-828.134) [-824.791] (-825.825) -- 0:00:38
      467500 -- (-826.035) (-827.740) [-825.548] (-825.329) * (-828.701) (-825.244) [-824.170] (-826.924) -- 0:00:38
      468000 -- (-825.815) (-827.508) (-823.781) [-827.054] * (-826.439) [-824.579] (-828.797) (-827.551) -- 0:00:38
      468500 -- (-826.032) (-829.157) [-826.014] (-825.855) * (-826.180) [-824.485] (-827.570) (-826.843) -- 0:00:38
      469000 -- (-825.864) [-827.361] (-828.065) (-824.839) * (-827.018) (-827.806) (-827.895) [-825.607] -- 0:00:38
      469500 -- [-824.707] (-826.038) (-831.373) (-825.286) * (-826.973) [-825.432] (-824.733) (-825.947) -- 0:00:38
      470000 -- (-825.177) (-825.468) [-828.514] (-825.607) * [-825.912] (-828.420) (-824.352) (-826.727) -- 0:00:38

      Average standard deviation of split frequencies: 0.007188

      470500 -- (-824.747) (-825.716) (-827.136) [-825.245] * [-825.658] (-825.976) (-825.480) (-826.732) -- 0:00:38
      471000 -- (-826.368) (-826.743) (-827.596) [-828.165] * (-825.515) (-829.816) [-826.910] (-825.146) -- 0:00:38
      471500 -- (-826.409) [-825.025] (-825.614) (-825.306) * (-825.312) [-826.240] (-825.514) (-824.068) -- 0:00:38
      472000 -- (-825.161) (-827.064) (-829.256) [-825.297] * (-826.625) (-825.813) [-828.498] (-825.883) -- 0:00:38
      472500 -- (-827.880) [-825.664] (-826.927) (-828.366) * (-826.735) [-824.914] (-827.221) (-826.633) -- 0:00:37
      473000 -- (-827.089) (-826.746) [-825.380] (-827.065) * (-827.591) (-827.175) (-825.836) [-827.585] -- 0:00:37
      473500 -- (-827.378) (-825.939) (-826.099) [-827.839] * (-827.286) (-824.347) [-826.004] (-825.983) -- 0:00:37
      474000 -- (-826.716) (-826.677) (-828.050) [-826.683] * (-826.896) (-829.010) (-824.106) [-826.524] -- 0:00:37
      474500 -- [-827.918] (-825.826) (-827.845) (-824.249) * (-827.638) (-826.259) (-824.309) [-825.035] -- 0:00:37
      475000 -- (-826.332) (-826.476) (-827.406) [-825.632] * [-824.793] (-826.032) (-826.182) (-826.244) -- 0:00:37

      Average standard deviation of split frequencies: 0.007340

      475500 -- [-826.302] (-826.594) (-828.096) (-825.314) * (-825.435) [-825.053] (-825.799) (-828.571) -- 0:00:37
      476000 -- (-825.082) [-825.778] (-824.594) (-828.456) * [-825.234] (-824.936) (-825.653) (-827.015) -- 0:00:37
      476500 -- (-825.752) [-826.545] (-824.275) (-825.649) * (-827.157) (-826.462) [-823.907] (-823.941) -- 0:00:37
      477000 -- (-827.557) [-825.688] (-825.201) (-825.345) * (-827.946) (-828.362) (-826.777) [-824.908] -- 0:00:37
      477500 -- (-826.056) (-826.096) (-826.686) [-824.862] * (-827.058) (-827.854) (-826.366) [-825.336] -- 0:00:37
      478000 -- (-826.448) (-828.214) [-826.438] (-825.355) * (-825.585) (-830.734) [-826.391] (-827.533) -- 0:00:38
      478500 -- (-832.982) (-824.930) [-829.523] (-826.893) * (-827.421) (-828.504) (-826.110) [-827.447] -- 0:00:38
      479000 -- (-825.268) (-825.202) [-825.626] (-829.210) * (-824.867) [-825.210] (-825.845) (-828.367) -- 0:00:38
      479500 -- (-824.749) (-826.152) [-825.844] (-827.965) * (-825.192) (-829.101) [-824.793] (-827.084) -- 0:00:37
      480000 -- (-824.681) (-826.491) (-825.482) [-826.953] * [-824.669] (-833.013) (-824.310) (-829.060) -- 0:00:37

      Average standard deviation of split frequencies: 0.006807

      480500 -- (-824.854) (-828.208) (-826.217) [-824.759] * (-825.456) (-825.864) (-824.767) [-825.009] -- 0:00:37
      481000 -- (-824.521) (-824.213) (-825.049) [-826.519] * [-827.912] (-826.192) (-824.691) (-828.466) -- 0:00:37
      481500 -- (-825.795) (-826.357) (-825.210) [-824.659] * (-828.711) (-825.134) (-824.312) [-825.691] -- 0:00:37
      482000 -- [-828.410] (-830.184) (-825.936) (-825.172) * (-825.790) [-825.880] (-824.778) (-828.368) -- 0:00:37
      482500 -- (-826.653) (-826.885) (-827.749) [-824.788] * (-826.693) (-826.577) (-825.457) [-824.590] -- 0:00:37
      483000 -- (-829.086) (-826.322) [-828.455] (-826.857) * [-827.241] (-825.690) (-825.372) (-828.108) -- 0:00:37
      483500 -- (-826.697) (-828.408) (-826.520) [-827.067] * (-827.796) [-825.199] (-824.557) (-825.268) -- 0:00:37
      484000 -- (-826.647) (-830.952) [-825.943] (-826.407) * (-828.540) (-827.178) [-824.406] (-825.177) -- 0:00:37
      484500 -- (-824.582) (-827.107) (-827.515) [-825.632] * (-826.183) (-826.920) [-825.850] (-825.482) -- 0:00:37
      485000 -- (-827.890) [-826.033] (-827.956) (-826.455) * (-825.537) [-824.105] (-825.747) (-825.508) -- 0:00:37

      Average standard deviation of split frequencies: 0.007360

      485500 -- [-824.629] (-824.006) (-829.815) (-826.823) * (-827.320) (-825.067) (-824.344) [-824.399] -- 0:00:37
      486000 -- [-825.919] (-824.062) (-828.159) (-829.825) * [-828.905] (-829.832) (-826.156) (-826.744) -- 0:00:37
      486500 -- (-825.148) [-827.397] (-825.330) (-827.189) * [-829.118] (-825.998) (-826.759) (-827.757) -- 0:00:36
      487000 -- (-828.081) (-824.940) [-828.326] (-827.699) * (-831.756) [-826.927] (-827.472) (-826.351) -- 0:00:36
      487500 -- (-826.855) (-827.257) [-829.873] (-827.650) * (-827.598) [-824.669] (-828.607) (-824.806) -- 0:00:36
      488000 -- (-827.846) (-825.946) [-831.632] (-825.501) * (-826.019) (-824.735) [-830.378] (-825.725) -- 0:00:36
      488500 -- (-826.077) (-826.531) (-829.641) [-825.578] * [-825.592] (-825.039) (-825.717) (-824.642) -- 0:00:36
      489000 -- [-826.237] (-825.565) (-825.688) (-824.839) * (-824.577) (-831.881) [-827.004] (-826.299) -- 0:00:36
      489500 -- [-826.759] (-828.251) (-825.654) (-828.924) * (-824.359) [-829.688] (-828.110) (-826.120) -- 0:00:36
      490000 -- (-826.936) (-827.376) (-826.354) [-829.510] * (-826.913) (-828.482) (-825.216) [-824.420] -- 0:00:36

      Average standard deviation of split frequencies: 0.007855

      490500 -- (-829.559) (-825.171) (-829.261) [-826.899] * (-824.989) (-826.146) (-826.038) [-824.322] -- 0:00:36
      491000 -- [-828.464] (-825.427) (-831.087) (-826.860) * [-824.913] (-824.865) (-827.054) (-829.458) -- 0:00:36
      491500 -- (-828.212) [-826.592] (-824.406) (-825.374) * (-825.851) (-829.779) [-827.927] (-828.292) -- 0:00:36
      492000 -- [-824.089] (-826.189) (-825.618) (-826.448) * (-828.098) (-826.816) [-825.502] (-829.916) -- 0:00:37
      492500 -- (-824.581) (-826.853) (-828.052) [-825.888] * (-825.816) (-825.161) (-825.392) [-826.967] -- 0:00:37
      493000 -- (-824.547) (-825.335) [-827.805] (-826.818) * (-826.018) (-825.362) [-824.548] (-825.400) -- 0:00:37
      493500 -- (-826.157) (-830.182) [-828.039] (-825.269) * (-829.242) [-824.100] (-825.012) (-828.134) -- 0:00:36
      494000 -- [-825.374] (-831.193) (-829.723) (-825.725) * (-828.888) (-824.313) (-827.433) [-825.537] -- 0:00:36
      494500 -- [-826.644] (-825.432) (-830.886) (-827.321) * [-825.258] (-825.753) (-831.626) (-826.003) -- 0:00:36
      495000 -- [-825.692] (-825.844) (-826.148) (-826.131) * (-824.299) (-826.005) (-828.392) [-824.712] -- 0:00:36

      Average standard deviation of split frequencies: 0.007659

      495500 -- (-826.681) (-824.863) [-825.904] (-829.627) * (-826.910) (-835.661) (-826.161) [-824.701] -- 0:00:36
      496000 -- (-826.119) [-827.093] (-825.691) (-824.375) * (-824.762) (-827.301) (-823.836) [-826.169] -- 0:00:36
      496500 -- (-826.932) (-826.355) (-828.744) [-825.730] * (-825.669) (-825.900) [-824.568] (-826.304) -- 0:00:36
      497000 -- (-825.106) [-825.463] (-825.072) (-824.804) * (-826.263) [-827.270] (-824.159) (-826.616) -- 0:00:36
      497500 -- (-826.107) [-826.283] (-826.738) (-830.434) * [-824.902] (-833.040) (-832.966) (-825.598) -- 0:00:36
      498000 -- (-824.838) (-827.732) [-825.494] (-827.631) * (-825.418) (-824.587) (-831.805) [-825.301] -- 0:00:36
      498500 -- (-825.056) (-825.465) (-825.731) [-826.318] * (-823.863) (-828.779) (-828.167) [-824.326] -- 0:00:36
      499000 -- [-825.423] (-825.966) (-825.563) (-825.845) * (-826.432) (-828.995) [-825.864] (-827.255) -- 0:00:36
      499500 -- (-825.478) [-827.171] (-828.403) (-825.925) * [-825.745] (-827.335) (-824.882) (-825.259) -- 0:00:36
      500000 -- [-826.853] (-826.370) (-829.187) (-823.893) * [-825.134] (-826.737) (-826.648) (-825.188) -- 0:00:36

      Average standard deviation of split frequencies: 0.007532

      500500 -- (-830.742) (-830.687) [-828.976] (-824.913) * [-824.256] (-825.688) (-827.410) (-826.915) -- 0:00:35
      501000 -- [-825.810] (-826.201) (-825.578) (-825.897) * [-824.633] (-827.591) (-826.144) (-824.119) -- 0:00:35
      501500 -- (-829.924) [-825.681] (-826.650) (-826.802) * (-825.246) [-827.075] (-826.845) (-825.604) -- 0:00:35
      502000 -- (-825.450) (-828.543) (-827.403) [-824.300] * (-827.699) [-825.578] (-827.206) (-826.178) -- 0:00:35
      502500 -- (-826.184) (-826.581) [-827.538] (-824.244) * (-827.077) [-829.965] (-825.666) (-826.372) -- 0:00:35
      503000 -- (-825.859) (-825.493) [-825.021] (-825.639) * (-824.885) [-825.173] (-827.386) (-826.386) -- 0:00:35
      503500 -- [-826.870] (-825.140) (-830.135) (-825.875) * (-825.264) [-824.381] (-825.083) (-824.208) -- 0:00:35
      504000 -- (-827.834) [-825.906] (-825.248) (-824.049) * (-825.690) (-825.075) [-826.809] (-826.773) -- 0:00:35
      504500 -- [-824.644] (-825.422) (-826.608) (-828.397) * (-826.203) [-825.445] (-824.572) (-826.008) -- 0:00:35
      505000 -- (-825.254) (-825.862) [-825.224] (-825.982) * (-824.284) [-824.894] (-828.265) (-826.215) -- 0:00:35

      Average standard deviation of split frequencies: 0.007946

      505500 -- (-824.755) (-826.075) (-824.785) [-827.114] * (-824.840) [-825.535] (-824.881) (-828.327) -- 0:00:35
      506000 -- (-825.124) (-825.446) (-825.075) [-825.091] * (-823.836) (-825.722) [-826.793] (-826.013) -- 0:00:36
      506500 -- [-827.847] (-826.569) (-827.409) (-826.214) * (-824.445) (-827.140) [-826.826] (-825.254) -- 0:00:36
      507000 -- [-824.524] (-827.009) (-825.994) (-825.957) * (-826.593) [-825.989] (-827.544) (-826.948) -- 0:00:35
      507500 -- (-824.458) (-826.235) (-824.197) [-825.930] * (-824.515) [-824.920] (-825.905) (-824.561) -- 0:00:35
      508000 -- [-826.722] (-825.088) (-827.428) (-829.015) * (-827.528) (-824.182) (-825.553) [-824.327] -- 0:00:35
      508500 -- (-826.524) (-826.969) (-828.134) [-824.104] * (-826.847) (-826.996) [-829.420] (-825.652) -- 0:00:35
      509000 -- (-825.219) [-827.673] (-829.554) (-825.997) * [-825.561] (-824.822) (-828.126) (-825.600) -- 0:00:35
      509500 -- (-830.203) (-833.112) [-826.336] (-825.078) * (-826.631) (-825.401) [-825.899] (-825.660) -- 0:00:35
      510000 -- (-826.460) [-827.179] (-825.615) (-827.628) * (-825.252) [-824.557] (-828.457) (-824.577) -- 0:00:35

      Average standard deviation of split frequencies: 0.008308

      510500 -- (-826.448) (-828.571) (-827.545) [-823.951] * (-825.141) [-825.721] (-828.447) (-824.366) -- 0:00:35
      511000 -- (-826.054) (-829.085) (-828.462) [-826.994] * (-825.440) [-828.068] (-832.551) (-825.240) -- 0:00:35
      511500 -- (-830.367) [-827.659] (-825.577) (-826.495) * [-829.950] (-825.781) (-828.458) (-825.349) -- 0:00:35
      512000 -- (-824.505) [-824.066] (-824.957) (-825.322) * (-827.599) [-825.082] (-825.866) (-825.943) -- 0:00:35
      512500 -- (-825.518) [-824.747] (-826.910) (-826.477) * (-828.088) (-828.203) (-826.428) [-824.944] -- 0:00:35
      513000 -- [-826.053] (-827.320) (-825.705) (-826.226) * (-824.236) [-824.459] (-829.491) (-826.783) -- 0:00:35
      513500 -- (-826.466) (-831.579) [-828.775] (-826.018) * (-825.317) (-825.377) (-828.341) [-827.393] -- 0:00:35
      514000 -- (-824.476) (-830.296) [-824.417] (-824.375) * (-825.131) (-824.595) (-829.656) [-825.930] -- 0:00:34
      514500 -- (-824.384) [-824.664] (-826.260) (-826.081) * [-825.942] (-824.328) (-828.229) (-828.737) -- 0:00:34
      515000 -- [-825.243] (-824.930) (-831.894) (-825.765) * (-827.654) [-826.999] (-831.263) (-826.449) -- 0:00:34

      Average standard deviation of split frequencies: 0.007792

      515500 -- (-829.869) [-824.770] (-829.774) (-826.619) * (-824.970) [-828.204] (-828.874) (-826.297) -- 0:00:34
      516000 -- (-826.366) [-825.858] (-827.943) (-824.719) * (-826.711) (-826.432) [-827.914] (-827.197) -- 0:00:34
      516500 -- [-825.526] (-825.227) (-824.594) (-827.682) * (-826.009) (-827.349) [-827.042] (-828.290) -- 0:00:34
      517000 -- (-825.882) [-824.812] (-826.634) (-824.666) * (-831.426) (-827.260) [-826.075] (-827.041) -- 0:00:34
      517500 -- (-828.710) (-825.325) [-824.981] (-830.155) * (-833.583) (-825.475) (-826.088) [-826.396] -- 0:00:34
      518000 -- (-826.844) (-825.820) [-828.430] (-832.876) * (-828.683) (-827.881) (-825.436) [-826.999] -- 0:00:34
      518500 -- (-828.502) (-825.352) (-825.215) [-826.277] * (-824.811) [-829.981] (-829.275) (-825.618) -- 0:00:34
      519000 -- (-828.500) (-825.837) [-825.026] (-825.142) * (-826.157) (-825.340) (-825.567) [-827.781] -- 0:00:34
      519500 -- [-827.707] (-824.305) (-827.922) (-827.586) * [-825.250] (-828.357) (-827.576) (-828.277) -- 0:00:34
      520000 -- (-830.478) (-825.410) [-828.223] (-833.880) * [-825.996] (-825.929) (-826.023) (-825.990) -- 0:00:34

      Average standard deviation of split frequencies: 0.008148

      520500 -- (-829.164) [-826.191] (-829.788) (-826.583) * [-825.159] (-824.887) (-826.197) (-827.556) -- 0:00:35
      521000 -- (-828.379) (-826.302) (-825.903) [-825.374] * (-826.207) (-826.593) (-830.819) [-825.411] -- 0:00:34
      521500 -- (-829.566) (-827.852) (-825.731) [-825.558] * (-831.203) (-829.689) [-825.038] (-827.794) -- 0:00:34
      522000 -- (-826.822) (-829.718) (-828.396) [-826.281] * (-826.481) (-829.409) (-826.627) [-824.694] -- 0:00:34
      522500 -- (-824.526) [-824.969] (-825.400) (-825.023) * [-826.540] (-828.397) (-825.937) (-825.793) -- 0:00:34
      523000 -- [-824.192] (-825.682) (-825.010) (-824.728) * (-825.355) (-827.377) (-824.504) [-826.933] -- 0:00:34
      523500 -- [-826.369] (-827.656) (-826.242) (-827.198) * (-834.477) [-826.343] (-824.358) (-827.608) -- 0:00:34
      524000 -- [-825.623] (-826.400) (-828.221) (-832.346) * (-827.436) (-828.142) (-824.238) [-824.903] -- 0:00:34
      524500 -- (-825.412) (-827.068) [-824.118] (-826.888) * [-823.771] (-830.595) (-826.023) (-826.294) -- 0:00:34
      525000 -- [-824.876] (-827.720) (-824.726) (-827.767) * (-824.244) [-825.401] (-825.034) (-829.852) -- 0:00:34

      Average standard deviation of split frequencies: 0.008382

      525500 -- [-827.675] (-826.180) (-825.133) (-828.572) * (-825.392) (-825.370) [-825.332] (-826.081) -- 0:00:34
      526000 -- [-828.068] (-829.435) (-826.590) (-824.120) * (-827.154) (-828.648) (-823.863) [-825.183] -- 0:00:34
      526500 -- (-829.893) (-824.865) (-827.036) [-827.149] * (-829.601) (-826.712) [-824.938] (-828.565) -- 0:00:34
      527000 -- (-831.703) (-827.303) (-827.908) [-825.317] * (-825.156) (-827.849) (-827.791) [-829.563] -- 0:00:34
      527500 -- (-827.354) (-830.337) [-826.952] (-826.147) * (-827.576) (-828.160) [-826.304] (-828.799) -- 0:00:34
      528000 -- (-829.140) (-827.149) (-828.846) [-829.251] * (-828.053) (-825.884) [-825.645] (-826.212) -- 0:00:33
      528500 -- (-825.344) (-826.017) [-826.492] (-832.622) * (-825.115) (-827.162) [-827.157] (-826.914) -- 0:00:33
      529000 -- (-828.926) (-827.403) (-831.383) [-827.290] * (-824.676) [-824.996] (-830.458) (-825.611) -- 0:00:33
      529500 -- (-825.253) (-825.295) [-829.491] (-827.418) * (-826.469) (-825.838) (-828.560) [-826.563] -- 0:00:33
      530000 -- [-824.651] (-824.260) (-829.130) (-826.658) * (-826.338) [-825.932] (-827.094) (-824.717) -- 0:00:33

      Average standard deviation of split frequencies: 0.007995

      530500 -- [-825.735] (-826.159) (-829.025) (-825.567) * [-824.444] (-827.530) (-824.876) (-825.151) -- 0:00:33
      531000 -- [-826.904] (-827.319) (-826.552) (-826.388) * (-824.391) (-829.582) (-826.446) [-824.202] -- 0:00:33
      531500 -- (-824.699) [-825.045] (-828.188) (-825.548) * [-824.818] (-825.604) (-830.253) (-825.008) -- 0:00:33
      532000 -- (-827.983) (-829.451) [-825.240] (-828.910) * [-825.552] (-828.140) (-825.381) (-828.530) -- 0:00:33
      532500 -- (-826.506) [-824.548] (-827.572) (-826.215) * (-826.232) (-826.811) (-827.368) [-825.506] -- 0:00:33
      533000 -- [-826.415] (-824.825) (-827.748) (-828.817) * (-824.000) (-829.253) (-824.367) [-826.354] -- 0:00:33
      533500 -- (-824.573) (-829.051) (-825.342) [-824.173] * (-827.645) (-825.182) [-825.603] (-826.679) -- 0:00:33
      534000 -- (-825.065) (-825.155) (-826.940) [-824.911] * (-826.041) (-827.483) [-824.846] (-827.418) -- 0:00:33
      534500 -- (-825.423) [-825.521] (-828.514) (-824.723) * (-825.671) (-826.201) [-827.161] (-825.699) -- 0:00:33
      535000 -- (-825.906) [-825.610] (-828.082) (-826.571) * (-824.033) [-826.552] (-827.969) (-825.965) -- 0:00:33

      Average standard deviation of split frequencies: 0.008080

      535500 -- (-826.265) (-825.542) (-825.715) [-825.626] * (-824.777) (-825.921) (-825.649) [-826.638] -- 0:00:33
      536000 -- (-825.499) (-828.874) [-827.902] (-831.797) * [-825.101] (-824.446) (-826.400) (-825.865) -- 0:00:33
      536500 -- (-824.530) (-825.605) (-828.234) [-825.480] * (-826.071) [-825.867] (-825.998) (-825.794) -- 0:00:33
      537000 -- (-826.164) (-825.493) (-824.941) [-825.337] * (-829.494) (-829.543) (-825.566) [-826.260] -- 0:00:33
      537500 -- (-828.969) (-826.584) (-828.382) [-827.968] * (-828.725) (-828.284) [-828.012] (-835.525) -- 0:00:33
      538000 -- (-824.462) [-828.094] (-824.259) (-826.149) * (-827.486) (-828.399) [-826.741] (-825.408) -- 0:00:33
      538500 -- [-824.585] (-827.572) (-824.226) (-825.956) * (-826.357) (-828.000) [-825.115] (-825.011) -- 0:00:33
      539000 -- (-826.862) [-825.162] (-825.143) (-825.096) * [-826.249] (-825.727) (-824.636) (-823.945) -- 0:00:33
      539500 -- (-825.099) (-825.382) [-825.875] (-825.143) * (-824.467) [-826.512] (-827.573) (-824.781) -- 0:00:33
      540000 -- [-827.001] (-825.896) (-827.647) (-825.071) * (-827.027) (-825.175) [-824.615] (-827.502) -- 0:00:33

      Average standard deviation of split frequencies: 0.006917

      540500 -- (-827.869) (-825.058) (-828.156) [-825.512] * (-827.210) (-824.682) [-826.983] (-826.674) -- 0:00:33
      541000 -- (-825.074) (-825.355) (-824.416) [-824.577] * (-825.028) [-824.171] (-829.118) (-826.225) -- 0:00:33
      541500 -- [-827.113] (-829.041) (-824.636) (-825.615) * [-825.527] (-824.811) (-831.337) (-828.231) -- 0:00:33
      542000 -- [-828.472] (-825.957) (-827.130) (-825.447) * (-826.524) (-828.572) (-826.486) [-825.760] -- 0:00:32
      542500 -- [-825.902] (-826.490) (-825.883) (-824.952) * [-826.743] (-824.772) (-823.972) (-829.325) -- 0:00:32
      543000 -- (-827.100) [-828.025] (-828.626) (-824.593) * (-825.766) (-827.064) [-823.996] (-826.942) -- 0:00:32
      543500 -- (-830.597) (-831.531) [-826.748] (-826.831) * (-824.588) [-828.036] (-825.985) (-829.743) -- 0:00:32
      544000 -- (-825.595) (-828.508) [-827.190] (-824.425) * [-825.209] (-827.099) (-826.256) (-831.718) -- 0:00:32
      544500 -- (-825.225) [-826.212] (-831.931) (-824.475) * (-825.589) (-826.001) [-828.188] (-827.353) -- 0:00:32
      545000 -- (-824.042) (-830.653) (-830.174) [-824.313] * [-824.821] (-827.595) (-826.003) (-825.914) -- 0:00:32

      Average standard deviation of split frequencies: 0.007662

      545500 -- (-824.663) (-827.638) (-824.354) [-824.041] * (-824.863) [-824.472] (-824.914) (-827.671) -- 0:00:32
      546000 -- (-825.421) (-827.018) [-823.758] (-825.107) * [-824.553] (-824.692) (-825.860) (-827.701) -- 0:00:32
      546500 -- (-826.740) (-827.607) [-825.340] (-828.033) * (-829.224) [-826.804] (-825.505) (-828.260) -- 0:00:32
      547000 -- (-828.986) (-827.260) [-825.930] (-828.233) * (-828.742) (-825.720) (-824.009) [-828.459] -- 0:00:32
      547500 -- [-829.140] (-828.015) (-827.706) (-825.936) * (-826.455) [-827.018] (-826.351) (-828.633) -- 0:00:32
      548000 -- (-827.993) [-826.500] (-826.007) (-828.810) * [-827.751] (-827.396) (-827.427) (-827.653) -- 0:00:32
      548500 -- [-827.210] (-827.928) (-825.897) (-827.532) * (-825.813) [-825.310] (-825.277) (-825.051) -- 0:00:32
      549000 -- (-824.403) (-826.020) (-825.248) [-825.832] * [-828.058] (-825.828) (-825.138) (-827.494) -- 0:00:32
      549500 -- (-825.158) (-832.554) (-828.196) [-826.849] * [-827.989] (-825.816) (-824.178) (-826.974) -- 0:00:32
      550000 -- (-824.710) (-834.439) (-825.190) [-824.743] * [-825.275] (-825.710) (-826.731) (-826.484) -- 0:00:32

      Average standard deviation of split frequencies: 0.007819

      550500 -- (-826.427) (-829.717) (-827.029) [-825.125] * (-824.358) (-824.727) (-827.667) [-828.666] -- 0:00:32
      551000 -- (-827.330) [-828.239] (-828.298) (-825.424) * [-824.642] (-826.347) (-828.201) (-824.662) -- 0:00:32
      551500 -- (-825.542) (-827.591) (-825.283) [-827.405] * (-825.759) [-824.451] (-827.502) (-824.488) -- 0:00:32
      552000 -- (-826.216) (-829.529) (-825.320) [-825.500] * (-825.272) [-826.342] (-824.356) (-824.774) -- 0:00:32
      552500 -- (-825.283) (-826.907) [-824.749] (-824.796) * (-826.012) [-825.071] (-825.628) (-826.139) -- 0:00:32
      553000 -- (-825.164) (-830.240) [-830.294] (-824.969) * (-825.645) [-825.305] (-826.178) (-825.119) -- 0:00:32
      553500 -- (-826.318) (-829.025) [-824.596] (-826.956) * (-824.041) (-825.021) (-826.548) [-827.283] -- 0:00:32
      554000 -- [-825.363] (-825.084) (-824.607) (-828.959) * [-827.552] (-824.365) (-825.930) (-827.827) -- 0:00:32
      554500 -- [-831.424] (-825.550) (-828.227) (-829.594) * (-824.503) [-825.075] (-827.969) (-827.855) -- 0:00:32
      555000 -- (-828.862) (-827.531) [-827.143] (-826.765) * (-824.801) (-827.454) (-829.114) [-826.372] -- 0:00:32

      Average standard deviation of split frequencies: 0.007744

      555500 -- (-830.473) (-824.035) [-826.154] (-826.810) * (-825.228) [-825.581] (-828.442) (-824.410) -- 0:00:32
      556000 -- (-831.377) (-827.171) [-826.180] (-826.754) * (-825.573) (-827.161) [-825.349] (-825.668) -- 0:00:31
      556500 -- (-826.173) (-826.880) [-827.796] (-826.489) * (-826.023) [-824.089] (-826.044) (-826.377) -- 0:00:31
      557000 -- (-829.303) (-824.872) [-826.684] (-825.597) * (-824.519) [-825.672] (-825.737) (-825.389) -- 0:00:31
      557500 -- [-826.744] (-824.729) (-827.516) (-827.907) * (-825.626) [-827.179] (-827.287) (-826.700) -- 0:00:31
      558000 -- (-826.314) [-824.948] (-824.833) (-826.865) * (-826.550) [-826.448] (-829.554) (-826.673) -- 0:00:31
      558500 -- (-827.270) (-831.834) (-824.526) [-824.939] * (-824.771) (-831.784) [-825.444] (-825.762) -- 0:00:31
      559000 -- [-828.585] (-833.110) (-829.200) (-828.906) * (-825.519) (-828.959) (-825.616) [-826.973] -- 0:00:31
      559500 -- (-826.335) (-830.382) [-825.197] (-824.891) * (-826.817) (-825.742) [-824.590] (-828.336) -- 0:00:31
      560000 -- [-825.291] (-826.465) (-828.091) (-827.105) * (-824.937) (-827.587) [-826.430] (-825.833) -- 0:00:31

      Average standard deviation of split frequencies: 0.008352

      560500 -- (-828.319) [-827.024] (-827.452) (-828.342) * (-825.083) [-827.091] (-831.381) (-825.019) -- 0:00:31
      561000 -- [-825.312] (-826.285) (-824.641) (-824.648) * [-826.897] (-827.207) (-826.539) (-827.207) -- 0:00:31
      561500 -- (-828.233) (-828.717) (-824.687) [-827.567] * (-827.997) [-825.076] (-827.107) (-825.231) -- 0:00:31
      562000 -- (-824.037) (-826.421) [-826.057] (-826.279) * (-824.222) (-825.365) (-825.760) [-824.753] -- 0:00:31
      562500 -- (-827.090) (-826.351) [-831.325] (-825.730) * (-825.420) (-830.187) [-824.545] (-824.933) -- 0:00:31
      563000 -- (-825.273) (-826.017) [-829.918] (-826.677) * [-828.289] (-832.290) (-825.096) (-826.552) -- 0:00:31
      563500 -- [-826.086] (-824.879) (-829.078) (-829.175) * [-832.023] (-828.168) (-824.722) (-827.122) -- 0:00:31
      564000 -- (-829.295) (-824.060) (-826.370) [-825.222] * (-825.602) (-828.008) (-825.331) [-827.443] -- 0:00:31
      564500 -- (-825.083) (-826.763) (-825.365) [-825.406] * (-824.935) (-829.313) (-825.920) [-824.222] -- 0:00:31
      565000 -- [-825.633] (-827.743) (-828.200) (-825.127) * (-826.417) (-831.524) (-828.245) [-824.199] -- 0:00:31

      Average standard deviation of split frequencies: 0.008551

      565500 -- (-825.047) [-826.009] (-829.630) (-825.097) * (-827.651) (-831.895) (-828.530) [-824.138] -- 0:00:31
      566000 -- (-827.041) (-825.921) (-830.966) [-826.162] * (-827.753) (-827.020) [-825.727] (-824.914) -- 0:00:31
      566500 -- (-827.026) (-826.421) [-826.205] (-824.967) * [-827.009] (-824.648) (-824.507) (-826.245) -- 0:00:31
      567000 -- (-829.787) [-823.931] (-828.212) (-828.331) * [-826.478] (-823.970) (-827.866) (-826.516) -- 0:00:31
      567500 -- [-824.307] (-824.174) (-825.754) (-828.981) * [-826.455] (-825.537) (-827.563) (-831.107) -- 0:00:31
      568000 -- (-828.736) [-827.759] (-828.455) (-827.592) * (-825.977) (-825.380) [-828.619] (-825.176) -- 0:00:31
      568500 -- [-828.355] (-826.293) (-828.622) (-827.829) * [-826.720] (-829.144) (-825.408) (-824.914) -- 0:00:31
      569000 -- [-827.595] (-825.635) (-827.008) (-828.333) * (-825.927) [-824.228] (-827.554) (-825.442) -- 0:00:31
      569500 -- (-824.455) (-826.561) (-825.899) [-828.407] * [-825.392] (-825.132) (-827.034) (-826.519) -- 0:00:30
      570000 -- (-828.696) (-829.910) (-825.576) [-828.632] * (-826.580) [-825.287] (-824.402) (-825.268) -- 0:00:30

      Average standard deviation of split frequencies: 0.007951

      570500 -- (-825.369) [-826.207] (-826.101) (-826.804) * (-827.102) (-833.316) (-824.505) [-825.995] -- 0:00:30
      571000 -- [-825.545] (-827.287) (-826.058) (-827.358) * [-825.983] (-827.149) (-825.398) (-825.050) -- 0:00:30
      571500 -- (-826.976) (-824.919) [-824.968] (-827.122) * (-826.892) (-826.276) (-827.831) [-825.051] -- 0:00:30
      572000 -- (-824.360) (-825.275) [-829.138] (-825.715) * (-827.954) [-825.482] (-827.005) (-825.434) -- 0:00:30
      572500 -- (-825.757) [-830.345] (-825.036) (-827.045) * (-825.970) (-824.049) (-824.436) [-825.628] -- 0:00:30
      573000 -- [-824.284] (-825.246) (-824.395) (-826.145) * (-826.859) (-825.222) (-824.330) [-828.590] -- 0:00:30
      573500 -- [-824.702] (-827.547) (-826.355) (-825.358) * (-826.210) (-828.761) [-831.534] (-826.637) -- 0:00:30
      574000 -- (-824.471) [-825.421] (-827.147) (-825.317) * (-826.411) (-827.659) (-825.535) [-828.273] -- 0:00:30
      574500 -- (-826.536) (-825.092) (-828.161) [-825.395] * (-826.020) (-824.868) (-826.345) [-826.048] -- 0:00:30
      575000 -- (-826.087) (-826.770) [-826.010] (-825.367) * (-831.440) (-824.019) [-824.670] (-829.606) -- 0:00:30

      Average standard deviation of split frequencies: 0.008184

      575500 -- [-825.337] (-826.832) (-826.643) (-828.172) * (-827.645) (-824.620) (-825.161) [-825.404] -- 0:00:30
      576000 -- (-826.186) [-825.196] (-825.458) (-828.013) * [-825.332] (-826.688) (-824.569) (-832.273) -- 0:00:30
      576500 -- (-825.894) (-827.640) (-826.309) [-828.865] * (-826.326) (-826.969) (-827.929) [-828.077] -- 0:00:30
      577000 -- [-828.694] (-827.250) (-826.762) (-831.033) * [-824.548] (-824.874) (-826.841) (-828.727) -- 0:00:30
      577500 -- [-825.708] (-826.952) (-824.575) (-826.822) * [-824.977] (-826.065) (-827.755) (-830.618) -- 0:00:30
      578000 -- (-825.178) (-825.368) (-826.679) [-829.465] * (-825.064) [-826.078] (-826.252) (-830.860) -- 0:00:30
      578500 -- (-830.287) (-826.177) [-827.393] (-827.203) * (-827.943) (-827.948) (-825.478) [-828.419] -- 0:00:30
      579000 -- (-825.729) (-825.182) (-826.842) [-824.640] * [-825.671] (-824.919) (-824.995) (-827.126) -- 0:00:30
      579500 -- (-827.737) (-825.898) (-830.952) [-826.785] * [-826.212] (-827.635) (-825.780) (-827.260) -- 0:00:30
      580000 -- (-828.533) (-827.119) (-829.747) [-824.718] * (-828.309) (-825.375) (-826.618) [-827.279] -- 0:00:30

      Average standard deviation of split frequencies: 0.008443

      580500 -- (-824.633) (-825.217) (-830.624) [-825.301] * [-825.423] (-825.407) (-827.461) (-826.200) -- 0:00:30
      581000 -- (-824.208) [-828.784] (-825.705) (-826.584) * (-826.099) (-826.594) (-827.575) [-824.274] -- 0:00:30
      581500 -- [-824.909] (-825.164) (-828.142) (-832.578) * (-828.911) [-824.762] (-830.739) (-823.814) -- 0:00:30
      582000 -- (-826.027) (-824.579) (-824.650) [-826.993] * (-827.428) (-824.563) (-827.554) [-826.066] -- 0:00:30
      582500 -- [-827.182] (-824.784) (-826.759) (-825.117) * (-824.295) (-826.089) [-825.755] (-824.470) -- 0:00:30
      583000 -- (-831.411) (-827.770) (-828.598) [-826.413] * (-825.623) [-827.603] (-828.073) (-828.129) -- 0:00:30
      583500 -- (-828.643) (-826.824) [-824.564] (-824.984) * (-830.700) (-827.767) [-827.405] (-825.533) -- 0:00:29
      584000 -- (-826.376) (-828.958) [-827.660] (-828.181) * [-827.093] (-830.446) (-827.707) (-824.587) -- 0:00:29
      584500 -- (-827.419) (-826.805) [-825.701] (-825.197) * [-827.518] (-824.996) (-825.785) (-828.025) -- 0:00:29
      585000 -- (-832.725) (-828.909) [-824.408] (-825.227) * (-825.633) (-829.130) (-824.636) [-825.297] -- 0:00:29

      Average standard deviation of split frequencies: 0.007994

      585500 -- [-824.029] (-826.692) (-824.302) (-829.098) * [-826.913] (-834.707) (-826.350) (-826.950) -- 0:00:29
      586000 -- [-825.314] (-826.189) (-824.120) (-826.298) * [-827.146] (-829.277) (-824.888) (-826.295) -- 0:00:29
      586500 -- (-826.048) [-825.518] (-824.325) (-834.183) * (-833.360) (-828.867) (-826.375) [-824.404] -- 0:00:29
      587000 -- (-827.227) [-825.469] (-826.924) (-829.076) * (-838.074) (-824.275) (-825.867) [-828.502] -- 0:00:29
      587500 -- (-826.098) [-824.393] (-827.650) (-828.210) * (-828.700) [-828.024] (-826.133) (-824.755) -- 0:00:29
      588000 -- (-824.981) (-829.975) [-827.043] (-825.139) * [-824.443] (-827.233) (-827.266) (-824.561) -- 0:00:29
      588500 -- (-824.533) [-827.716] (-825.554) (-824.771) * [-824.968] (-827.504) (-827.678) (-825.329) -- 0:00:29
      589000 -- (-824.397) (-826.217) (-827.395) [-824.698] * (-826.718) (-825.017) (-825.714) [-828.527] -- 0:00:29
      589500 -- (-829.301) [-826.503] (-825.318) (-829.656) * (-827.006) [-827.584] (-827.648) (-825.410) -- 0:00:29
      590000 -- [-824.917] (-829.627) (-824.327) (-833.794) * [-830.410] (-825.617) (-827.828) (-825.106) -- 0:00:29

      Average standard deviation of split frequencies: 0.008081

      590500 -- (-825.601) [-824.464] (-824.300) (-825.446) * (-827.823) [-826.196] (-826.635) (-824.620) -- 0:00:29
      591000 -- [-824.511] (-826.671) (-826.400) (-831.276) * (-828.575) (-823.806) [-825.309] (-824.206) -- 0:00:29
      591500 -- (-825.954) [-825.450] (-826.952) (-833.032) * (-829.224) (-824.795) (-826.223) [-824.466] -- 0:00:29
      592000 -- (-828.072) (-824.677) (-826.832) [-828.228] * [-825.879] (-825.319) (-826.545) (-826.279) -- 0:00:29
      592500 -- [-825.358] (-824.403) (-827.845) (-825.427) * (-826.017) (-827.097) [-826.888] (-825.423) -- 0:00:29
      593000 -- [-825.699] (-826.377) (-828.603) (-827.281) * (-827.194) (-825.421) [-825.633] (-823.968) -- 0:00:29
      593500 -- (-831.182) [-826.267] (-827.483) (-828.195) * [-826.422] (-824.398) (-827.421) (-826.996) -- 0:00:29
      594000 -- [-825.474] (-825.843) (-827.877) (-824.992) * (-828.691) [-824.634] (-827.915) (-824.502) -- 0:00:29
      594500 -- [-826.568] (-825.181) (-824.781) (-825.418) * (-826.645) (-825.284) [-824.273] (-825.516) -- 0:00:29
      595000 -- (-829.041) [-827.189] (-827.064) (-824.544) * (-825.115) (-827.314) (-825.999) [-824.795] -- 0:00:29

      Average standard deviation of split frequencies: 0.008384

      595500 -- (-830.751) (-825.491) (-828.145) [-826.450] * (-825.446) [-825.882] (-826.595) (-825.569) -- 0:00:29
      596000 -- (-827.015) (-827.191) [-826.331] (-825.892) * [-824.741] (-827.789) (-826.202) (-826.563) -- 0:00:29
      596500 -- (-827.412) [-826.291] (-826.396) (-825.783) * (-824.212) (-831.078) (-827.030) [-825.108] -- 0:00:29
      597000 -- (-825.572) (-826.327) [-826.776] (-827.893) * (-824.011) (-829.648) (-826.811) [-825.767] -- 0:00:29
      597500 -- [-824.832] (-832.325) (-825.452) (-827.088) * (-825.187) (-827.739) [-825.630] (-830.213) -- 0:00:28
      598000 -- (-824.699) [-826.227] (-826.949) (-828.363) * [-826.611] (-825.480) (-829.246) (-827.226) -- 0:00:28
      598500 -- (-827.381) [-826.927] (-825.310) (-825.185) * (-827.365) [-826.545] (-825.702) (-825.120) -- 0:00:28
      599000 -- [-827.021] (-828.492) (-826.614) (-825.258) * (-831.280) (-825.184) [-826.790] (-825.805) -- 0:00:28
      599500 -- [-827.537] (-825.520) (-825.447) (-829.139) * (-826.742) (-825.407) (-827.452) [-826.790] -- 0:00:28
      600000 -- (-826.765) (-824.622) [-826.078] (-825.093) * (-826.803) (-827.677) (-829.423) [-829.198] -- 0:00:28

      Average standard deviation of split frequencies: 0.009156

      600500 -- [-823.777] (-825.431) (-825.429) (-825.137) * (-827.254) (-828.629) [-825.935] (-829.745) -- 0:00:28
      601000 -- (-828.883) (-826.292) (-824.613) [-826.339] * (-828.229) (-828.456) (-831.250) [-826.561] -- 0:00:28
      601500 -- (-827.523) (-825.587) [-826.366] (-825.005) * (-823.983) (-825.458) (-832.970) [-824.843] -- 0:00:28
      602000 -- (-826.734) (-825.328) [-825.900] (-828.250) * (-825.205) (-825.923) (-827.873) [-826.446] -- 0:00:28
      602500 -- (-827.375) [-825.204] (-825.356) (-825.845) * (-829.174) [-824.164] (-827.820) (-824.500) -- 0:00:28
      603000 -- (-825.873) [-824.846] (-825.436) (-824.983) * (-828.315) [-826.676] (-831.861) (-826.685) -- 0:00:28
      603500 -- (-825.690) [-824.898] (-826.026) (-826.736) * (-828.138) (-826.207) (-825.210) [-826.225] -- 0:00:28
      604000 -- [-826.369] (-824.217) (-825.025) (-824.660) * (-828.746) (-827.650) (-826.430) [-825.451] -- 0:00:28
      604500 -- [-825.362] (-825.120) (-824.552) (-825.733) * [-828.493] (-829.352) (-827.214) (-825.674) -- 0:00:28
      605000 -- (-827.703) (-824.658) (-825.607) [-826.900] * (-825.152) [-828.875] (-825.299) (-827.873) -- 0:00:28

      Average standard deviation of split frequencies: 0.008609

      605500 -- (-825.311) [-825.186] (-827.311) (-828.933) * (-830.231) (-826.177) [-826.567] (-826.287) -- 0:00:28
      606000 -- [-831.269] (-823.969) (-824.714) (-826.732) * [-825.256] (-824.788) (-825.762) (-826.997) -- 0:00:28
      606500 -- (-824.300) (-824.681) (-825.343) [-824.619] * [-827.919] (-825.830) (-825.193) (-828.964) -- 0:00:28
      607000 -- (-826.194) (-824.499) (-826.287) [-824.708] * (-829.637) (-831.194) [-824.659] (-825.842) -- 0:00:28
      607500 -- (-825.122) (-829.655) (-829.136) [-824.185] * (-825.953) (-826.041) [-825.127] (-828.659) -- 0:00:28
      608000 -- (-824.304) [-825.294] (-826.972) (-827.234) * (-827.296) (-826.352) [-826.192] (-824.558) -- 0:00:28
      608500 -- (-824.573) (-829.026) (-828.021) [-824.724] * (-825.651) [-824.707] (-827.577) (-825.448) -- 0:00:28
      609000 -- (-826.305) (-827.645) [-827.737] (-825.247) * (-825.684) [-824.605] (-827.912) (-827.551) -- 0:00:28
      609500 -- [-825.283] (-826.940) (-827.635) (-826.928) * [-826.400] (-824.898) (-826.492) (-827.292) -- 0:00:28
      610000 -- (-824.997) (-825.550) [-827.111] (-825.584) * (-828.797) [-828.370] (-826.374) (-824.509) -- 0:00:28

      Average standard deviation of split frequencies: 0.008594

      610500 -- (-824.559) (-827.630) [-825.044] (-824.603) * (-830.077) (-826.338) [-823.816] (-824.806) -- 0:00:28
      611000 -- [-824.834] (-826.726) (-825.231) (-830.580) * (-826.165) (-824.847) (-826.443) [-828.123] -- 0:00:28
      611500 -- (-824.933) (-827.224) [-824.130] (-829.355) * (-825.363) (-825.428) (-825.608) [-826.085] -- 0:00:27
      612000 -- (-825.540) (-824.823) [-827.093] (-827.716) * (-825.242) [-825.542] (-825.710) (-826.368) -- 0:00:27
      612500 -- (-824.798) (-824.762) (-824.463) [-824.123] * [-826.458] (-828.906) (-825.259) (-825.095) -- 0:00:27
      613000 -- (-825.488) (-825.034) [-826.119] (-824.351) * [-826.210] (-829.562) (-826.995) (-824.140) -- 0:00:27
      613500 -- (-826.552) (-826.368) (-828.660) [-824.422] * (-825.751) [-830.560] (-824.341) (-824.192) -- 0:00:27
      614000 -- (-826.125) (-827.068) [-825.639] (-825.416) * [-824.558] (-824.004) (-824.332) (-825.718) -- 0:00:27
      614500 -- (-826.829) [-825.516] (-826.236) (-825.986) * (-825.648) [-826.521] (-827.845) (-826.927) -- 0:00:27
      615000 -- (-827.680) [-828.109] (-826.010) (-831.185) * (-823.853) (-827.909) (-827.739) [-827.027] -- 0:00:27

      Average standard deviation of split frequencies: 0.008418

      615500 -- (-826.522) (-825.291) [-825.234] (-826.369) * (-828.535) [-826.448] (-824.842) (-828.150) -- 0:00:27
      616000 -- (-825.274) [-824.674] (-826.372) (-827.289) * (-825.636) (-825.781) [-826.050] (-827.358) -- 0:00:27
      616500 -- (-825.397) (-826.909) (-826.965) [-825.134] * (-824.782) [-826.724] (-825.026) (-826.267) -- 0:00:27
      617000 -- (-827.792) (-832.815) [-826.277] (-828.530) * (-825.555) (-825.012) (-833.752) [-827.347] -- 0:00:27
      617500 -- (-828.075) (-829.001) [-824.619] (-826.331) * (-827.139) (-826.241) (-827.241) [-826.318] -- 0:00:27
      618000 -- (-832.446) (-827.799) [-825.134] (-826.657) * [-828.268] (-824.695) (-827.300) (-826.853) -- 0:00:27
      618500 -- [-827.951] (-826.186) (-825.693) (-830.006) * (-828.582) [-824.633] (-824.852) (-824.356) -- 0:00:27
      619000 -- [-825.052] (-828.926) (-825.025) (-825.026) * [-825.696] (-825.420) (-828.491) (-826.351) -- 0:00:27
      619500 -- (-826.119) (-830.245) (-826.128) [-825.579] * [-830.947] (-826.353) (-830.789) (-826.226) -- 0:00:27
      620000 -- (-824.412) (-829.272) [-824.491] (-829.509) * (-825.888) (-824.196) [-825.997] (-828.395) -- 0:00:27

      Average standard deviation of split frequencies: 0.009013

      620500 -- (-825.761) [-826.773] (-826.196) (-830.652) * [-824.811] (-826.960) (-825.477) (-829.050) -- 0:00:27
      621000 -- [-825.018] (-829.310) (-827.704) (-826.108) * (-824.687) [-826.280] (-826.964) (-826.364) -- 0:00:27
      621500 -- (-823.893) (-825.141) [-825.123] (-825.289) * (-824.201) [-825.317] (-824.865) (-829.865) -- 0:00:27
      622000 -- (-824.447) (-826.824) (-825.403) [-826.206] * (-824.000) [-828.021] (-825.407) (-825.591) -- 0:00:27
      622500 -- (-824.098) [-828.455] (-825.228) (-828.031) * (-824.585) (-826.139) [-825.115] (-826.448) -- 0:00:27
      623000 -- (-825.454) (-829.784) [-828.619] (-826.831) * [-824.757] (-826.050) (-825.013) (-831.494) -- 0:00:27
      623500 -- (-825.257) (-825.327) [-826.073] (-826.766) * (-825.814) (-825.167) (-826.056) [-829.907] -- 0:00:27
      624000 -- (-830.492) [-825.471] (-827.304) (-824.410) * [-825.143] (-826.714) (-827.268) (-827.035) -- 0:00:27
      624500 -- (-826.829) [-825.682] (-825.767) (-825.515) * (-825.651) (-827.591) [-828.925] (-827.878) -- 0:00:27
      625000 -- (-828.711) [-824.305] (-826.242) (-824.778) * (-825.927) [-825.944] (-831.221) (-827.502) -- 0:00:27

      Average standard deviation of split frequencies: 0.009087

      625500 -- [-826.912] (-824.966) (-825.392) (-825.559) * (-828.162) (-828.196) [-828.468] (-825.020) -- 0:00:26
      626000 -- (-826.967) [-824.648] (-825.096) (-826.035) * (-826.394) [-824.113] (-826.884) (-825.297) -- 0:00:26
      626500 -- (-829.041) (-825.288) (-827.739) [-825.054] * (-827.315) [-824.011] (-825.777) (-826.436) -- 0:00:26
      627000 -- [-826.933] (-824.300) (-828.426) (-829.392) * (-825.525) (-825.254) [-824.325] (-829.487) -- 0:00:26
      627500 -- (-829.490) [-823.996] (-826.016) (-825.517) * (-825.557) [-826.154] (-824.398) (-825.843) -- 0:00:26
      628000 -- (-825.073) (-824.533) (-830.320) [-825.786] * (-825.687) (-824.665) (-825.031) [-826.006] -- 0:00:26
      628500 -- (-824.772) (-827.991) [-826.243] (-827.963) * (-824.387) (-826.876) (-824.885) [-826.639] -- 0:00:26
      629000 -- (-826.297) (-827.831) [-826.086] (-824.369) * (-825.151) (-827.668) [-824.275] (-828.069) -- 0:00:26
      629500 -- (-830.043) (-826.053) (-825.655) [-827.006] * (-824.670) (-827.328) [-824.226] (-827.668) -- 0:00:26
      630000 -- [-828.816] (-827.885) (-824.672) (-827.984) * [-827.263] (-827.295) (-824.745) (-826.045) -- 0:00:26

      Average standard deviation of split frequencies: 0.009069

      630500 -- [-826.027] (-826.830) (-830.218) (-830.251) * (-826.309) [-826.071] (-826.463) (-825.816) -- 0:00:26
      631000 -- (-827.460) (-827.232) [-825.508] (-829.961) * (-826.467) [-825.561] (-824.495) (-825.275) -- 0:00:26
      631500 -- (-825.997) (-825.986) (-825.955) [-826.357] * [-825.419] (-826.756) (-825.070) (-830.891) -- 0:00:26
      632000 -- [-824.447] (-826.600) (-829.185) (-825.321) * (-829.991) (-828.157) [-825.299] (-826.269) -- 0:00:26
      632500 -- (-827.708) (-825.502) (-829.913) [-824.866] * (-826.317) (-826.178) [-825.597] (-825.568) -- 0:00:26
      633000 -- (-829.282) (-824.332) [-826.514] (-824.904) * [-825.399] (-824.621) (-825.113) (-825.792) -- 0:00:26
      633500 -- (-827.870) [-824.836] (-824.614) (-824.706) * [-826.130] (-824.247) (-824.127) (-824.837) -- 0:00:26
      634000 -- (-828.306) [-824.901] (-825.174) (-825.709) * [-826.906] (-824.391) (-824.428) (-825.895) -- 0:00:26
      634500 -- (-825.839) (-825.856) [-829.312] (-826.501) * [-826.489] (-824.088) (-825.020) (-824.335) -- 0:00:26
      635000 -- (-837.991) (-825.354) (-828.396) [-827.059] * (-826.552) [-828.174] (-828.411) (-827.599) -- 0:00:26

      Average standard deviation of split frequencies: 0.009685

      635500 -- (-826.512) (-826.246) (-826.894) [-826.126] * (-824.813) (-825.000) [-825.553] (-825.891) -- 0:00:26
      636000 -- (-829.068) (-828.873) (-831.844) [-825.459] * (-824.916) (-824.866) [-825.082] (-824.626) -- 0:00:26
      636500 -- (-825.739) [-826.788] (-824.920) (-825.224) * (-827.490) (-827.321) [-827.166] (-828.396) -- 0:00:26
      637000 -- (-827.991) (-826.902) (-824.922) [-826.809] * (-826.905) (-826.468) [-827.104] (-826.318) -- 0:00:26
      637500 -- (-825.466) [-825.931] (-830.645) (-827.837) * (-825.868) (-828.441) (-825.477) [-826.587] -- 0:00:26
      638000 -- [-826.861] (-826.920) (-826.884) (-826.412) * (-827.950) (-826.976) [-824.965] (-825.600) -- 0:00:26
      638500 -- (-829.957) (-828.485) (-826.530) [-824.241] * (-827.699) [-829.057] (-824.512) (-825.899) -- 0:00:26
      639000 -- (-829.527) [-826.613] (-825.804) (-825.094) * (-825.954) [-825.732] (-828.341) (-830.329) -- 0:00:25
      639500 -- (-828.287) (-825.486) [-824.532] (-825.225) * (-825.734) [-824.000] (-832.775) (-826.791) -- 0:00:25
      640000 -- (-825.719) (-827.522) (-824.382) [-829.399] * (-826.945) (-823.982) [-827.534] (-826.745) -- 0:00:25

      Average standard deviation of split frequencies: 0.009841

      640500 -- (-824.932) [-824.898] (-828.130) (-826.331) * (-825.998) [-826.406] (-825.245) (-836.764) -- 0:00:25
      641000 -- [-825.531] (-824.859) (-832.779) (-826.945) * [-824.847] (-829.380) (-826.702) (-827.569) -- 0:00:25
      641500 -- (-827.875) (-825.263) (-828.509) [-826.866] * [-824.901] (-827.046) (-832.638) (-824.327) -- 0:00:25
      642000 -- (-828.092) (-825.429) [-824.660] (-826.098) * (-828.716) (-829.145) (-831.658) [-824.941] -- 0:00:25
      642500 -- (-834.786) [-825.805] (-827.961) (-825.088) * [-828.517] (-826.655) (-825.499) (-827.304) -- 0:00:25
      643000 -- (-825.730) (-826.316) [-827.341] (-825.917) * (-824.872) [-825.951] (-824.933) (-824.889) -- 0:00:25
      643500 -- [-825.298] (-827.549) (-825.367) (-826.021) * [-824.769] (-828.930) (-827.975) (-824.865) -- 0:00:25
      644000 -- (-826.929) (-826.194) (-824.369) [-826.080] * [-826.081] (-827.369) (-824.488) (-825.184) -- 0:00:25
      644500 -- (-825.264) (-826.537) [-825.114] (-826.092) * (-826.627) (-824.883) (-826.558) [-825.050] -- 0:00:25
      645000 -- [-825.534] (-826.259) (-826.708) (-826.700) * (-825.661) (-824.138) [-825.848] (-825.577) -- 0:00:25

      Average standard deviation of split frequencies: 0.009532

      645500 -- [-827.835] (-828.233) (-826.535) (-824.573) * (-825.907) (-826.021) [-827.426] (-823.971) -- 0:00:25
      646000 -- (-825.376) (-828.481) (-827.707) [-825.446] * (-827.756) (-826.711) [-828.531] (-825.721) -- 0:00:25
      646500 -- (-827.122) [-826.319] (-824.607) (-833.381) * (-825.894) [-827.824] (-824.810) (-830.895) -- 0:00:25
      647000 -- (-827.143) (-827.031) (-827.186) [-828.901] * [-825.990] (-827.806) (-827.617) (-827.614) -- 0:00:25
      647500 -- [-828.672] (-830.998) (-824.479) (-831.991) * (-827.111) (-826.137) (-824.116) [-825.018] -- 0:00:25
      648000 -- (-829.428) (-829.526) [-824.656] (-827.509) * [-826.507] (-826.802) (-824.148) (-824.463) -- 0:00:25
      648500 -- [-826.467] (-825.548) (-824.766) (-826.742) * (-827.143) [-825.896] (-828.139) (-826.810) -- 0:00:25
      649000 -- (-826.276) [-827.530] (-825.996) (-828.400) * (-827.110) (-823.984) (-827.450) [-827.768] -- 0:00:25
      649500 -- (-823.884) (-826.607) (-827.216) [-825.624] * (-829.086) (-825.636) [-826.716] (-827.514) -- 0:00:25
      650000 -- [-824.832] (-825.343) (-825.626) (-824.992) * (-825.948) (-826.057) [-825.069] (-826.254) -- 0:00:25

      Average standard deviation of split frequencies: 0.009461

      650500 -- (-824.102) [-825.132] (-828.320) (-825.607) * (-825.917) (-824.832) [-824.641] (-826.179) -- 0:00:25
      651000 -- [-826.999] (-823.856) (-826.643) (-824.842) * (-829.685) (-826.414) [-825.320] (-828.826) -- 0:00:25
      651500 -- [-824.923] (-827.129) (-824.477) (-824.063) * (-826.443) (-825.846) (-826.563) [-826.138] -- 0:00:25
      652000 -- (-825.519) (-826.860) [-830.573] (-829.315) * (-826.275) [-826.212] (-827.503) (-825.466) -- 0:00:25
      652500 -- (-825.425) (-827.594) (-828.452) [-824.319] * [-824.551] (-824.593) (-825.564) (-825.804) -- 0:00:25
      653000 -- (-825.218) (-825.839) (-824.335) [-827.512] * (-825.180) (-828.413) (-827.304) [-826.328] -- 0:00:24
      653500 -- (-827.708) [-825.113] (-826.079) (-827.045) * (-825.028) [-826.101] (-827.564) (-824.091) -- 0:00:24
      654000 -- (-825.773) (-825.541) (-825.897) [-827.182] * (-826.537) (-825.454) [-827.456] (-824.943) -- 0:00:24
      654500 -- [-825.140] (-824.859) (-825.102) (-824.497) * (-826.198) [-826.100] (-824.027) (-824.974) -- 0:00:24
      655000 -- (-826.102) [-825.041] (-824.425) (-826.488) * [-825.462] (-825.212) (-824.651) (-826.510) -- 0:00:24

      Average standard deviation of split frequencies: 0.009131

      655500 -- (-825.114) (-825.950) [-824.845] (-824.419) * [-826.259] (-827.066) (-831.334) (-828.235) -- 0:00:24
      656000 -- (-825.713) [-827.498] (-824.033) (-825.852) * (-825.118) [-825.694] (-827.081) (-825.144) -- 0:00:24
      656500 -- (-826.168) (-827.604) [-824.651] (-829.455) * [-825.273] (-825.619) (-824.740) (-826.167) -- 0:00:24
      657000 -- [-826.543] (-827.477) (-824.651) (-826.657) * [-829.182] (-825.558) (-827.698) (-827.609) -- 0:00:24
      657500 -- (-824.403) (-824.595) (-825.366) [-827.059] * [-826.460] (-826.074) (-826.331) (-827.364) -- 0:00:24
      658000 -- (-825.058) (-824.369) (-825.571) [-824.491] * (-825.859) [-824.447] (-829.804) (-826.068) -- 0:00:24
      658500 -- [-825.839] (-827.911) (-824.477) (-825.955) * (-829.744) [-827.617] (-823.766) (-826.910) -- 0:00:24
      659000 -- [-825.489] (-828.075) (-824.673) (-828.901) * (-828.867) [-826.405] (-826.633) (-825.625) -- 0:00:24
      659500 -- (-826.075) (-828.461) [-829.391] (-827.328) * [-826.265] (-825.377) (-825.066) (-827.279) -- 0:00:24
      660000 -- (-826.785) [-827.973] (-828.243) (-825.775) * (-827.161) [-824.822] (-825.710) (-826.949) -- 0:00:24

      Average standard deviation of split frequencies: 0.008856

      660500 -- [-825.805] (-824.908) (-827.424) (-824.928) * (-825.020) (-826.208) [-825.111] (-824.171) -- 0:00:24
      661000 -- [-825.954] (-827.079) (-828.535) (-823.830) * (-825.428) [-827.069] (-825.059) (-826.440) -- 0:00:24
      661500 -- (-827.709) (-827.342) [-827.512] (-825.378) * (-825.483) [-828.867] (-825.708) (-827.813) -- 0:00:24
      662000 -- [-825.108] (-827.901) (-825.581) (-826.626) * (-824.114) (-833.683) [-824.165] (-825.967) -- 0:00:24
      662500 -- (-827.811) [-828.028] (-829.699) (-826.600) * (-823.988) (-830.482) [-825.744] (-825.418) -- 0:00:24
      663000 -- (-828.068) [-824.545] (-827.412) (-834.596) * (-824.542) (-830.062) (-827.415) [-826.339] -- 0:00:24
      663500 -- [-827.720] (-824.174) (-826.822) (-824.028) * [-825.644] (-825.635) (-827.416) (-828.601) -- 0:00:24
      664000 -- (-824.280) [-830.038] (-824.481) (-830.258) * [-827.156] (-824.348) (-824.207) (-828.400) -- 0:00:24
      664500 -- (-824.263) (-825.508) (-824.424) [-828.736] * (-826.072) [-824.522] (-824.811) (-826.561) -- 0:00:24
      665000 -- (-826.780) (-825.152) (-829.512) [-825.637] * (-826.779) [-825.207] (-826.918) (-829.754) -- 0:00:24

      Average standard deviation of split frequencies: 0.009160

      665500 -- (-825.964) (-829.867) [-824.023] (-830.186) * (-829.220) (-824.955) [-825.225] (-830.286) -- 0:00:24
      666000 -- (-825.057) (-826.704) [-823.812] (-830.839) * (-826.009) (-828.351) [-825.581] (-826.192) -- 0:00:24
      666500 -- (-825.236) [-824.458] (-824.214) (-830.182) * (-829.854) (-826.106) (-827.409) [-826.499] -- 0:00:24
      667000 -- (-825.187) (-825.311) [-824.653] (-826.909) * [-824.527] (-825.108) (-829.320) (-824.784) -- 0:00:23
      667500 -- [-826.370] (-829.912) (-827.737) (-828.616) * [-824.780] (-826.149) (-826.418) (-825.341) -- 0:00:23
      668000 -- (-829.048) [-824.168] (-827.781) (-826.817) * (-824.603) (-826.968) (-830.665) [-824.813] -- 0:00:23
      668500 -- (-825.629) [-824.495] (-827.102) (-824.760) * (-825.650) (-828.768) (-826.276) [-825.752] -- 0:00:23
      669000 -- [-825.267] (-824.534) (-826.657) (-829.065) * (-824.930) (-824.427) (-824.745) [-826.145] -- 0:00:23
      669500 -- [-823.930] (-824.854) (-827.330) (-827.497) * [-825.122] (-825.500) (-827.254) (-825.368) -- 0:00:23
      670000 -- (-823.856) [-825.568] (-827.566) (-825.275) * (-824.591) (-826.966) [-826.653] (-828.146) -- 0:00:23

      Average standard deviation of split frequencies: 0.008269

      670500 -- (-824.082) (-826.254) (-824.760) [-826.613] * (-827.237) (-826.614) (-826.681) [-828.509] -- 0:00:23
      671000 -- (-824.569) (-824.764) (-824.175) [-827.081] * (-830.258) [-825.847] (-830.088) (-825.556) -- 0:00:23
      671500 -- [-823.957] (-824.960) (-824.986) (-827.064) * (-827.005) (-826.519) [-826.525] (-825.651) -- 0:00:23
      672000 -- (-825.605) [-828.536] (-824.714) (-826.474) * [-827.204] (-826.411) (-829.281) (-827.662) -- 0:00:23
      672500 -- (-824.117) (-824.826) (-825.257) [-826.363] * (-826.518) (-825.668) [-827.740] (-827.119) -- 0:00:23
      673000 -- (-830.239) [-824.721] (-825.321) (-826.779) * [-824.714] (-824.455) (-831.532) (-826.933) -- 0:00:23
      673500 -- (-826.223) [-825.216] (-829.009) (-826.328) * (-827.241) [-825.234] (-826.655) (-826.457) -- 0:00:23
      674000 -- [-824.190] (-825.567) (-827.064) (-830.248) * [-827.640] (-826.101) (-825.663) (-832.007) -- 0:00:23
      674500 -- [-824.443] (-825.450) (-825.553) (-827.837) * (-829.352) [-826.305] (-826.046) (-835.738) -- 0:00:23
      675000 -- (-828.210) (-826.976) (-826.130) [-825.659] * (-825.482) (-824.489) [-829.096] (-826.483) -- 0:00:23

      Average standard deviation of split frequencies: 0.008063

      675500 -- (-827.729) (-825.412) (-824.139) [-825.494] * (-827.216) (-828.019) (-826.810) [-825.593] -- 0:00:23
      676000 -- [-829.208] (-824.790) (-824.846) (-828.152) * [-825.035] (-829.662) (-828.860) (-826.414) -- 0:00:23
      676500 -- (-824.336) (-824.735) [-827.017] (-828.925) * (-825.881) (-825.646) [-826.617] (-824.576) -- 0:00:23
      677000 -- (-824.336) (-828.422) (-825.203) [-824.642] * [-825.001] (-826.579) (-826.819) (-826.188) -- 0:00:23
      677500 -- [-827.900] (-825.575) (-826.246) (-826.032) * [-825.956] (-824.796) (-826.172) (-827.116) -- 0:00:23
      678000 -- (-824.750) (-826.786) [-824.885] (-824.655) * (-825.504) (-825.826) (-826.971) [-824.613] -- 0:00:23
      678500 -- (-825.796) [-824.105] (-823.865) (-824.787) * (-824.377) (-826.317) [-825.733] (-824.015) -- 0:00:23
      679000 -- (-830.855) (-826.126) [-825.054] (-827.035) * (-832.593) [-826.782] (-826.184) (-826.966) -- 0:00:23
      679500 -- [-825.124] (-823.816) (-828.622) (-826.879) * (-825.375) (-829.121) (-829.317) [-825.235] -- 0:00:23
      680000 -- (-826.478) (-825.698) (-825.438) [-824.582] * (-826.676) [-825.812] (-825.444) (-828.617) -- 0:00:23

      Average standard deviation of split frequencies: 0.008527

      680500 -- (-825.457) (-825.135) [-829.550] (-824.765) * (-826.297) (-825.931) [-825.818] (-827.875) -- 0:00:23
      681000 -- [-825.581] (-829.235) (-829.168) (-826.573) * (-826.402) [-825.536] (-828.042) (-827.198) -- 0:00:22
      681500 -- (-824.340) [-824.693] (-823.966) (-825.201) * (-825.108) (-827.144) [-825.411] (-825.385) -- 0:00:22
      682000 -- (-823.991) (-826.036) (-827.785) [-827.622] * (-825.596) (-825.703) (-825.701) [-827.198] -- 0:00:22
      682500 -- [-824.418] (-827.070) (-826.913) (-824.362) * [-825.255] (-826.727) (-826.408) (-828.623) -- 0:00:22
      683000 -- (-825.481) (-824.585) (-824.319) [-824.358] * [-824.429] (-835.804) (-829.172) (-827.596) -- 0:00:22
      683500 -- (-826.844) (-825.375) (-827.454) [-824.628] * (-825.053) (-835.987) [-824.727] (-827.127) -- 0:00:22
      684000 -- (-825.708) [-827.197] (-826.891) (-824.732) * [-825.902] (-833.692) (-828.008) (-826.558) -- 0:00:22
      684500 -- [-827.711] (-826.796) (-824.907) (-828.683) * (-828.246) (-833.243) [-826.184] (-830.531) -- 0:00:22
      685000 -- (-827.721) [-826.603] (-825.037) (-831.888) * (-828.699) (-826.407) (-825.690) [-828.541] -- 0:00:22

      Average standard deviation of split frequencies: 0.007602

      685500 -- (-829.471) [-823.900] (-825.477) (-825.332) * (-824.423) (-824.884) [-824.133] (-828.105) -- 0:00:22
      686000 -- (-828.879) (-825.325) (-823.849) [-825.207] * (-824.529) (-827.746) (-826.690) [-825.095] -- 0:00:22
      686500 -- (-831.137) (-826.369) [-824.944] (-826.118) * (-825.580) [-825.582] (-827.820) (-825.633) -- 0:00:22
      687000 -- [-829.056] (-826.543) (-827.062) (-826.083) * (-825.427) (-825.114) (-824.682) [-829.236] -- 0:00:22
      687500 -- (-827.460) (-825.121) [-826.223] (-826.668) * (-824.223) (-827.168) [-825.128] (-825.838) -- 0:00:22
      688000 -- (-830.117) [-825.622] (-825.936) (-825.036) * [-825.795] (-826.303) (-825.990) (-824.575) -- 0:00:22
      688500 -- (-825.897) (-832.059) [-825.045] (-826.742) * (-832.823) (-828.003) [-825.678] (-823.847) -- 0:00:22
      689000 -- [-824.825] (-828.956) (-825.025) (-828.460) * [-828.781] (-826.565) (-824.970) (-826.741) -- 0:00:22
      689500 -- [-825.708] (-825.745) (-829.692) (-828.283) * (-828.647) (-827.663) (-824.589) [-829.684] -- 0:00:22
      690000 -- (-826.466) (-826.059) [-825.397] (-828.241) * (-825.189) (-825.490) (-826.619) [-827.097] -- 0:00:22

      Average standard deviation of split frequencies: 0.007295

      690500 -- (-828.306) [-827.701] (-825.897) (-828.823) * (-827.338) (-827.857) (-826.913) [-826.803] -- 0:00:22
      691000 -- [-827.944] (-828.747) (-827.701) (-827.130) * [-826.303] (-833.408) (-826.393) (-825.255) -- 0:00:22
      691500 -- [-827.436] (-827.104) (-831.607) (-824.437) * (-826.502) (-828.369) [-827.833] (-827.292) -- 0:00:22
      692000 -- (-826.412) [-825.806] (-827.993) (-824.121) * (-829.036) (-826.336) [-824.258] (-827.435) -- 0:00:22
      692500 -- [-828.081] (-827.189) (-827.981) (-823.799) * [-825.719] (-827.665) (-824.689) (-829.680) -- 0:00:22
      693000 -- [-824.542] (-827.271) (-825.032) (-824.817) * (-826.258) (-824.814) (-825.179) [-825.427] -- 0:00:22
      693500 -- (-824.994) (-824.645) (-823.709) [-825.523] * (-825.527) [-828.273] (-829.299) (-826.715) -- 0:00:22
      694000 -- (-826.550) [-823.920] (-826.266) (-825.156) * (-827.187) [-825.370] (-824.603) (-825.062) -- 0:00:22
      694500 -- (-830.266) [-825.107] (-828.970) (-825.831) * (-824.109) (-825.446) (-825.663) [-827.656] -- 0:00:21
      695000 -- (-824.403) [-829.093] (-828.071) (-826.596) * (-824.940) (-826.134) (-832.089) [-826.540] -- 0:00:21

      Average standard deviation of split frequencies: 0.007450

      695500 -- [-824.243] (-824.239) (-825.156) (-825.641) * (-826.527) (-824.318) (-825.182) [-826.264] -- 0:00:21
      696000