--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:19:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0030/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -455.18 -458.20
2 -455.21 -458.01
--------------------------------------
TOTAL -455.19 -458.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891295 0.086746 0.360395 1.489011 0.858673 1298.80 1399.90 1.000
r(A<->C){all} 0.146994 0.015633 0.000007 0.397125 0.114391 303.39 368.09 1.003
r(A<->G){all} 0.180975 0.022181 0.000004 0.481592 0.140219 315.20 328.89 1.002
r(A<->T){all} 0.166927 0.019510 0.000023 0.447712 0.129732 242.34 341.75 1.000
r(C<->G){all} 0.173894 0.020874 0.000011 0.456480 0.133775 222.58 315.78 1.001
r(C<->T){all} 0.167110 0.020083 0.000003 0.456569 0.130174 236.90 240.09 1.005
r(G<->T){all} 0.164100 0.019498 0.000032 0.449187 0.130180 148.74 217.23 1.001
pi(A){all} 0.157147 0.000373 0.122006 0.197343 0.156750 1148.46 1321.79 1.000
pi(C){all} 0.320911 0.000646 0.268352 0.366097 0.321096 1386.95 1423.87 1.000
pi(G){all} 0.329247 0.000640 0.277605 0.375904 0.328808 1101.07 1111.23 1.000
pi(T){all} 0.192694 0.000471 0.147862 0.232807 0.192147 1183.79 1310.52 1.000
alpha{1,2} 0.409715 0.231721 0.000134 1.375773 0.237075 1218.75 1267.06 1.000
alpha{3} 0.442637 0.217859 0.000188 1.373491 0.293996 1180.59 1214.51 1.000
pinvar{all} 0.995086 0.000038 0.984359 0.999999 0.997053 1222.10 1305.14 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -435.795959
Model 2: PositiveSelection -435.795904
Model 0: one-ratio -435.795946
Model 7: beta -435.796027
Model 8: beta&w>1 -435.795971
Model 0 vs 1 2.599999993435631E-5
Model 2 vs 1 1.0999999994965037E-4
Model 8 vs 7 1.1199999994460086E-4
>C1
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C2
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C3
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C4
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C5
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C6
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
C1 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C2 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C3 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C4 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C5 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C6 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
**************************************************
C1 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C2 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C3 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C4 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C5 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C6 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
**************************************************
C1 CGKNCAGCILSCR
C2 CGKNCAGCILSCR
C3 CGKNCAGCILSCR
C4 CGKNCAGCILSCR
C5 CGKNCAGCILSCR
C6 CGKNCAGCILSCR
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3390]--->[3390]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C2 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C3 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C4 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C5 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C6 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
**************************************************
C1 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C2 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C3 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C4 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C5 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C6 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
**************************************************
C1 CGKNCAGCILSCR
C2 CGKNCAGCILSCR
C3 CGKNCAGCILSCR
C4 CGKNCAGCILSCR
C5 CGKNCAGCILSCR
C6 CGKNCAGCILSCR
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C2 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C3 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C4 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C5 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C6 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
**************************************************
C1 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C2 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C3 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C4 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C5 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C6 GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
**************************************************
C1 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C2 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C3 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C4 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C5 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C6 TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
**************************************************
C1 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C2 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C3 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C4 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C5 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C6 GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
**************************************************
C1 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C2 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C3 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C4 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C5 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C6 AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
**************************************************
C1 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C2 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C3 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C4 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C5 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C6 CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
**************************************************
C1 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C2 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C3 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C4 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C5 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C6 TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
***************************************
>C1
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C2
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C3
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C4
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C5
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C6
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C1
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C2
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C3
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C4
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C5
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C6
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 339 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789091
Setting output file names to "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 513876959
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0719794944
Seed = 1823441473
Swapseed = 1579789091
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -758.698208 -- -24.965149
Chain 2 -- -758.698208 -- -24.965149
Chain 3 -- -758.698208 -- -24.965149
Chain 4 -- -758.698251 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -758.698208 -- -24.965149
Chain 2 -- -758.698136 -- -24.965149
Chain 3 -- -758.698251 -- -24.965149
Chain 4 -- -758.698251 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-758.698] (-758.698) (-758.698) (-758.698) * [-758.698] (-758.698) (-758.698) (-758.698)
500 -- (-471.193) (-470.029) [-466.211] (-469.756) * (-473.551) (-473.365) (-479.523) [-472.987] -- 0:00:00
1000 -- [-464.876] (-463.489) (-468.214) (-470.777) * (-468.583) (-471.385) (-477.602) [-459.230] -- 0:00:00
1500 -- (-471.679) [-462.237] (-465.980) (-465.208) * (-462.540) [-462.316] (-464.768) (-467.610) -- 0:00:00
2000 -- (-462.352) (-469.058) [-467.474] (-471.318) * (-464.563) (-465.253) (-465.905) [-463.457] -- 0:00:00
2500 -- [-462.173] (-467.982) (-468.942) (-462.055) * (-466.400) (-467.499) [-464.285] (-460.220) -- 0:00:00
3000 -- [-463.388] (-460.929) (-472.054) (-462.285) * (-465.463) [-465.798] (-463.281) (-468.079) -- 0:00:00
3500 -- (-461.173) (-465.832) [-463.410] (-470.327) * (-481.804) (-461.899) (-461.723) [-457.856] -- 0:00:00
4000 -- (-470.813) (-466.313) [-466.310] (-469.898) * (-464.244) [-460.065] (-465.217) (-464.487) -- 0:00:00
4500 -- (-465.934) (-464.299) (-465.293) [-460.667] * (-465.870) (-464.692) (-465.721) [-466.643] -- 0:00:00
5000 -- (-467.952) [-461.358] (-468.097) (-469.778) * (-462.322) [-461.303] (-471.345) (-466.945) -- 0:00:00
Average standard deviation of split frequencies: 0.102479
5500 -- (-462.321) (-464.793) [-475.845] (-468.410) * (-469.305) [-464.551] (-469.757) (-464.868) -- 0:03:00
6000 -- (-466.361) (-468.793) [-464.716] (-461.216) * [-458.861] (-470.211) (-469.859) (-461.033) -- 0:02:45
6500 -- (-468.683) (-465.579) (-473.824) [-460.402] * (-466.244) [-463.200] (-465.757) (-458.800) -- 0:02:32
7000 -- (-466.043) [-464.358] (-466.191) (-469.807) * (-461.236) (-467.847) (-466.387) [-459.648] -- 0:02:21
7500 -- (-465.119) (-484.953) (-466.934) [-461.720] * (-472.055) (-467.900) (-461.453) [-462.181] -- 0:02:12
8000 -- (-468.186) (-467.702) (-472.510) [-459.191] * (-463.632) (-469.492) [-462.088] (-470.525) -- 0:02:04
8500 -- (-476.117) (-454.723) (-480.269) [-465.468] * (-462.568) [-465.493] (-467.276) (-463.081) -- 0:01:56
9000 -- (-455.215) [-457.403] (-470.519) (-464.355) * (-463.293) (-466.236) (-469.442) [-467.126] -- 0:01:50
9500 -- [-454.383] (-455.457) (-462.577) (-465.589) * [-460.323] (-464.071) (-464.176) (-470.704) -- 0:01:44
10000 -- (-454.451) (-457.062) (-478.556) [-462.524] * [-473.436] (-463.579) (-459.190) (-476.097) -- 0:01:39
Average standard deviation of split frequencies: 0.056821
10500 -- [-455.390] (-456.464) (-473.338) (-460.357) * [-468.304] (-462.925) (-466.759) (-458.936) -- 0:01:34
11000 -- (-453.667) (-456.998) (-476.070) [-459.742] * (-470.758) (-474.170) (-470.512) [-464.730] -- 0:01:29
11500 -- (-459.770) (-456.160) (-460.528) [-463.218] * [-462.942] (-468.445) (-466.183) (-462.710) -- 0:01:25
12000 -- [-456.144] (-455.350) (-460.564) (-465.944) * [-469.395] (-464.207) (-472.745) (-463.782) -- 0:01:22
12500 -- (-460.975) [-461.140] (-456.786) (-469.298) * (-469.125) (-469.835) (-467.793) [-462.140] -- 0:01:19
13000 -- [-454.792] (-455.683) (-457.095) (-460.568) * (-464.627) [-466.449] (-465.313) (-474.069) -- 0:01:15
13500 -- [-458.279] (-455.371) (-459.949) (-470.895) * (-470.462) (-470.841) [-465.634] (-462.728) -- 0:01:13
14000 -- (-455.995) (-455.875) (-457.494) [-465.824] * [-461.567] (-466.494) (-464.474) (-464.989) -- 0:01:10
14500 -- [-457.158] (-455.223) (-459.220) (-464.516) * (-463.271) (-469.637) (-463.760) [-464.075] -- 0:01:07
15000 -- (-454.756) (-459.325) [-457.395] (-464.323) * (-466.731) (-463.356) [-462.533] (-466.109) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- [-455.923] (-455.522) (-456.410) (-462.497) * (-466.133) (-462.030) [-466.253] (-474.315) -- 0:01:03
16000 -- (-454.992) [-455.119] (-455.871) (-472.312) * (-469.344) [-459.120] (-472.512) (-476.836) -- 0:01:01
16500 -- [-457.725] (-456.121) (-455.966) (-463.029) * (-468.103) (-464.675) [-461.707] (-460.997) -- 0:00:59
17000 -- (-454.793) (-455.160) (-456.626) [-465.151] * [-468.478] (-465.141) (-463.231) (-460.744) -- 0:00:57
17500 -- (-454.165) (-455.161) [-455.822] (-463.934) * (-467.708) (-460.236) [-470.137] (-454.530) -- 0:00:56
18000 -- [-455.423] (-454.110) (-454.662) (-463.355) * (-467.438) (-465.168) (-463.697) [-456.477] -- 0:00:54
18500 -- (-455.501) [-454.715] (-456.200) (-464.251) * (-470.047) (-470.723) (-469.626) [-454.590] -- 0:00:53
19000 -- (-455.045) (-456.195) [-453.855] (-472.589) * [-469.001] (-465.401) (-475.767) (-459.566) -- 0:00:51
19500 -- [-456.668] (-455.853) (-453.743) (-464.809) * (-465.263) (-463.841) [-467.841] (-455.645) -- 0:00:50
20000 -- (-456.821) [-455.772] (-454.448) (-463.803) * [-461.839] (-472.528) (-462.926) (-455.243) -- 0:00:49
Average standard deviation of split frequencies: 0.042198
20500 -- [-457.132] (-454.803) (-455.761) (-467.500) * (-485.918) (-463.806) [-464.860] (-455.303) -- 0:00:47
21000 -- (-456.059) (-455.637) [-455.657] (-465.986) * (-475.420) (-466.062) (-463.886) [-454.350] -- 0:01:33
21500 -- [-459.582] (-454.264) (-453.796) (-467.288) * [-454.463] (-466.996) (-464.906) (-454.965) -- 0:01:31
22000 -- (-459.743) (-454.844) [-456.489] (-464.627) * [-462.499] (-466.316) (-465.852) (-455.759) -- 0:01:28
22500 -- [-461.375] (-454.420) (-456.692) (-465.320) * (-454.662) (-460.920) [-465.152] (-454.980) -- 0:01:26
23000 -- (-459.086) (-455.815) [-456.031] (-464.403) * (-455.900) [-467.446] (-469.797) (-454.675) -- 0:01:24
23500 -- (-458.675) (-455.517) (-455.179) [-461.061] * (-456.417) (-468.729) (-459.259) [-454.393] -- 0:01:23
24000 -- (-456.112) (-456.467) [-457.755] (-470.255) * (-457.706) (-465.014) (-463.002) [-454.306] -- 0:01:21
24500 -- (-456.067) (-454.259) [-457.738] (-466.526) * (-453.694) (-463.358) [-465.838] (-454.744) -- 0:01:19
25000 -- (-457.282) (-455.148) (-456.287) [-463.010] * (-455.518) (-464.720) (-467.504) [-455.488] -- 0:01:18
Average standard deviation of split frequencies: 0.047298
25500 -- [-456.186] (-455.193) (-454.767) (-463.706) * (-456.698) [-463.811] (-466.916) (-457.639) -- 0:01:16
26000 -- (-454.084) (-456.144) (-455.138) [-466.949] * [-456.507] (-463.849) (-462.419) (-456.290) -- 0:01:14
26500 -- (-455.219) [-456.605] (-456.977) (-469.420) * (-454.656) (-463.646) (-475.514) [-456.413] -- 0:01:13
27000 -- (-459.535) (-454.670) (-457.196) [-460.161] * (-456.954) (-469.077) (-472.445) [-454.557] -- 0:01:12
27500 -- (-455.789) [-456.379] (-455.294) (-460.045) * (-458.749) (-462.291) [-467.346] (-455.689) -- 0:01:10
28000 -- [-454.929] (-453.989) (-454.954) (-467.961) * (-455.114) (-470.402) (-461.851) [-457.228] -- 0:01:09
28500 -- (-455.977) [-456.340] (-456.990) (-470.245) * (-459.980) (-467.871) (-464.214) [-455.539] -- 0:01:08
29000 -- [-455.123] (-457.637) (-454.979) (-458.377) * (-456.710) (-465.238) (-457.581) [-454.754] -- 0:01:06
29500 -- (-455.619) [-458.657] (-455.885) (-469.389) * (-458.593) (-471.503) (-455.995) [-455.448] -- 0:01:05
30000 -- (-454.757) (-456.941) (-456.992) [-468.224] * [-457.989] (-475.031) (-456.909) (-455.169) -- 0:01:04
Average standard deviation of split frequencies: 0.054900
30500 -- (-454.227) (-456.189) (-455.052) [-466.183] * (-456.572) (-467.273) [-454.281] (-456.335) -- 0:01:03
31000 -- [-453.742] (-455.056) (-454.578) (-468.922) * (-456.228) (-456.474) (-455.348) [-455.040] -- 0:01:02
31500 -- [-455.693] (-456.061) (-454.226) (-459.758) * (-456.087) (-459.441) (-458.619) [-457.524] -- 0:01:01
32000 -- [-454.772] (-456.390) (-455.582) (-470.164) * (-455.375) (-458.255) (-456.034) [-454.273] -- 0:01:00
32500 -- (-459.462) [-456.277] (-454.277) (-464.419) * (-456.799) (-457.609) (-455.689) [-453.979] -- 0:00:59
33000 -- (-454.536) (-456.030) (-455.589) [-465.489] * (-456.195) (-456.142) (-456.875) [-457.129] -- 0:00:58
33500 -- (-454.825) (-456.457) [-458.843] (-469.282) * [-454.853] (-455.985) (-458.393) (-456.731) -- 0:00:57
34000 -- [-455.956] (-458.644) (-457.952) (-460.188) * [-456.596] (-455.674) (-455.002) (-455.058) -- 0:00:56
34500 -- (-454.719) [-454.883] (-457.035) (-474.415) * (-457.075) [-454.345] (-454.716) (-455.092) -- 0:00:55
35000 -- (-456.157) (-454.193) [-456.779] (-469.423) * (-455.658) [-454.914] (-456.838) (-454.820) -- 0:00:55
Average standard deviation of split frequencies: 0.049261
35500 -- (-460.342) [-455.982] (-457.174) (-465.162) * (-458.479) (-456.510) [-460.095] (-454.381) -- 0:00:54
36000 -- (-455.709) (-458.503) (-455.600) [-463.223] * (-455.101) [-459.410] (-455.023) (-454.457) -- 0:00:53
36500 -- (-457.283) (-457.176) (-461.277) [-459.586] * [-457.943] (-459.911) (-455.957) (-455.711) -- 0:00:52
37000 -- (-458.247) (-455.894) [-454.891] (-464.725) * (-457.821) [-456.758] (-454.715) (-454.026) -- 0:01:18
37500 -- (-455.521) (-454.646) [-456.816] (-469.591) * (-453.825) [-455.728] (-454.655) (-457.408) -- 0:01:17
38000 -- (-455.581) (-456.444) (-455.903) [-459.851] * (-455.281) (-458.167) [-456.067] (-458.845) -- 0:01:15
38500 -- (-454.914) [-456.799] (-457.854) (-469.604) * (-454.621) (-460.655) [-456.190] (-455.885) -- 0:01:14
39000 -- (-457.857) [-459.406] (-455.815) (-464.067) * (-453.634) (-461.909) (-455.951) [-458.213] -- 0:01:13
39500 -- (-456.123) (-456.181) (-456.059) [-466.644] * (-458.333) (-454.731) (-458.078) [-453.832] -- 0:01:12
40000 -- [-460.900] (-457.984) (-454.655) (-464.703) * (-458.844) (-455.681) (-459.183) [-454.647] -- 0:01:12
Average standard deviation of split frequencies: 0.052743
40500 -- (-459.575) [-456.715] (-456.220) (-466.982) * (-455.194) (-456.027) (-454.229) [-455.009] -- 0:01:11
41000 -- (-457.043) (-457.034) [-454.179] (-458.559) * (-455.071) (-454.633) (-454.866) [-454.144] -- 0:01:10
41500 -- (-454.174) [-456.092] (-456.125) (-458.466) * (-455.143) (-458.101) (-457.720) [-455.337] -- 0:01:09
42000 -- (-456.286) (-454.804) [-459.197] (-456.774) * [-455.118] (-458.392) (-455.216) (-454.195) -- 0:01:08
42500 -- (-462.138) [-455.694] (-455.472) (-456.286) * [-456.421] (-456.806) (-456.970) (-458.771) -- 0:01:07
43000 -- [-457.740] (-454.811) (-455.199) (-454.916) * (-455.643) (-457.853) [-458.658] (-463.667) -- 0:01:06
43500 -- (-456.804) (-455.563) [-460.440] (-457.212) * (-454.997) (-456.380) [-454.612] (-457.049) -- 0:01:05
44000 -- [-457.279] (-456.639) (-454.431) (-454.957) * (-457.260) (-456.744) [-454.649] (-455.276) -- 0:01:05
44500 -- (-458.814) (-456.012) [-454.448] (-456.099) * (-457.112) [-455.778] (-454.587) (-456.159) -- 0:01:04
45000 -- [-456.727] (-455.488) (-454.139) (-456.201) * [-463.809] (-455.841) (-454.266) (-454.908) -- 0:01:03
Average standard deviation of split frequencies: 0.047824
45500 -- (-454.414) (-455.478) [-460.493] (-457.654) * (-455.157) (-456.038) (-455.987) [-455.560] -- 0:01:02
46000 -- (-454.707) (-454.614) [-455.271] (-456.186) * [-455.717] (-455.393) (-455.183) (-454.972) -- 0:01:02
46500 -- (-457.128) [-456.702] (-454.467) (-454.053) * [-455.295] (-456.960) (-455.546) (-454.768) -- 0:01:01
47000 -- [-454.608] (-456.231) (-454.118) (-455.767) * (-458.092) (-455.172) (-455.233) [-458.572] -- 0:01:00
47500 -- (-454.078) (-456.817) [-454.180] (-454.832) * (-457.050) (-455.338) (-456.048) [-456.376] -- 0:01:00
48000 -- (-454.648) [-453.579] (-454.963) (-455.928) * (-456.227) [-454.141] (-457.807) (-453.976) -- 0:00:59
48500 -- (-459.688) [-454.506] (-457.411) (-459.686) * [-456.278] (-459.123) (-457.310) (-455.767) -- 0:00:58
49000 -- (-459.284) (-455.353) (-456.759) [-457.153] * (-456.502) (-456.120) (-456.278) [-458.646] -- 0:00:58
49500 -- (-456.198) (-458.263) [-457.751] (-456.730) * (-457.602) (-456.037) (-455.315) [-455.258] -- 0:00:57
50000 -- (-467.136) (-458.968) [-457.240] (-455.752) * (-455.482) [-457.336] (-455.480) (-455.044) -- 0:00:57
Average standard deviation of split frequencies: 0.049458
50500 -- (-456.779) (-457.205) [-456.122] (-455.102) * (-457.715) [-455.151] (-454.996) (-455.820) -- 0:00:56
51000 -- (-456.404) (-459.263) (-456.382) [-456.185] * (-457.543) (-456.419) (-453.881) [-459.033] -- 0:00:55
51500 -- (-456.945) [-459.301] (-454.417) (-455.942) * (-456.405) (-455.299) (-455.135) [-458.395] -- 0:00:55
52000 -- (-455.216) (-457.496) [-455.493] (-457.253) * (-453.539) (-455.035) [-455.402] (-454.275) -- 0:00:54
52500 -- (-456.503) [-454.613] (-454.898) (-458.294) * (-455.552) (-455.777) (-458.240) [-455.329] -- 0:01:12
53000 -- (-457.103) (-455.530) [-455.687] (-455.867) * (-454.639) (-456.943) (-457.548) [-456.024] -- 0:01:11
53500 -- (-454.104) (-456.553) (-455.201) [-459.503] * (-458.497) (-455.534) (-455.575) [-454.502] -- 0:01:10
54000 -- (-455.700) (-454.016) [-457.891] (-455.458) * [-456.173] (-455.936) (-457.466) (-456.789) -- 0:01:10
54500 -- (-455.801) [-455.831] (-456.066) (-457.059) * (-455.452) [-454.540] (-454.904) (-457.377) -- 0:01:09
55000 -- (-456.092) (-455.903) [-456.293] (-455.372) * (-457.519) (-456.414) [-455.157] (-455.224) -- 0:01:08
Average standard deviation of split frequencies: 0.041689
55500 -- (-455.008) (-459.063) (-457.584) [-454.928] * (-457.289) (-456.109) [-457.586] (-459.321) -- 0:01:08
56000 -- (-454.196) (-457.137) (-455.301) [-457.329] * (-454.069) (-454.275) [-455.550] (-455.472) -- 0:01:07
56500 -- (-454.211) (-454.100) [-459.752] (-456.324) * [-455.464] (-455.530) (-455.135) (-456.170) -- 0:01:06
57000 -- [-454.186] (-454.382) (-455.248) (-456.302) * (-455.629) (-456.050) [-455.815] (-455.095) -- 0:01:06
57500 -- [-454.050] (-454.020) (-455.977) (-455.182) * [-454.959] (-454.921) (-457.816) (-455.109) -- 0:01:05
58000 -- [-453.996] (-457.003) (-456.868) (-456.826) * [-455.719] (-456.766) (-456.013) (-459.083) -- 0:01:04
58500 -- [-454.725] (-456.141) (-455.048) (-455.588) * (-455.564) (-455.797) (-455.357) [-461.202] -- 0:01:04
59000 -- (-454.590) (-455.285) (-453.809) [-454.940] * [-454.577] (-455.846) (-455.333) (-455.867) -- 0:01:03
59500 -- (-456.393) [-454.834] (-457.449) (-455.283) * [-454.708] (-456.105) (-455.901) (-459.473) -- 0:01:03
60000 -- (-456.214) (-455.133) (-460.225) [-453.853] * (-455.282) [-459.587] (-455.086) (-457.037) -- 0:01:02
Average standard deviation of split frequencies: 0.038852
60500 -- (-455.318) (-459.403) (-455.665) [-455.632] * (-454.835) (-458.181) (-455.662) [-454.866] -- 0:01:02
61000 -- [-455.477] (-455.750) (-455.757) (-454.917) * (-455.240) (-458.493) (-456.941) [-454.801] -- 0:01:01
61500 -- (-454.962) (-455.852) (-455.969) [-457.144] * (-455.210) (-456.784) (-458.618) [-456.739] -- 0:01:01
62000 -- [-458.864] (-457.223) (-456.743) (-461.769) * (-455.971) [-457.539] (-456.927) (-458.047) -- 0:01:00
62500 -- (-463.087) (-458.493) [-456.452] (-454.018) * (-456.444) (-462.058) (-457.834) [-454.869] -- 0:01:00
63000 -- (-454.434) (-455.868) [-454.607] (-454.741) * (-457.478) (-454.979) [-459.317] (-456.477) -- 0:00:59
63500 -- (-455.633) (-453.717) [-454.276] (-458.189) * (-455.675) (-453.691) [-455.023] (-458.599) -- 0:00:58
64000 -- (-454.904) (-456.600) [-454.891] (-456.405) * (-460.623) [-454.647] (-456.161) (-454.485) -- 0:00:58
64500 -- (-456.793) (-457.467) [-457.468] (-456.689) * [-456.835] (-458.192) (-454.245) (-457.801) -- 0:00:58
65000 -- [-456.140] (-457.592) (-454.719) (-455.643) * [-457.496] (-460.589) (-454.812) (-459.346) -- 0:00:57
Average standard deviation of split frequencies: 0.033440
65500 -- (-455.136) (-457.606) (-460.974) [-457.907] * (-459.152) (-455.117) (-457.299) [-457.908] -- 0:00:57
66000 -- (-455.567) (-455.610) [-454.168] (-457.921) * (-456.180) [-454.853] (-454.263) (-456.066) -- 0:00:56
66500 -- (-457.634) (-461.617) (-458.290) [-458.367] * (-457.667) (-454.158) [-458.421] (-456.663) -- 0:00:56
67000 -- (-454.642) (-456.364) (-455.243) [-454.592] * (-454.613) (-456.295) [-454.532] (-455.879) -- 0:00:55
67500 -- [-454.941] (-454.241) (-456.416) (-458.415) * [-459.117] (-456.127) (-455.691) (-456.425) -- 0:00:55
68000 -- (-454.420) (-456.598) [-454.928] (-455.587) * (-457.371) (-455.555) [-455.624] (-456.011) -- 0:01:08
68500 -- (-454.821) [-456.922] (-455.868) (-457.981) * (-454.114) (-458.527) (-455.723) [-457.619] -- 0:01:07
69000 -- (-457.188) (-457.279) [-453.694] (-458.175) * [-455.753] (-455.103) (-455.848) (-455.473) -- 0:01:07
69500 -- [-455.198] (-455.144) (-456.437) (-456.576) * [-454.018] (-456.324) (-456.481) (-457.132) -- 0:01:06
70000 -- [-456.185] (-454.644) (-457.551) (-455.934) * (-453.983) (-459.990) (-455.222) [-454.415] -- 0:01:06
Average standard deviation of split frequencies: 0.033021
70500 -- (-456.468) (-457.228) [-454.542] (-455.390) * (-456.569) [-454.488] (-453.980) (-458.809) -- 0:01:05
71000 -- [-457.829] (-455.737) (-457.024) (-454.954) * (-454.403) (-456.538) (-457.796) [-454.511] -- 0:01:05
71500 -- (-460.844) (-454.504) [-457.199] (-456.985) * (-456.674) [-455.580] (-459.049) (-458.976) -- 0:01:04
72000 -- (-455.788) [-455.396] (-461.137) (-454.432) * (-458.521) [-454.849] (-456.915) (-457.160) -- 0:01:04
72500 -- (-455.484) (-457.670) (-455.850) [-455.745] * (-457.815) [-456.012] (-455.209) (-455.496) -- 0:01:03
73000 -- (-455.663) (-459.027) [-454.066] (-457.421) * [-457.613] (-455.914) (-455.804) (-456.036) -- 0:01:03
73500 -- (-457.965) (-455.145) [-454.025] (-455.226) * [-457.083] (-456.135) (-454.184) (-459.264) -- 0:01:03
74000 -- [-459.142] (-454.018) (-458.583) (-454.423) * (-457.419) [-456.029] (-462.395) (-457.809) -- 0:01:02
74500 -- (-457.772) (-454.498) (-454.289) [-455.308] * (-456.820) (-456.627) (-456.988) [-457.387] -- 0:01:02
75000 -- (-456.261) (-455.789) (-454.156) [-455.474] * (-454.391) [-454.493] (-460.502) (-454.740) -- 0:01:01
Average standard deviation of split frequencies: 0.031993
75500 -- (-455.791) [-453.816] (-455.638) (-454.250) * (-453.732) (-455.030) [-457.483] (-459.787) -- 0:01:01
76000 -- [-457.412] (-459.051) (-456.352) (-457.035) * (-455.863) (-455.780) [-455.812] (-456.633) -- 0:01:00
76500 -- (-455.574) (-457.180) [-454.168] (-455.393) * (-453.954) (-456.285) (-455.745) [-458.186] -- 0:01:00
77000 -- (-457.935) (-454.346) [-454.939] (-455.636) * (-454.644) (-454.243) (-457.051) [-455.659] -- 0:00:59
77500 -- (-462.010) (-454.449) (-457.220) [-456.891] * (-453.957) [-454.000] (-454.539) (-460.222) -- 0:00:59
78000 -- [-455.352] (-458.382) (-455.115) (-454.039) * (-455.214) [-454.051] (-456.513) (-458.067) -- 0:00:59
78500 -- [-453.930] (-461.981) (-454.803) (-456.761) * (-455.817) [-455.990] (-454.592) (-455.293) -- 0:00:58
79000 -- (-455.910) (-457.108) (-456.091) [-457.233] * (-454.380) (-457.304) [-455.255] (-456.586) -- 0:00:58
79500 -- (-458.535) (-456.930) [-457.591] (-459.728) * (-454.557) (-454.944) (-462.708) [-455.882] -- 0:00:57
80000 -- (-460.106) [-454.919] (-459.021) (-461.122) * (-455.650) [-455.589] (-454.749) (-456.678) -- 0:00:57
Average standard deviation of split frequencies: 0.030388
80500 -- (-454.102) (-455.744) [-456.866] (-461.369) * (-456.131) (-456.357) (-456.595) [-454.774] -- 0:00:57
81000 -- (-454.139) (-455.700) (-457.062) [-456.245] * (-457.142) [-453.747] (-457.002) (-455.007) -- 0:00:56
81500 -- (-460.803) (-454.775) [-457.008] (-458.798) * (-455.920) [-453.557] (-455.830) (-456.227) -- 0:00:56
82000 -- [-457.024] (-454.199) (-455.942) (-455.718) * (-456.760) (-455.485) [-457.134] (-455.335) -- 0:00:55
82500 -- (-456.454) [-456.859] (-456.128) (-455.955) * (-454.420) [-455.036] (-456.278) (-456.275) -- 0:00:55
83000 -- (-454.969) (-455.602) [-456.506] (-455.078) * (-454.692) (-454.136) (-458.390) [-454.925] -- 0:00:55
83500 -- (-454.563) (-453.752) (-455.299) [-454.219] * (-455.779) (-454.753) (-453.615) [-455.510] -- 0:00:54
84000 -- (-453.978) (-458.623) (-455.382) [-456.036] * (-455.212) (-454.588) [-454.790] (-456.484) -- 0:01:05
84500 -- (-456.449) (-455.346) [-454.370] (-456.073) * (-454.774) (-454.760) (-454.023) [-453.893] -- 0:01:05
85000 -- (-456.565) [-453.936] (-454.218) (-454.200) * (-458.147) (-457.703) (-454.859) [-458.780] -- 0:01:04
Average standard deviation of split frequencies: 0.030801
85500 -- (-456.497) [-456.712] (-456.519) (-454.729) * [-456.204] (-459.920) (-458.970) (-454.922) -- 0:01:04
86000 -- (-454.454) (-454.969) (-455.301) [-456.204] * (-455.759) (-456.258) [-455.530] (-454.872) -- 0:01:03
86500 -- (-455.366) (-455.113) (-454.134) [-455.829] * (-453.896) [-456.769] (-455.426) (-454.955) -- 0:01:03
87000 -- [-459.667] (-455.426) (-458.146) (-456.300) * (-457.697) [-459.362] (-456.198) (-460.241) -- 0:01:02
87500 -- [-456.526] (-455.375) (-456.382) (-454.569) * (-457.230) (-455.147) (-460.124) [-455.422] -- 0:01:02
88000 -- (-454.047) (-456.373) [-456.692] (-453.901) * (-454.898) (-459.096) [-454.829] (-457.517) -- 0:01:02
88500 -- (-455.770) (-454.957) [-455.200] (-455.363) * [-454.853] (-454.605) (-454.911) (-459.901) -- 0:01:01
89000 -- (-457.465) (-458.319) [-456.259] (-457.554) * (-458.161) (-454.632) [-455.097] (-461.061) -- 0:01:01
89500 -- (-456.889) (-457.853) (-463.376) [-456.012] * (-455.242) [-454.324] (-454.915) (-457.385) -- 0:01:01
90000 -- (-457.724) [-454.573] (-453.823) (-454.121) * (-456.290) (-455.149) (-456.543) [-455.653] -- 0:01:00
Average standard deviation of split frequencies: 0.030206
90500 -- [-454.977] (-456.065) (-457.815) (-461.299) * [-456.533] (-454.047) (-456.198) (-455.362) -- 0:01:00
91000 -- [-456.113] (-454.923) (-455.425) (-456.140) * (-453.584) (-454.495) [-453.941] (-457.696) -- 0:00:59
91500 -- (-456.111) (-459.442) (-458.699) [-458.441] * (-455.699) [-455.074] (-455.031) (-454.196) -- 0:00:59
92000 -- (-455.858) (-455.171) [-454.195] (-456.178) * (-457.360) (-456.292) (-455.239) [-460.191] -- 0:00:59
92500 -- [-457.496] (-456.162) (-457.179) (-455.664) * (-456.698) (-454.746) [-454.156] (-455.873) -- 0:00:58
93000 -- [-456.204] (-458.658) (-458.466) (-454.996) * [-455.201] (-455.146) (-459.329) (-455.822) -- 0:00:58
93500 -- (-460.867) (-458.660) [-454.638] (-456.307) * (-458.110) [-454.882] (-455.228) (-454.310) -- 0:00:58
94000 -- (-456.494) (-455.480) [-456.483] (-456.005) * (-456.541) (-456.274) (-457.050) [-455.032] -- 0:00:57
94500 -- (-454.568) [-454.231] (-458.581) (-458.444) * (-457.590) (-455.351) (-457.347) [-454.991] -- 0:00:57
95000 -- (-456.242) (-455.455) (-457.379) [-455.133] * (-457.952) (-454.449) (-459.092) [-454.468] -- 0:00:57
Average standard deviation of split frequencies: 0.028294
95500 -- (-465.110) (-457.353) (-454.268) [-456.018] * (-457.613) (-454.868) (-455.200) [-458.376] -- 0:00:56
96000 -- (-456.303) [-455.410] (-457.908) (-457.261) * (-454.133) [-454.416] (-457.106) (-458.827) -- 0:00:56
96500 -- (-456.419) [-455.117] (-455.196) (-456.335) * (-453.870) (-458.676) (-456.526) [-457.016] -- 0:00:56
97000 -- (-456.184) (-458.560) (-455.663) [-457.203] * (-455.286) [-455.871] (-457.796) (-459.649) -- 0:00:55
97500 -- [-457.401] (-455.975) (-458.365) (-454.443) * (-459.654) (-457.281) [-455.243] (-457.255) -- 0:00:55
98000 -- (-455.349) [-454.833] (-460.516) (-456.754) * (-455.557) (-457.274) (-459.322) [-454.300] -- 0:00:55
98500 -- (-457.406) [-455.225] (-456.994) (-458.381) * (-456.151) (-457.084) (-455.024) [-456.531] -- 0:00:54
99000 -- [-459.458] (-455.695) (-457.134) (-455.751) * [-458.998] (-456.239) (-457.531) (-456.420) -- 0:00:54
99500 -- [-455.037] (-455.841) (-455.609) (-456.692) * (-454.241) [-455.542] (-455.831) (-457.625) -- 0:01:03
100000 -- (-460.880) (-458.127) [-455.464] (-455.723) * (-453.560) (-454.741) (-455.863) [-458.053] -- 0:01:02
Average standard deviation of split frequencies: 0.024646
100500 -- (-456.927) (-455.728) (-459.259) [-454.799] * (-458.183) [-455.304] (-455.717) (-456.016) -- 0:01:02
101000 -- (-457.889) (-454.013) [-456.106] (-456.666) * (-454.759) [-455.798] (-455.265) (-461.096) -- 0:01:02
101500 -- [-455.340] (-454.929) (-455.936) (-457.358) * (-456.518) [-456.716] (-454.940) (-455.884) -- 0:01:01
102000 -- (-454.216) [-456.163] (-456.886) (-460.106) * [-455.880] (-454.945) (-455.239) (-457.420) -- 0:01:01
102500 -- (-454.215) [-456.740] (-458.381) (-457.098) * (-455.447) (-456.668) (-454.485) [-454.022] -- 0:01:01
103000 -- (-454.937) (-455.578) [-456.842] (-454.072) * [-456.373] (-455.321) (-454.257) (-454.964) -- 0:01:00
103500 -- (-453.948) (-455.891) [-456.046] (-454.915) * (-457.037) (-455.774) (-456.379) [-453.964] -- 0:01:00
104000 -- (-454.335) [-459.965] (-455.713) (-454.921) * [-454.513] (-454.703) (-455.253) (-456.297) -- 0:01:00
104500 -- [-456.114] (-458.844) (-455.929) (-459.999) * [-455.357] (-455.565) (-455.117) (-458.232) -- 0:00:59
105000 -- (-458.126) (-455.466) [-455.518] (-455.427) * (-455.383) (-454.996) [-454.244] (-459.177) -- 0:00:59
Average standard deviation of split frequencies: 0.023295
105500 -- [-455.384] (-455.719) (-455.378) (-456.170) * (-456.912) (-457.385) [-455.101] (-456.264) -- 0:00:59
106000 -- (-457.286) (-457.125) (-453.592) [-455.249] * (-454.339) (-458.558) [-457.302] (-455.450) -- 0:00:59
106500 -- (-460.980) (-456.896) (-455.117) [-453.974] * (-456.758) (-457.291) [-454.746] (-456.842) -- 0:00:58
107000 -- (-460.087) [-454.947] (-453.691) (-457.546) * (-454.631) (-458.003) [-455.013] (-454.932) -- 0:00:58
107500 -- (-455.349) (-458.779) (-453.991) [-457.883] * (-454.582) [-457.324] (-456.029) (-457.344) -- 0:00:58
108000 -- [-457.481] (-459.041) (-455.311) (-457.313) * [-456.509] (-457.155) (-456.116) (-457.781) -- 0:00:57
108500 -- [-458.457] (-455.949) (-455.979) (-458.382) * (-454.409) [-454.219] (-455.263) (-454.138) -- 0:00:57
109000 -- (-456.280) (-456.059) (-458.031) [-456.562] * (-455.417) [-454.366] (-456.355) (-456.676) -- 0:00:57
109500 -- [-456.705] (-455.898) (-458.512) (-455.961) * [-459.720] (-455.359) (-455.441) (-453.968) -- 0:00:56
110000 -- (-455.681) (-456.470) (-454.442) [-457.273] * [-456.170] (-454.645) (-457.633) (-456.400) -- 0:00:56
Average standard deviation of split frequencies: 0.024493
110500 -- (-456.156) (-453.815) (-454.515) [-453.971] * (-460.378) [-454.521] (-454.972) (-456.063) -- 0:00:56
111000 -- (-456.222) [-456.068] (-454.650) (-456.714) * (-460.353) [-455.737] (-455.542) (-454.292) -- 0:00:56
111500 -- (-454.329) [-455.884] (-454.871) (-457.802) * (-456.850) (-455.240) (-458.153) [-455.159] -- 0:00:55
112000 -- (-460.640) (-457.379) [-455.746] (-455.795) * (-457.973) (-456.057) [-455.076] (-456.939) -- 0:00:55
112500 -- [-453.784] (-456.566) (-456.145) (-458.431) * (-457.279) (-454.084) [-461.273] (-455.577) -- 0:00:55
113000 -- (-457.818) [-458.090] (-456.543) (-455.761) * (-456.245) (-454.727) [-457.688] (-460.215) -- 0:00:54
113500 -- [-456.418] (-454.957) (-455.374) (-454.923) * (-457.061) [-456.197] (-457.427) (-455.271) -- 0:00:54
114000 -- [-455.766] (-463.177) (-455.425) (-454.562) * (-455.940) (-454.525) (-455.625) [-463.913] -- 0:00:54
114500 -- (-455.332) (-457.523) (-456.052) [-458.098] * (-455.834) [-458.326] (-457.315) (-458.445) -- 0:01:01
115000 -- (-455.350) [-456.260] (-458.104) (-454.778) * (-456.422) [-455.462] (-459.717) (-457.289) -- 0:01:01
Average standard deviation of split frequencies: 0.022148
115500 -- (-457.021) [-457.528] (-458.951) (-457.997) * (-456.126) (-454.474) (-457.325) [-456.586] -- 0:01:01
116000 -- (-459.007) (-456.314) (-457.969) [-454.070] * (-457.535) (-454.432) [-456.309] (-457.746) -- 0:01:00
116500 -- [-459.721] (-455.728) (-458.750) (-455.152) * [-455.777] (-457.392) (-457.117) (-454.528) -- 0:01:00
117000 -- (-456.062) (-455.597) (-456.892) [-455.990] * (-455.822) (-459.688) (-456.632) [-454.315] -- 0:01:00
117500 -- [-454.038] (-454.989) (-454.401) (-454.815) * (-455.451) (-460.377) (-455.524) [-455.690] -- 0:01:00
118000 -- (-453.755) (-456.656) [-454.657] (-454.752) * (-455.289) (-461.301) [-456.084] (-453.949) -- 0:00:59
118500 -- (-455.053) (-456.733) [-455.983] (-454.656) * (-455.597) [-461.480] (-455.594) (-458.467) -- 0:00:59
119000 -- [-455.923] (-454.131) (-454.999) (-454.740) * (-454.247) [-456.316] (-456.435) (-457.900) -- 0:00:59
119500 -- [-455.686] (-458.690) (-457.291) (-456.660) * [-455.329] (-461.446) (-458.908) (-458.032) -- 0:00:58
120000 -- (-455.237) [-455.207] (-455.762) (-455.114) * (-457.630) (-455.969) (-463.631) [-454.367] -- 0:00:58
Average standard deviation of split frequencies: 0.025176
120500 -- (-456.512) (-456.945) [-455.243] (-455.303) * [-456.791] (-455.379) (-466.923) (-457.081) -- 0:00:58
121000 -- [-454.289] (-456.775) (-455.435) (-460.688) * [-454.222] (-461.234) (-465.724) (-456.515) -- 0:00:58
121500 -- (-453.981) (-455.283) (-458.262) [-454.243] * (-454.913) (-458.544) [-459.498] (-454.536) -- 0:00:57
122000 -- (-455.370) (-455.859) [-456.941] (-454.781) * (-456.534) (-455.095) (-458.626) [-456.977] -- 0:00:57
122500 -- (-455.696) (-458.647) (-456.907) [-455.076] * (-458.212) [-453.945] (-458.086) (-457.852) -- 0:00:57
123000 -- (-458.205) (-460.825) (-455.776) [-455.520] * (-456.403) (-455.492) (-459.497) [-455.008] -- 0:00:57
123500 -- (-456.473) (-454.920) (-455.688) [-454.003] * (-454.791) (-454.755) (-454.839) [-458.081] -- 0:00:56
124000 -- (-455.743) [-455.550] (-455.611) (-458.606) * [-459.336] (-455.039) (-457.796) (-454.514) -- 0:00:56
124500 -- [-457.182] (-454.125) (-455.544) (-456.915) * [-455.058] (-455.463) (-457.335) (-456.648) -- 0:00:56
125000 -- (-458.186) [-454.457] (-455.332) (-458.686) * (-454.469) [-454.038] (-455.867) (-457.813) -- 0:00:56
Average standard deviation of split frequencies: 0.023629
125500 -- (-455.872) (-454.553) [-458.428] (-457.465) * (-456.108) (-455.477) [-457.713] (-453.902) -- 0:00:55
126000 -- [-455.099] (-457.629) (-456.224) (-455.360) * (-455.914) (-456.125) [-454.112] (-455.393) -- 0:00:55
126500 -- [-454.278] (-454.917) (-455.399) (-455.595) * (-459.563) (-455.270) [-454.696] (-456.343) -- 0:00:55
127000 -- [-459.586] (-455.179) (-454.585) (-456.524) * (-456.533) (-456.691) [-458.564] (-454.457) -- 0:00:54
127500 -- [-457.277] (-456.496) (-457.707) (-459.282) * (-464.446) (-455.466) (-463.072) [-455.161] -- 0:00:54
128000 -- (-455.618) [-454.916] (-460.030) (-454.111) * [-455.435] (-457.076) (-456.127) (-454.778) -- 0:00:54
128500 -- (-454.247) [-457.234] (-459.924) (-455.322) * (-456.366) [-457.425] (-457.092) (-460.891) -- 0:01:01
129000 -- (-454.586) [-456.767] (-456.834) (-455.725) * (-454.286) (-461.680) (-457.792) [-460.464] -- 0:01:00
129500 -- [-455.489] (-454.743) (-461.574) (-455.097) * (-457.654) [-453.712] (-456.765) (-457.802) -- 0:01:00
130000 -- (-456.241) (-457.052) (-455.323) [-455.029] * (-457.083) [-457.177] (-454.339) (-458.000) -- 0:01:00
Average standard deviation of split frequencies: 0.025064
130500 -- (-453.885) (-461.632) (-454.619) [-454.327] * (-457.703) [-457.831] (-454.791) (-454.237) -- 0:00:59
131000 -- (-454.931) (-459.868) (-454.526) [-461.145] * (-454.740) (-456.247) (-455.184) [-454.347] -- 0:00:59
131500 -- (-454.095) (-453.821) [-454.619] (-457.564) * (-456.901) [-456.516] (-454.459) (-456.516) -- 0:00:59
132000 -- (-455.834) [-453.782] (-455.335) (-457.306) * (-455.962) [-456.841] (-454.652) (-454.546) -- 0:00:59
132500 -- [-454.201] (-456.948) (-455.074) (-460.362) * (-457.249) [-454.508] (-455.196) (-458.884) -- 0:00:58
133000 -- [-455.518] (-455.372) (-454.990) (-462.362) * (-458.577) (-456.671) (-456.003) [-456.257] -- 0:00:58
133500 -- (-456.079) (-455.881) (-456.728) [-455.455] * (-455.882) [-459.243] (-455.525) (-456.454) -- 0:00:58
134000 -- (-455.864) (-459.531) (-457.429) [-456.574] * (-458.698) [-458.062] (-457.851) (-455.640) -- 0:00:58
134500 -- [-454.751] (-458.093) (-455.437) (-459.065) * (-459.049) (-459.839) [-456.917] (-454.800) -- 0:00:57
135000 -- [-454.025] (-459.322) (-455.134) (-457.500) * (-456.181) [-459.138] (-456.177) (-455.966) -- 0:00:57
Average standard deviation of split frequencies: 0.025034
135500 -- (-462.007) (-460.812) (-454.410) [-454.139] * [-454.682] (-457.229) (-453.840) (-457.948) -- 0:00:57
136000 -- (-463.832) [-455.177] (-458.516) (-460.757) * (-457.834) (-457.176) [-455.650] (-455.307) -- 0:00:57
136500 -- (-460.596) (-454.447) (-461.432) [-461.281] * [-456.449] (-455.614) (-454.367) (-455.553) -- 0:00:56
137000 -- (-456.021) (-456.847) [-460.711] (-457.683) * (-456.670) [-456.138] (-454.169) (-454.526) -- 0:00:56
137500 -- (-453.990) [-455.187] (-457.799) (-456.566) * (-456.023) (-454.957) [-454.499] (-455.158) -- 0:00:56
138000 -- (-454.360) [-453.863] (-458.694) (-457.407) * (-454.619) (-455.672) (-454.179) [-454.749] -- 0:00:56
138500 -- (-456.460) (-453.649) (-462.211) [-456.465] * (-456.716) [-456.309] (-455.990) (-455.560) -- 0:00:55
139000 -- [-456.403] (-454.769) (-459.294) (-457.286) * (-457.229) (-455.855) [-455.928] (-456.959) -- 0:00:55
139500 -- [-456.178] (-455.067) (-455.038) (-454.596) * (-460.958) (-458.431) [-456.585] (-456.672) -- 0:00:55
140000 -- (-456.159) (-454.788) (-460.340) [-455.088] * (-456.688) (-454.270) (-457.973) [-455.071] -- 0:00:55
Average standard deviation of split frequencies: 0.022276
140500 -- (-454.864) [-455.204] (-457.985) (-455.905) * [-455.866] (-453.962) (-455.422) (-454.146) -- 0:00:55
141000 -- (-455.334) (-454.724) [-456.946] (-459.387) * (-454.809) (-453.900) [-456.790] (-453.853) -- 0:00:54
141500 -- [-455.225] (-457.792) (-457.590) (-457.050) * (-453.738) (-455.800) (-456.058) [-457.345] -- 0:00:54
142000 -- (-456.270) (-455.221) [-456.030] (-462.587) * (-454.252) (-457.378) [-454.765] (-456.331) -- 0:00:54
142500 -- (-459.217) (-454.390) (-454.685) [-456.424] * (-455.999) (-454.966) [-456.531] (-456.109) -- 0:00:54
143000 -- [-456.670] (-453.860) (-454.565) (-460.285) * (-456.246) [-456.319] (-457.894) (-454.022) -- 0:00:53
143500 -- (-460.793) (-454.195) (-454.074) [-455.367] * (-457.934) (-457.930) (-459.767) [-454.318] -- 0:00:53
144000 -- (-455.390) [-456.116] (-460.228) (-454.059) * (-460.959) (-454.542) [-458.143] (-457.740) -- 0:00:53
144500 -- [-459.610] (-456.070) (-455.802) (-456.742) * (-467.174) [-455.055] (-455.411) (-454.694) -- 0:00:59
145000 -- (-457.075) (-455.326) [-455.163] (-458.119) * (-461.569) [-454.017] (-455.352) (-453.623) -- 0:00:58
Average standard deviation of split frequencies: 0.020341
145500 -- (-454.511) (-454.642) [-454.165] (-457.566) * [-455.874] (-453.954) (-457.202) (-457.027) -- 0:00:58
146000 -- (-455.504) [-454.891] (-455.566) (-457.865) * (-461.311) [-456.064] (-457.874) (-457.650) -- 0:00:58
146500 -- (-457.531) [-454.582] (-455.431) (-457.296) * (-455.944) (-454.960) (-456.383) [-454.355] -- 0:00:58
147000 -- (-455.033) (-457.580) (-454.863) [-457.008] * (-455.757) [-457.160] (-455.097) (-455.062) -- 0:00:58
147500 -- (-456.756) (-456.048) [-455.112] (-455.466) * [-454.707] (-456.371) (-456.620) (-459.619) -- 0:00:57
148000 -- (-456.969) (-455.543) [-455.496] (-454.696) * (-455.038) [-454.967] (-456.268) (-456.959) -- 0:00:57
148500 -- [-454.786] (-454.915) (-458.132) (-454.912) * (-454.036) (-456.449) (-454.923) [-456.056] -- 0:00:57
149000 -- (-453.938) (-457.785) (-457.104) [-454.410] * (-455.685) (-458.706) [-454.533] (-457.803) -- 0:00:57
149500 -- [-454.388] (-458.233) (-458.250) (-455.399) * (-455.187) (-456.469) [-459.830] (-457.560) -- 0:00:56
150000 -- [-456.389] (-454.781) (-457.099) (-455.478) * (-459.138) [-454.269] (-455.910) (-460.520) -- 0:00:56
Average standard deviation of split frequencies: 0.024335
150500 -- (-456.369) [-454.042] (-455.869) (-454.347) * (-460.695) (-455.677) (-455.471) [-455.092] -- 0:00:56
151000 -- (-459.315) (-454.346) [-454.502] (-456.248) * [-455.913] (-455.671) (-458.100) (-456.338) -- 0:00:56
151500 -- (-457.322) (-455.893) [-455.118] (-457.174) * (-457.481) [-456.333] (-455.587) (-460.131) -- 0:00:56
152000 -- (-460.654) (-457.338) [-454.664] (-457.705) * (-460.276) (-454.461) [-455.609] (-454.620) -- 0:00:55
152500 -- (-460.252) (-454.457) [-457.190] (-455.520) * (-460.414) (-457.885) [-454.647] (-458.122) -- 0:00:55
153000 -- (-461.754) [-455.105] (-457.961) (-455.349) * [-456.421] (-455.948) (-456.518) (-457.124) -- 0:00:55
153500 -- [-454.744] (-456.545) (-455.123) (-454.645) * [-454.851] (-460.608) (-458.300) (-459.856) -- 0:00:55
154000 -- [-454.279] (-456.096) (-458.508) (-454.494) * (-454.734) [-459.863] (-455.098) (-455.419) -- 0:00:54
154500 -- [-454.030] (-457.792) (-459.739) (-453.805) * (-455.356) [-454.328] (-456.409) (-455.761) -- 0:00:54
155000 -- (-454.108) [-459.733] (-454.508) (-455.277) * (-455.561) (-456.779) [-455.568] (-455.826) -- 0:00:54
Average standard deviation of split frequencies: 0.024708
155500 -- [-453.774] (-456.119) (-457.569) (-458.665) * (-457.777) (-456.376) (-458.025) [-455.555] -- 0:00:54
156000 -- (-461.922) [-455.134] (-458.980) (-455.768) * [-455.263] (-455.000) (-460.053) (-455.615) -- 0:00:54
156500 -- (-458.433) [-454.406] (-455.363) (-455.963) * (-459.066) (-457.322) (-455.137) [-455.698] -- 0:00:53
157000 -- (-455.944) (-454.909) (-455.557) [-460.150] * (-461.077) (-455.834) [-456.678] (-454.744) -- 0:00:53
157500 -- (-454.220) (-454.483) (-455.670) [-455.066] * [-455.733] (-454.655) (-461.204) (-457.232) -- 0:00:53
158000 -- (-457.197) (-454.902) [-455.191] (-454.361) * [-456.811] (-457.879) (-454.169) (-456.514) -- 0:00:53
158500 -- (-456.413) (-456.544) (-454.892) [-456.710] * (-455.937) (-454.232) [-455.164] (-456.927) -- 0:00:53
159000 -- (-455.828) (-455.460) [-455.317] (-456.348) * [-457.404] (-454.529) (-455.642) (-461.265) -- 0:00:52
159500 -- (-454.206) (-456.157) (-457.165) [-456.132] * (-455.861) (-458.567) (-456.588) [-458.119] -- 0:00:52
160000 -- [-456.189] (-456.111) (-457.593) (-456.930) * [-453.799] (-455.788) (-455.539) (-456.157) -- 0:00:52
Average standard deviation of split frequencies: 0.025198
160500 -- (-453.592) (-460.342) (-456.561) [-454.738] * (-457.726) [-456.486] (-453.960) (-455.398) -- 0:00:57
161000 -- [-454.420] (-455.646) (-458.520) (-455.973) * [-464.845] (-455.734) (-453.921) (-456.770) -- 0:00:57
161500 -- (-460.104) [-455.116] (-459.367) (-454.581) * [-457.951] (-458.161) (-455.920) (-456.316) -- 0:00:57
162000 -- (-454.857) (-455.246) (-455.609) [-455.305] * [-456.438] (-458.150) (-455.006) (-454.878) -- 0:00:56
162500 -- (-459.844) (-455.829) (-455.762) [-455.572] * (-454.977) (-454.849) (-455.458) [-455.946] -- 0:00:56
163000 -- (-457.280) [-456.514] (-455.425) (-455.056) * (-457.363) (-453.946) (-455.659) [-455.159] -- 0:00:56
163500 -- (-456.173) [-455.007] (-458.312) (-457.586) * (-454.435) (-455.072) (-456.385) [-456.306] -- 0:00:56
164000 -- (-456.859) [-454.874] (-456.597) (-456.643) * [-454.852] (-458.667) (-456.948) (-456.579) -- 0:00:56
164500 -- (-454.454) [-454.693] (-454.097) (-455.518) * [-453.935] (-456.649) (-454.575) (-456.848) -- 0:00:55
165000 -- (-455.622) (-456.543) [-453.858] (-454.314) * [-458.367] (-457.079) (-455.976) (-455.635) -- 0:00:55
Average standard deviation of split frequencies: 0.023002
165500 -- [-454.945] (-456.778) (-458.993) (-454.997) * (-455.729) [-455.916] (-457.156) (-456.581) -- 0:00:55
166000 -- (-458.034) [-454.159] (-460.041) (-455.599) * (-459.746) (-455.031) (-454.750) [-456.881] -- 0:00:55
166500 -- (-457.947) [-455.164] (-455.981) (-456.418) * [-454.306] (-453.686) (-457.912) (-456.492) -- 0:00:55
167000 -- (-456.029) (-454.580) [-461.670] (-457.552) * [-456.299] (-456.510) (-455.923) (-457.831) -- 0:00:54
167500 -- (-457.130) (-453.796) (-456.196) [-456.185] * (-454.563) (-457.186) (-457.863) [-458.144] -- 0:00:54
168000 -- (-455.845) [-454.024] (-457.392) (-455.249) * (-455.291) (-455.855) (-458.361) [-458.457] -- 0:00:54
168500 -- [-454.818] (-458.335) (-457.099) (-456.282) * [-454.454] (-457.876) (-454.053) (-457.134) -- 0:00:54
169000 -- (-453.692) (-454.800) [-458.567] (-458.010) * (-454.300) (-457.125) (-454.798) [-457.514] -- 0:00:54
169500 -- (-455.749) [-454.600] (-457.425) (-455.226) * (-454.824) [-454.186] (-455.474) (-455.212) -- 0:00:53
170000 -- (-458.186) (-456.477) [-455.402] (-453.979) * (-455.733) (-456.907) (-457.155) [-456.678] -- 0:00:53
Average standard deviation of split frequencies: 0.023115
170500 -- (-453.994) (-454.240) [-455.007] (-454.162) * (-456.012) (-455.691) (-457.846) [-456.486] -- 0:00:53
171000 -- [-456.202] (-458.905) (-454.244) (-454.003) * (-454.987) (-455.351) [-455.774] (-454.985) -- 0:00:53
171500 -- (-456.884) (-457.232) (-454.661) [-454.830] * (-455.526) [-454.878] (-457.202) (-455.961) -- 0:00:53
172000 -- (-456.105) (-455.145) (-455.073) [-459.463] * (-461.286) (-454.920) [-458.506] (-455.385) -- 0:00:52
172500 -- (-456.056) (-455.873) [-454.974] (-455.906) * (-454.663) (-456.043) (-454.582) [-455.098] -- 0:00:52
173000 -- (-456.636) (-455.878) (-456.327) [-456.879] * [-457.883] (-455.252) (-454.274) (-454.881) -- 0:00:52
173500 -- [-455.991] (-454.815) (-455.624) (-455.717) * [-455.511] (-455.199) (-454.425) (-455.327) -- 0:00:52
174000 -- [-454.719] (-456.767) (-455.610) (-455.088) * (-461.115) (-456.005) [-454.648] (-457.563) -- 0:00:52
174500 -- (-455.121) (-456.373) (-455.017) [-456.969] * (-454.550) (-456.976) [-455.644] (-458.241) -- 0:00:52
175000 -- [-454.807] (-458.637) (-455.293) (-454.927) * (-457.663) (-456.412) (-454.950) [-456.291] -- 0:00:51
Average standard deviation of split frequencies: 0.021900
175500 -- (-458.321) (-454.249) [-456.376] (-453.947) * (-454.388) (-458.186) (-455.244) [-455.574] -- 0:00:51
176000 -- (-456.135) (-454.688) [-454.747] (-454.541) * (-455.791) [-456.540] (-454.976) (-455.356) -- 0:00:56
176500 -- (-455.777) (-456.348) (-458.107) [-453.957] * [-455.129] (-457.434) (-454.800) (-456.831) -- 0:00:55
177000 -- (-459.641) (-455.348) [-454.611] (-456.377) * (-458.481) [-453.977] (-456.033) (-458.063) -- 0:00:55
177500 -- (-457.159) [-454.149] (-458.211) (-456.344) * (-455.286) [-455.949] (-456.434) (-457.789) -- 0:00:55
178000 -- [-453.829] (-455.420) (-456.320) (-458.591) * (-455.441) (-455.183) [-457.214] (-454.375) -- 0:00:55
178500 -- (-456.114) (-456.100) (-456.373) [-455.168] * (-454.973) [-457.776] (-455.070) (-455.194) -- 0:00:55
179000 -- [-456.140] (-457.111) (-454.593) (-454.665) * (-453.782) [-454.424] (-456.050) (-455.471) -- 0:00:55
179500 -- (-455.394) (-455.275) (-455.182) [-455.147] * (-454.850) (-455.234) [-454.355] (-456.671) -- 0:00:54
180000 -- (-455.058) [-456.648] (-456.292) (-455.888) * (-458.510) [-454.611] (-456.087) (-457.849) -- 0:00:54
Average standard deviation of split frequencies: 0.018990
180500 -- [-455.495] (-454.695) (-456.279) (-457.318) * (-461.581) (-454.809) (-455.931) [-454.258] -- 0:00:54
181000 -- (-457.144) [-457.958] (-458.763) (-454.580) * (-458.251) (-458.903) (-455.444) [-456.948] -- 0:00:54
181500 -- [-454.789] (-456.051) (-455.057) (-455.048) * (-457.347) (-455.165) (-455.686) [-454.444] -- 0:00:54
182000 -- (-455.099) (-455.174) (-456.381) [-456.163] * [-459.855] (-457.783) (-453.910) (-458.131) -- 0:00:53
182500 -- (-455.219) (-457.290) [-454.189] (-456.445) * [-457.761] (-459.607) (-458.398) (-454.431) -- 0:00:53
183000 -- [-455.317] (-460.428) (-457.969) (-457.032) * [-459.365] (-458.177) (-454.439) (-454.491) -- 0:00:53
183500 -- [-455.918] (-455.074) (-458.480) (-455.066) * (-455.803) (-454.641) [-457.591] (-459.002) -- 0:00:53
184000 -- (-454.439) (-463.889) (-456.281) [-454.593] * (-458.829) [-456.531] (-455.604) (-456.403) -- 0:00:53
184500 -- [-455.765] (-455.021) (-457.749) (-455.742) * (-454.111) (-456.111) (-459.493) [-457.837] -- 0:00:53
185000 -- (-457.549) (-455.479) [-456.910] (-457.790) * (-457.275) (-455.331) [-455.653] (-456.177) -- 0:00:52
Average standard deviation of split frequencies: 0.015460
185500 -- (-456.661) (-455.390) (-455.930) [-461.590] * [-457.928] (-455.919) (-454.761) (-454.964) -- 0:00:52
186000 -- (-458.658) [-456.032] (-459.712) (-457.967) * (-457.161) [-454.938] (-456.336) (-454.411) -- 0:00:52
186500 -- (-455.085) [-455.155] (-460.165) (-456.185) * (-454.454) (-455.738) (-455.364) [-454.416] -- 0:00:52
187000 -- [-454.312] (-456.537) (-458.449) (-456.733) * (-455.188) [-455.588] (-458.838) (-453.891) -- 0:00:52
187500 -- (-454.582) (-457.559) (-456.936) [-459.711] * [-456.393] (-455.472) (-458.642) (-456.850) -- 0:00:52
188000 -- (-456.290) (-454.418) [-454.854] (-457.487) * [-454.170] (-455.479) (-456.168) (-454.311) -- 0:00:51
188500 -- (-456.354) (-455.369) [-456.857] (-458.805) * (-460.545) (-456.568) [-457.380] (-457.687) -- 0:00:51
189000 -- (-461.946) (-455.762) [-455.829] (-455.071) * (-454.857) (-456.797) [-456.312] (-457.074) -- 0:00:51
189500 -- (-457.222) (-456.333) (-458.915) [-454.712] * [-454.372] (-454.032) (-455.838) (-456.991) -- 0:00:51
190000 -- (-455.343) (-457.329) (-457.787) [-456.498] * [-456.055] (-456.622) (-458.506) (-455.298) -- 0:00:51
Average standard deviation of split frequencies: 0.013671
190500 -- [-458.091] (-456.302) (-454.010) (-457.318) * (-456.669) [-454.567] (-454.327) (-457.693) -- 0:00:50
191000 -- [-455.246] (-455.059) (-454.320) (-458.113) * [-458.281] (-454.971) (-455.026) (-457.666) -- 0:00:55
191500 -- (-454.969) (-456.470) (-456.326) [-457.872] * (-458.287) (-455.613) [-456.098] (-454.087) -- 0:00:54
192000 -- (-458.127) (-458.398) [-455.166] (-456.844) * (-455.134) [-453.918] (-456.705) (-455.705) -- 0:00:54
192500 -- [-456.614] (-456.630) (-455.155) (-455.203) * (-456.012) (-458.421) (-458.274) [-457.035] -- 0:00:54
193000 -- (-458.423) (-454.253) (-455.628) [-455.016] * (-456.131) [-456.922] (-455.553) (-455.496) -- 0:00:54
193500 -- (-457.876) [-457.702] (-455.751) (-455.076) * (-456.092) (-455.456) (-455.076) [-455.494] -- 0:00:54
194000 -- [-454.096] (-458.178) (-456.781) (-454.081) * (-461.099) (-454.691) [-455.489] (-455.130) -- 0:00:54
194500 -- (-454.767) (-455.431) (-455.136) [-455.148] * (-459.895) (-456.344) (-454.871) [-455.758] -- 0:00:53
195000 -- (-456.121) (-457.840) [-455.567] (-455.184) * (-455.013) (-457.354) [-454.921] (-454.718) -- 0:00:53
Average standard deviation of split frequencies: 0.016694
195500 -- (-454.509) (-454.132) [-454.618] (-454.275) * (-454.047) (-456.857) (-454.446) [-456.274] -- 0:00:53
196000 -- (-455.753) (-456.178) (-455.099) [-455.551] * (-457.666) [-456.152] (-469.009) (-456.445) -- 0:00:53
196500 -- [-454.853] (-458.176) (-457.827) (-458.528) * (-458.428) [-457.568] (-458.110) (-454.246) -- 0:00:53
197000 -- [-455.523] (-456.446) (-455.505) (-456.046) * (-455.239) [-456.191] (-456.056) (-456.429) -- 0:00:52
197500 -- [-455.256] (-457.575) (-456.428) (-455.383) * (-456.947) (-454.624) [-456.871] (-457.292) -- 0:00:52
198000 -- (-455.722) [-455.066] (-460.247) (-456.814) * (-456.305) (-454.325) [-457.826] (-455.725) -- 0:00:52
198500 -- (-454.555) (-455.974) (-455.268) [-455.043] * (-454.467) (-456.210) [-455.729] (-460.411) -- 0:00:52
199000 -- (-455.544) [-454.797] (-454.201) (-454.981) * (-453.923) [-456.419] (-454.948) (-456.423) -- 0:00:52
199500 -- (-456.688) [-454.954] (-457.361) (-456.225) * (-454.168) (-456.621) [-456.258] (-454.941) -- 0:00:52
200000 -- (-461.723) (-455.239) [-455.918] (-457.253) * (-457.186) (-461.750) (-460.901) [-454.267] -- 0:00:51
Average standard deviation of split frequencies: 0.014878
200500 -- (-456.228) (-457.979) [-453.562] (-454.368) * [-455.465] (-456.714) (-454.320) (-456.208) -- 0:00:51
201000 -- (-455.292) [-459.487] (-456.122) (-454.687) * [-454.840] (-458.011) (-454.437) (-456.120) -- 0:00:51
201500 -- [-455.299] (-459.197) (-457.055) (-456.502) * [-457.318] (-455.106) (-456.556) (-457.283) -- 0:00:51
202000 -- (-461.629) (-455.980) (-455.698) [-461.486] * (-456.684) (-455.173) [-459.374] (-458.165) -- 0:00:51
202500 -- (-454.466) [-455.252] (-459.366) (-454.411) * (-456.503) [-455.663] (-457.795) (-458.068) -- 0:00:51
203000 -- [-453.831] (-455.205) (-455.421) (-456.210) * (-457.526) (-456.611) [-455.566] (-457.523) -- 0:00:51
203500 -- (-453.882) (-457.501) [-455.441] (-458.883) * (-458.305) (-457.254) [-455.731] (-459.789) -- 0:00:50
204000 -- (-454.233) (-455.018) (-456.988) [-457.821] * (-457.725) (-457.096) [-455.903] (-454.823) -- 0:00:50
204500 -- [-456.360] (-455.028) (-459.300) (-457.313) * (-453.558) [-456.253] (-454.106) (-454.747) -- 0:00:50
205000 -- (-459.177) (-454.233) (-456.819) [-453.927] * (-456.667) (-457.063) (-458.491) [-453.841] -- 0:00:50
Average standard deviation of split frequencies: 0.013008
205500 -- (-461.780) (-457.155) (-454.282) [-455.661] * (-454.597) (-456.560) (-457.931) [-455.179] -- 0:00:50
206000 -- (-457.701) (-453.943) [-458.081] (-454.724) * (-455.142) [-457.190] (-454.565) (-455.679) -- 0:00:50
206500 -- (-458.366) [-455.427] (-454.669) (-454.739) * (-456.406) (-461.703) [-454.929] (-457.090) -- 0:00:49
207000 -- (-456.061) [-454.257] (-454.517) (-453.807) * [-461.537] (-455.371) (-458.061) (-459.248) -- 0:00:53
207500 -- (-455.639) (-455.246) (-453.991) [-456.704] * (-457.917) (-455.824) (-463.634) [-454.123] -- 0:00:53
208000 -- (-455.714) (-456.741) [-457.235] (-455.694) * (-461.652) [-453.645] (-456.875) (-454.749) -- 0:00:53
208500 -- (-455.326) (-455.331) [-454.990] (-455.677) * (-455.902) (-453.980) (-454.166) [-455.653] -- 0:00:53
209000 -- (-454.685) (-456.155) [-455.907] (-456.164) * (-455.812) (-454.871) [-454.845] (-455.487) -- 0:00:52
209500 -- (-454.361) (-454.215) [-458.763] (-455.503) * (-457.575) [-458.232] (-454.973) (-456.943) -- 0:00:52
210000 -- (-457.387) (-454.405) [-454.490] (-458.847) * (-455.133) (-455.717) (-454.824) [-454.145] -- 0:00:52
Average standard deviation of split frequencies: 0.013675
210500 -- (-456.425) [-453.948] (-454.262) (-455.278) * (-454.769) (-456.113) (-454.540) [-455.995] -- 0:00:52
211000 -- [-454.852] (-456.078) (-456.795) (-457.506) * (-458.925) [-456.144] (-456.343) (-459.726) -- 0:00:52
211500 -- (-460.964) (-454.747) [-457.348] (-456.782) * (-455.932) (-456.772) [-457.491] (-457.589) -- 0:00:52
212000 -- (-458.542) (-457.262) [-454.522] (-459.391) * (-455.197) [-454.302] (-454.993) (-460.010) -- 0:00:52
212500 -- [-454.586] (-456.357) (-456.430) (-454.470) * [-464.870] (-455.762) (-454.221) (-456.823) -- 0:00:51
213000 -- [-457.145] (-455.100) (-456.398) (-456.489) * (-459.083) [-454.912] (-460.338) (-458.869) -- 0:00:51
213500 -- (-456.694) [-454.648] (-454.880) (-464.844) * (-457.055) (-454.462) [-455.988] (-458.990) -- 0:00:51
214000 -- (-457.718) (-456.773) [-456.798] (-459.646) * (-455.716) (-456.610) [-455.579] (-454.701) -- 0:00:51
214500 -- (-460.274) (-453.832) (-457.430) [-454.287] * (-457.219) [-456.432] (-455.713) (-457.965) -- 0:00:51
215000 -- (-455.768) (-454.485) [-455.776] (-458.084) * (-456.125) (-455.065) [-458.787] (-455.060) -- 0:00:51
Average standard deviation of split frequencies: 0.013337
215500 -- (-454.460) [-455.783] (-458.185) (-456.387) * [-457.703] (-457.001) (-454.665) (-454.858) -- 0:00:50
216000 -- [-453.820] (-456.171) (-457.096) (-456.841) * (-458.213) [-454.315] (-453.672) (-455.272) -- 0:00:50
216500 -- (-455.494) (-455.178) [-458.109] (-455.928) * (-457.050) (-455.549) [-454.047] (-457.588) -- 0:00:50
217000 -- (-456.746) (-454.458) [-456.051] (-463.378) * [-455.433] (-455.088) (-454.297) (-457.300) -- 0:00:50
217500 -- (-459.668) [-455.154] (-455.388) (-457.741) * (-454.193) (-455.217) [-454.378] (-457.509) -- 0:00:50
218000 -- (-455.989) (-454.668) (-456.532) [-456.296] * (-455.640) [-458.771] (-454.346) (-457.080) -- 0:00:50
218500 -- (-455.462) (-456.154) [-456.623] (-456.999) * [-457.595] (-458.528) (-455.439) (-456.438) -- 0:00:50
219000 -- (-458.754) (-457.553) (-454.622) [-454.160] * (-453.926) (-454.791) [-454.682] (-458.187) -- 0:00:49
219500 -- (-461.826) [-454.700] (-454.955) (-454.247) * (-454.886) (-455.105) [-453.940] (-459.415) -- 0:00:49
220000 -- (-455.446) (-455.549) (-456.783) [-455.696] * [-455.063] (-455.766) (-455.472) (-455.933) -- 0:00:49
Average standard deviation of split frequencies: 0.012818
220500 -- (-454.570) [-455.080] (-453.938) (-455.150) * (-458.683) [-454.096] (-456.690) (-458.748) -- 0:00:49
221000 -- (-454.269) [-455.088] (-454.578) (-453.669) * [-456.890] (-453.816) (-455.502) (-457.431) -- 0:00:49
221500 -- (-455.429) [-454.472] (-454.746) (-455.890) * [-456.301] (-456.808) (-454.423) (-456.396) -- 0:00:49
222000 -- [-454.452] (-456.809) (-455.696) (-456.142) * (-457.877) (-456.249) [-455.392] (-459.117) -- 0:00:52
222500 -- [-453.967] (-455.876) (-455.491) (-454.604) * (-454.789) (-456.260) (-454.542) [-461.122] -- 0:00:52
223000 -- (-454.974) [-456.028] (-454.974) (-455.271) * (-456.294) (-456.310) (-455.711) [-455.192] -- 0:00:52
223500 -- (-455.737) (-454.546) [-454.047] (-459.003) * (-455.088) (-457.615) (-455.880) [-454.946] -- 0:00:52
224000 -- (-455.977) [-454.775] (-456.454) (-459.485) * [-455.928] (-457.286) (-461.170) (-458.874) -- 0:00:51
224500 -- (-454.303) (-458.598) (-453.834) [-456.475] * (-455.294) (-457.922) [-458.109] (-458.587) -- 0:00:51
225000 -- [-454.732] (-454.569) (-456.133) (-454.247) * (-454.718) (-457.627) (-460.692) [-455.283] -- 0:00:51
Average standard deviation of split frequencies: 0.011588
225500 -- (-456.268) [-454.263] (-454.465) (-456.476) * (-456.051) (-456.955) [-456.203] (-456.583) -- 0:00:51
226000 -- (-454.769) [-457.852] (-455.898) (-455.045) * (-456.421) (-458.690) [-455.973] (-459.540) -- 0:00:51
226500 -- [-456.215] (-454.173) (-455.140) (-455.515) * (-454.543) [-456.079] (-458.376) (-455.607) -- 0:00:51
227000 -- [-458.098] (-457.943) (-456.089) (-453.886) * [-454.679] (-454.395) (-456.875) (-454.740) -- 0:00:51
227500 -- (-455.251) (-455.440) (-457.285) [-455.848] * [-453.992] (-454.086) (-454.961) (-455.596) -- 0:00:50
228000 -- [-454.971] (-456.961) (-459.801) (-457.187) * [-463.863] (-456.460) (-461.412) (-454.569) -- 0:00:50
228500 -- (-454.535) (-455.528) [-458.769] (-456.828) * [-455.384] (-455.347) (-457.485) (-456.942) -- 0:00:50
229000 -- (-456.637) [-456.825] (-454.678) (-457.696) * (-457.951) [-454.581] (-457.014) (-456.763) -- 0:00:50
229500 -- [-454.784] (-456.380) (-457.836) (-455.967) * (-455.721) (-457.002) (-455.480) [-454.050] -- 0:00:50
230000 -- (-458.678) (-457.202) [-454.884] (-457.285) * (-454.802) [-455.020] (-456.888) (-455.744) -- 0:00:50
Average standard deviation of split frequencies: 0.011901
230500 -- (-457.900) (-456.999) (-456.592) [-456.143] * (-457.774) (-456.573) (-454.682) [-454.631] -- 0:00:50
231000 -- (-456.112) [-456.325] (-456.211) (-455.473) * (-456.917) [-454.330] (-456.853) (-454.535) -- 0:00:49
231500 -- (-459.126) [-455.747] (-460.340) (-459.094) * (-461.589) (-455.769) [-456.433] (-455.088) -- 0:00:49
232000 -- (-457.037) (-453.578) [-455.867] (-458.943) * [-458.790] (-454.950) (-458.600) (-462.143) -- 0:00:49
232500 -- (-455.333) (-458.519) (-458.921) [-455.898] * (-458.102) (-456.589) [-454.451] (-457.317) -- 0:00:49
233000 -- (-456.529) [-453.706] (-456.418) (-458.531) * [-458.226] (-454.565) (-455.178) (-455.314) -- 0:00:49
233500 -- [-455.583] (-455.663) (-457.250) (-456.933) * (-454.474) [-457.044] (-457.994) (-454.674) -- 0:00:49
234000 -- [-454.821] (-455.727) (-455.580) (-455.268) * (-455.891) (-455.702) [-455.577] (-454.715) -- 0:00:49
234500 -- (-457.219) [-454.526] (-459.254) (-457.314) * (-456.634) [-456.045] (-456.008) (-455.852) -- 0:00:48
235000 -- [-456.481] (-454.977) (-456.661) (-460.673) * (-453.862) (-454.597) (-456.008) [-456.496] -- 0:00:48
Average standard deviation of split frequencies: 0.011632
235500 -- (-456.485) [-456.761] (-454.454) (-454.977) * [-454.541] (-457.416) (-455.028) (-455.449) -- 0:00:51
236000 -- (-454.925) [-456.677] (-454.960) (-456.420) * [-454.823] (-456.685) (-454.556) (-458.558) -- 0:00:51
236500 -- (-457.978) (-456.564) [-455.108] (-454.221) * (-454.755) (-457.438) [-455.895] (-459.052) -- 0:00:51
237000 -- (-456.946) (-458.957) [-454.073] (-454.461) * (-455.470) [-454.916] (-454.687) (-454.781) -- 0:00:51
237500 -- (-458.282) (-458.010) [-455.792] (-456.924) * (-455.444) (-454.767) [-455.890] (-456.500) -- 0:00:51
238000 -- [-454.488] (-455.121) (-454.589) (-456.085) * (-459.060) (-455.593) (-458.940) [-455.147] -- 0:00:51
238500 -- [-455.080] (-454.792) (-454.636) (-456.011) * (-455.362) (-457.688) [-456.779] (-454.211) -- 0:00:51
239000 -- (-456.258) (-454.568) [-457.361] (-454.522) * (-455.463) (-456.943) (-457.200) [-454.912] -- 0:00:50
239500 -- [-453.720] (-454.111) (-455.829) (-456.126) * (-455.310) [-454.874] (-457.461) (-454.706) -- 0:00:50
240000 -- [-453.618] (-453.978) (-456.652) (-457.469) * (-455.792) (-455.139) (-454.774) [-456.654] -- 0:00:50
Average standard deviation of split frequencies: 0.011407
240500 -- (-454.162) (-454.410) (-455.109) [-456.611] * [-456.125] (-456.045) (-457.428) (-457.657) -- 0:00:50
241000 -- (-454.263) (-456.409) [-454.687] (-456.836) * [-457.175] (-455.811) (-459.916) (-455.451) -- 0:00:50
241500 -- (-456.514) (-454.705) [-454.952] (-458.887) * [-457.250] (-456.071) (-459.170) (-454.447) -- 0:00:50
242000 -- (-455.547) [-454.477] (-457.393) (-455.330) * [-455.639] (-456.489) (-456.324) (-454.476) -- 0:00:50
242500 -- [-458.297] (-460.489) (-456.778) (-454.899) * (-457.204) (-457.600) (-455.545) [-454.948] -- 0:00:49
243000 -- (-459.253) [-455.516] (-456.517) (-455.925) * [-454.738] (-458.286) (-455.863) (-455.208) -- 0:00:49
243500 -- (-454.365) (-455.731) (-455.961) [-455.743] * (-456.052) (-457.658) [-455.763] (-455.758) -- 0:00:49
244000 -- (-459.927) [-455.098] (-455.932) (-457.282) * (-455.676) (-455.076) [-455.611] (-455.644) -- 0:00:49
244500 -- (-458.418) (-456.318) [-454.008] (-458.615) * (-456.920) (-456.636) [-456.540] (-454.408) -- 0:00:49
245000 -- (-456.854) (-454.779) (-457.474) [-456.478] * (-457.921) (-456.639) [-455.006] (-454.344) -- 0:00:49
Average standard deviation of split frequencies: 0.009222
245500 -- (-460.086) [-454.796] (-456.888) (-455.941) * (-461.778) [-456.473] (-454.729) (-459.311) -- 0:00:49
246000 -- (-456.053) [-458.021] (-462.628) (-454.143) * (-459.821) [-454.449] (-455.731) (-460.694) -- 0:00:49
246500 -- (-456.656) [-458.209] (-457.302) (-454.146) * [-454.752] (-455.317) (-455.455) (-454.114) -- 0:00:48
247000 -- (-455.888) (-455.907) (-458.256) [-456.792] * [-454.722] (-455.058) (-457.451) (-456.237) -- 0:00:48
247500 -- [-456.166] (-454.350) (-459.252) (-456.730) * [-454.469] (-456.720) (-455.440) (-458.918) -- 0:00:48
248000 -- (-456.758) (-460.593) [-457.472] (-456.135) * [-457.392] (-455.836) (-454.554) (-454.819) -- 0:00:48
248500 -- (-455.748) (-457.542) (-454.799) [-454.923] * (-455.658) [-454.380] (-457.127) (-454.894) -- 0:00:48
249000 -- (-456.645) (-455.826) [-454.848] (-459.914) * (-456.788) [-456.599] (-454.195) (-455.481) -- 0:00:48
249500 -- (-455.804) [-455.888] (-455.653) (-457.723) * (-454.082) (-456.736) [-457.752] (-454.348) -- 0:00:48
250000 -- [-456.112] (-456.634) (-457.509) (-455.259) * [-454.394] (-459.314) (-456.955) (-455.229) -- 0:00:48
Average standard deviation of split frequencies: 0.007640
250500 -- (-454.585) (-458.792) (-454.020) [-456.190] * (-453.789) (-456.325) [-457.248] (-455.614) -- 0:00:47
251000 -- (-455.821) (-454.418) (-454.197) [-459.036] * [-460.290] (-456.928) (-454.647) (-455.013) -- 0:00:47
251500 -- (-455.035) [-462.302] (-454.921) (-456.433) * (-456.527) (-457.831) (-464.407) [-455.135] -- 0:00:50
252000 -- [-454.879] (-459.444) (-455.011) (-456.552) * [-455.308] (-453.828) (-465.493) (-456.687) -- 0:00:50
252500 -- [-454.705] (-455.187) (-455.308) (-454.662) * [-454.502] (-455.515) (-458.256) (-456.521) -- 0:00:50
253000 -- (-460.840) (-457.625) (-456.614) [-457.383] * (-454.450) [-454.354] (-456.279) (-455.443) -- 0:00:50
253500 -- (-458.660) [-454.797] (-455.840) (-458.092) * (-457.045) (-455.238) (-455.419) [-455.942] -- 0:00:50
254000 -- (-455.766) [-454.387] (-455.592) (-455.488) * (-454.042) (-454.330) (-455.025) [-455.526] -- 0:00:49
254500 -- (-457.279) [-455.922] (-455.025) (-455.134) * (-454.626) [-454.760] (-454.141) (-456.331) -- 0:00:49
255000 -- (-462.516) (-458.548) (-456.152) [-455.924] * (-455.056) (-455.149) [-453.993] (-456.440) -- 0:00:49
Average standard deviation of split frequencies: 0.006875
255500 -- (-455.782) [-455.601] (-462.430) (-456.882) * [-454.742] (-455.588) (-454.380) (-455.634) -- 0:00:49
256000 -- [-454.214] (-458.541) (-457.836) (-458.235) * (-457.024) (-455.771) [-454.479] (-456.430) -- 0:00:49
256500 -- (-456.717) (-455.329) [-454.591] (-457.381) * (-455.404) (-457.547) [-455.307] (-455.873) -- 0:00:49
257000 -- [-454.746] (-459.936) (-455.345) (-456.805) * (-454.976) (-454.800) (-455.243) [-455.931] -- 0:00:49
257500 -- [-456.188] (-455.055) (-458.708) (-457.018) * (-455.658) [-455.184] (-457.211) (-457.040) -- 0:00:49
258000 -- (-456.574) (-455.396) [-454.484] (-455.694) * (-457.615) [-455.021] (-454.392) (-455.099) -- 0:00:48
258500 -- (-457.157) (-456.194) [-454.328] (-454.796) * (-456.703) (-456.172) (-453.998) [-456.436] -- 0:00:48
259000 -- [-455.373] (-454.190) (-455.075) (-454.605) * [-455.730] (-456.170) (-455.148) (-456.808) -- 0:00:48
259500 -- (-457.910) (-455.834) (-455.531) [-455.946] * (-459.154) (-456.696) [-455.033] (-455.528) -- 0:00:48
260000 -- [-454.551] (-456.137) (-454.849) (-455.119) * (-454.725) (-454.584) (-455.604) [-457.972] -- 0:00:48
Average standard deviation of split frequencies: 0.006993
260500 -- [-454.985] (-456.314) (-455.168) (-457.268) * [-456.060] (-454.110) (-458.111) (-457.409) -- 0:00:48
261000 -- (-456.601) (-455.818) [-457.391] (-457.835) * (-461.681) (-458.619) (-456.316) [-454.165] -- 0:00:48
261500 -- (-455.802) [-453.800] (-454.023) (-455.142) * (-456.583) [-455.749] (-459.708) (-455.495) -- 0:00:48
262000 -- (-456.686) [-454.724] (-454.770) (-458.851) * (-454.884) (-458.390) (-457.561) [-455.785] -- 0:00:47
262500 -- (-456.500) (-455.772) [-453.896] (-454.605) * (-456.175) (-455.034) (-456.249) [-456.649] -- 0:00:47
263000 -- (-459.390) [-454.729] (-454.932) (-456.524) * (-454.040) (-459.735) [-454.922] (-455.881) -- 0:00:47
263500 -- (-459.721) [-454.242] (-454.931) (-459.277) * (-454.669) (-461.103) [-454.436] (-456.645) -- 0:00:47
264000 -- [-454.612] (-454.578) (-458.376) (-455.458) * (-457.086) (-454.342) [-454.117] (-455.731) -- 0:00:47
264500 -- (-454.482) (-457.989) [-457.034] (-454.260) * (-455.611) (-457.900) [-454.307] (-458.551) -- 0:00:47
265000 -- (-455.949) (-457.839) (-455.288) [-454.469] * (-458.928) [-456.838] (-456.223) (-460.694) -- 0:00:47
Average standard deviation of split frequencies: 0.007193
265500 -- [-455.573] (-455.428) (-454.945) (-457.852) * (-457.392) (-456.572) (-460.085) [-454.341] -- 0:00:47
266000 -- (-455.952) [-455.025] (-454.089) (-453.942) * [-455.831] (-459.020) (-458.343) (-456.796) -- 0:00:46
266500 -- (-458.393) [-456.328] (-457.160) (-454.793) * [-455.545] (-459.390) (-456.937) (-455.336) -- 0:00:46
267000 -- (-456.230) (-456.327) (-456.629) [-455.716] * (-458.205) (-456.129) [-459.709] (-455.731) -- 0:00:46
267500 -- [-456.278] (-455.160) (-455.921) (-454.682) * (-459.807) (-456.072) [-454.895] (-455.381) -- 0:00:49
268000 -- (-455.382) (-455.306) [-455.310] (-456.570) * (-461.141) (-454.512) (-454.490) [-458.187] -- 0:00:49
268500 -- (-455.968) (-455.739) [-455.816] (-455.690) * [-456.209] (-455.694) (-454.708) (-458.831) -- 0:00:49
269000 -- (-456.277) (-457.572) (-455.070) [-456.069] * [-455.382] (-456.674) (-458.443) (-458.592) -- 0:00:48
269500 -- (-456.438) (-460.042) [-456.673] (-462.601) * [-458.631] (-456.338) (-457.607) (-458.160) -- 0:00:48
270000 -- [-456.834] (-457.265) (-461.335) (-458.561) * (-456.689) (-456.762) [-456.142] (-454.921) -- 0:00:48
Average standard deviation of split frequencies: 0.007069
270500 -- (-455.039) (-458.548) (-454.104) [-455.170] * (-454.812) [-457.147] (-454.222) (-455.907) -- 0:00:48
271000 -- [-454.801] (-454.642) (-458.346) (-455.880) * (-455.506) [-456.578] (-458.534) (-457.753) -- 0:00:48
271500 -- (-454.507) (-456.437) (-456.170) [-458.204] * (-457.091) (-455.084) [-454.604] (-456.834) -- 0:00:48
272000 -- (-455.869) [-454.158] (-454.213) (-458.906) * (-459.061) (-456.206) (-457.525) [-454.188] -- 0:00:48
272500 -- (-457.496) (-453.848) (-454.281) [-453.955] * (-458.270) [-456.584] (-455.567) (-454.117) -- 0:00:48
273000 -- (-456.420) (-455.901) (-456.449) [-454.188] * (-454.976) (-459.656) (-456.029) [-454.117] -- 0:00:47
273500 -- (-458.689) (-459.608) [-458.163] (-454.600) * [-456.127] (-456.623) (-457.232) (-455.916) -- 0:00:47
274000 -- [-456.603] (-455.156) (-455.214) (-455.253) * [-457.565] (-457.874) (-459.414) (-456.360) -- 0:00:47
274500 -- (-457.076) (-454.798) (-460.167) [-457.099] * (-456.709) (-457.771) [-457.887] (-456.408) -- 0:00:47
275000 -- [-459.782] (-456.559) (-454.752) (-454.426) * (-455.771) (-458.059) [-456.580] (-459.288) -- 0:00:47
Average standard deviation of split frequencies: 0.007033
275500 -- (-457.529) [-454.746] (-455.484) (-457.236) * (-458.831) [-453.856] (-454.566) (-457.796) -- 0:00:47
276000 -- (-455.326) (-454.671) (-456.056) [-456.623] * (-455.724) [-457.046] (-455.680) (-457.517) -- 0:00:47
276500 -- (-455.590) (-457.692) [-454.590] (-456.292) * (-455.393) (-456.355) (-455.964) [-455.822] -- 0:00:47
277000 -- (-459.006) (-459.692) (-457.164) [-455.209] * (-457.382) (-454.541) (-455.070) [-457.726] -- 0:00:46
277500 -- (-456.073) (-460.671) [-456.696] (-457.225) * (-460.208) [-453.977] (-457.099) (-461.467) -- 0:00:46
278000 -- (-454.342) (-454.924) [-455.555] (-456.298) * (-455.507) (-455.437) [-456.308] (-463.454) -- 0:00:46
278500 -- (-454.514) (-455.785) [-454.226] (-454.414) * (-456.466) (-456.078) (-458.266) [-458.084] -- 0:00:46
279000 -- [-454.531] (-455.136) (-455.218) (-456.569) * (-454.750) [-455.882] (-457.604) (-454.396) -- 0:00:46
279500 -- (-456.317) [-456.119] (-458.078) (-454.752) * (-455.911) (-454.105) [-456.383] (-457.735) -- 0:00:46
280000 -- [-454.673] (-456.850) (-455.761) (-456.271) * (-457.148) [-454.774] (-457.904) (-457.447) -- 0:00:46
Average standard deviation of split frequencies: 0.006323
280500 -- (-457.190) (-454.987) [-457.337] (-456.675) * (-454.623) (-455.265) (-456.404) [-456.045] -- 0:00:46
281000 -- (-458.595) (-453.919) [-455.687] (-454.601) * (-457.697) [-454.668] (-458.362) (-454.596) -- 0:00:46
281500 -- [-453.905] (-454.675) (-454.422) (-454.519) * (-457.410) [-455.502] (-456.963) (-453.992) -- 0:00:48
282000 -- (-455.653) [-454.658] (-459.362) (-456.820) * [-457.033] (-457.870) (-455.500) (-454.615) -- 0:00:48
282500 -- (-454.861) (-457.283) [-456.776] (-459.516) * (-457.130) (-457.569) (-458.142) [-457.658] -- 0:00:48
283000 -- (-456.484) (-454.319) (-455.854) [-455.493] * (-455.671) (-453.995) (-455.773) [-455.190] -- 0:00:48
283500 -- (-454.700) (-455.758) (-462.984) [-457.434] * (-454.557) (-456.493) [-455.408] (-457.438) -- 0:00:48
284000 -- (-455.095) (-456.743) (-458.958) [-459.896] * (-455.779) [-455.557] (-454.091) (-457.692) -- 0:00:47
284500 -- (-456.522) (-456.273) (-458.073) [-455.639] * (-456.441) [-456.449] (-458.932) (-454.626) -- 0:00:47
285000 -- (-454.680) (-454.571) (-457.487) [-457.318] * [-456.432] (-458.948) (-455.288) (-455.079) -- 0:00:47
Average standard deviation of split frequencies: 0.006302
285500 -- (-455.017) (-454.287) (-458.561) [-457.425] * (-454.155) (-456.063) (-456.078) [-456.670] -- 0:00:47
286000 -- (-455.475) (-454.513) [-455.130] (-455.738) * (-454.714) [-454.333] (-455.771) (-454.423) -- 0:00:47
286500 -- (-456.476) (-455.255) (-454.843) [-455.298] * (-456.424) (-454.679) (-453.812) [-454.144] -- 0:00:47
287000 -- [-456.758] (-454.413) (-456.147) (-454.982) * (-458.187) (-454.622) (-457.625) [-455.174] -- 0:00:47
287500 -- (-454.721) (-456.819) (-459.715) [-457.265] * (-454.948) (-457.369) [-455.084] (-455.876) -- 0:00:47
288000 -- [-456.933] (-455.696) (-465.760) (-454.114) * [-453.639] (-456.914) (-454.699) (-455.203) -- 0:00:46
288500 -- (-458.960) (-456.387) (-457.587) [-454.680] * (-455.903) (-456.283) (-458.062) [-455.087] -- 0:00:46
289000 -- [-455.181] (-455.587) (-454.788) (-454.295) * (-457.708) (-456.285) [-457.689] (-456.311) -- 0:00:46
289500 -- (-458.000) (-454.207) (-455.272) [-456.814] * (-457.640) (-454.430) (-457.435) [-455.356] -- 0:00:46
290000 -- (-455.364) [-455.527] (-457.347) (-454.620) * [-457.014] (-454.038) (-458.030) (-454.663) -- 0:00:46
Average standard deviation of split frequencies: 0.006296
290500 -- (-456.905) (-455.784) [-455.328] (-455.153) * (-454.430) (-457.268) [-455.437] (-453.993) -- 0:00:46
291000 -- [-454.959] (-454.694) (-454.382) (-454.700) * (-455.429) (-455.269) (-456.407) [-454.107] -- 0:00:46
291500 -- [-455.769] (-455.590) (-455.091) (-454.947) * (-454.915) (-455.134) [-455.497] (-454.055) -- 0:00:46
292000 -- [-456.344] (-454.542) (-454.784) (-454.212) * (-454.737) (-454.258) [-456.184] (-455.601) -- 0:00:46
292500 -- (-454.038) (-460.379) (-456.652) [-457.700] * (-454.912) (-458.018) [-458.735] (-457.325) -- 0:00:45
293000 -- (-458.176) [-454.161] (-454.846) (-453.995) * (-454.973) (-457.520) [-455.918] (-456.172) -- 0:00:45
293500 -- [-455.865] (-456.069) (-456.195) (-456.807) * [-454.600] (-455.612) (-456.602) (-454.585) -- 0:00:45
294000 -- [-457.448] (-454.244) (-454.762) (-454.088) * (-456.847) (-457.092) [-457.882] (-458.801) -- 0:00:45
294500 -- (-463.402) (-455.412) (-454.795) [-454.636] * (-456.658) (-455.268) [-455.241] (-457.338) -- 0:00:45
295000 -- [-456.293] (-456.635) (-454.863) (-455.653) * [-456.480] (-454.984) (-454.485) (-459.545) -- 0:00:45
Average standard deviation of split frequencies: 0.006464
295500 -- [-456.985] (-456.893) (-455.070) (-454.966) * [-456.959] (-456.338) (-456.067) (-457.847) -- 0:00:45
296000 -- (-457.436) [-454.806] (-456.299) (-459.547) * (-455.712) (-457.505) [-455.350] (-455.231) -- 0:00:45
296500 -- (-454.731) [-455.545] (-455.827) (-460.978) * (-454.919) [-455.339] (-456.083) (-460.182) -- 0:00:47
297000 -- [-456.278] (-455.873) (-457.467) (-456.208) * [-458.786] (-458.343) (-464.389) (-456.517) -- 0:00:47
297500 -- (-458.642) (-454.273) (-457.258) [-457.960] * (-454.615) (-455.787) (-463.901) [-456.122] -- 0:00:47
298000 -- [-457.623] (-456.646) (-456.499) (-457.166) * [-458.566] (-454.009) (-458.767) (-454.842) -- 0:00:47
298500 -- [-456.110] (-454.421) (-456.071) (-461.196) * (-457.349) [-455.602] (-453.745) (-456.854) -- 0:00:47
299000 -- (-454.034) [-456.351] (-456.176) (-453.554) * [-456.077] (-454.331) (-460.443) (-454.312) -- 0:00:46
299500 -- (-456.173) (-454.757) [-456.348] (-453.859) * (-454.433) (-456.721) (-461.167) [-458.016] -- 0:00:46
300000 -- (-453.934) (-455.929) [-454.845] (-454.848) * (-455.179) (-464.993) [-456.401] (-457.196) -- 0:00:46
Average standard deviation of split frequencies: 0.007563
300500 -- (-454.842) (-455.935) (-455.368) [-455.190] * (-458.366) [-460.261] (-454.716) (-461.899) -- 0:00:46
301000 -- (-458.810) (-455.940) (-454.847) [-456.419] * (-454.526) (-458.768) [-455.092] (-455.806) -- 0:00:46
301500 -- (-455.428) (-456.029) (-454.687) [-454.845] * (-455.629) (-458.869) (-458.288) [-455.123] -- 0:00:46
302000 -- [-456.085] (-455.459) (-456.313) (-455.456) * (-453.823) (-462.499) [-454.387] (-454.833) -- 0:00:46
302500 -- (-454.289) (-454.822) [-457.682] (-455.904) * [-454.937] (-460.276) (-455.797) (-458.906) -- 0:00:46
303000 -- [-455.864] (-457.621) (-454.644) (-456.828) * (-455.613) (-454.251) [-456.603] (-457.814) -- 0:00:46
303500 -- (-456.493) [-455.155] (-454.116) (-456.407) * (-455.581) [-454.871] (-455.634) (-454.878) -- 0:00:45
304000 -- [-454.703] (-453.851) (-454.899) (-455.978) * (-457.663) [-457.006] (-456.046) (-455.034) -- 0:00:45
304500 -- [-456.067] (-454.537) (-454.770) (-461.385) * (-457.151) [-453.763] (-455.158) (-454.649) -- 0:00:45
305000 -- (-453.957) (-455.339) [-455.719] (-459.115) * (-459.262) (-455.737) [-457.051] (-453.883) -- 0:00:45
Average standard deviation of split frequencies: 0.008609
305500 -- (-455.374) [-456.491] (-459.236) (-455.958) * [-456.513] (-457.177) (-454.326) (-456.105) -- 0:00:45
306000 -- (-457.621) (-455.073) [-455.529] (-459.410) * (-457.076) [-454.925] (-454.852) (-457.164) -- 0:00:45
306500 -- (-455.163) (-454.182) [-457.526] (-455.517) * (-454.253) (-459.218) (-454.035) [-454.900] -- 0:00:45
307000 -- (-453.647) (-455.894) (-456.494) [-455.771] * (-455.663) [-455.164] (-453.579) (-458.392) -- 0:00:45
307500 -- (-463.359) [-457.003] (-455.942) (-459.424) * [-454.954] (-456.150) (-455.224) (-463.002) -- 0:00:45
308000 -- [-454.228] (-454.360) (-455.936) (-454.739) * (-458.604) (-454.718) [-455.849] (-454.274) -- 0:00:44
308500 -- (-456.403) (-453.609) (-454.737) [-455.628] * (-454.177) (-457.770) [-453.979] (-458.884) -- 0:00:44
309000 -- (-455.305) (-453.900) (-457.343) [-456.867] * (-454.476) (-456.261) [-456.028] (-455.761) -- 0:00:44
309500 -- (-456.134) (-453.953) [-455.219] (-455.083) * [-456.863] (-454.134) (-456.135) (-454.434) -- 0:00:44
310000 -- (-455.041) (-454.436) [-456.017] (-456.589) * (-458.842) (-454.462) (-455.309) [-453.765] -- 0:00:44
Average standard deviation of split frequencies: 0.009372
310500 -- [-456.824] (-456.258) (-457.309) (-459.501) * (-462.002) [-454.704] (-456.096) (-453.888) -- 0:00:44
311000 -- (-453.968) [-456.726] (-457.813) (-454.163) * [-457.542] (-454.588) (-456.914) (-455.464) -- 0:00:44
311500 -- (-454.481) [-454.740] (-454.551) (-454.389) * (-456.596) (-454.987) (-457.142) [-456.817] -- 0:00:44
312000 -- (-455.636) (-457.598) [-454.342] (-456.498) * (-453.704) [-455.012] (-457.457) (-456.931) -- 0:00:46
312500 -- (-454.850) [-458.124] (-455.664) (-458.529) * (-453.754) (-455.662) (-457.827) [-454.399] -- 0:00:46
313000 -- (-454.646) (-457.214) [-454.793] (-458.708) * (-457.632) [-454.549] (-455.463) (-455.683) -- 0:00:46
313500 -- (-455.628) (-457.231) (-457.986) [-455.486] * (-456.548) [-455.725] (-455.381) (-454.124) -- 0:00:45
314000 -- (-459.042) (-455.510) (-454.898) [-455.217] * (-457.579) [-456.329] (-458.265) (-455.239) -- 0:00:45
314500 -- (-457.592) (-454.849) [-455.378] (-457.053) * (-457.817) [-453.885] (-458.310) (-453.677) -- 0:00:45
315000 -- (-455.613) (-455.196) [-455.433] (-455.019) * (-455.492) (-456.679) (-455.906) [-456.523] -- 0:00:45
Average standard deviation of split frequencies: 0.009389
315500 -- [-454.518] (-454.936) (-454.776) (-455.754) * (-455.841) (-455.630) [-454.499] (-455.699) -- 0:00:45
316000 -- [-453.958] (-454.048) (-454.459) (-455.792) * (-454.873) (-456.034) (-454.202) [-454.011] -- 0:00:45
316500 -- (-455.526) [-456.266] (-454.104) (-455.998) * (-455.550) (-455.577) [-454.779] (-455.172) -- 0:00:45
317000 -- (-454.751) (-460.399) [-456.134] (-457.338) * (-458.404) (-454.438) [-458.001] (-460.021) -- 0:00:45
317500 -- [-458.020] (-457.566) (-460.874) (-456.596) * [-454.452] (-454.243) (-456.511) (-459.989) -- 0:00:45
318000 -- (-455.674) (-460.520) [-453.668] (-455.854) * (-458.875) (-454.019) (-457.026) [-455.523] -- 0:00:45
318500 -- (-456.776) (-456.465) [-455.405] (-457.981) * (-454.638) (-455.477) [-457.452] (-455.274) -- 0:00:44
319000 -- (-453.699) (-455.435) (-455.282) [-454.432] * (-457.842) (-455.416) (-454.805) [-455.271] -- 0:00:44
319500 -- (-455.405) (-454.341) [-454.918] (-454.834) * (-455.994) (-456.300) [-454.047] (-455.875) -- 0:00:44
320000 -- (-454.959) (-455.430) [-455.022] (-455.568) * [-455.011] (-455.870) (-455.599) (-455.717) -- 0:00:44
Average standard deviation of split frequencies: 0.009555
320500 -- (-459.930) [-457.109] (-455.838) (-454.374) * [-455.084] (-455.532) (-455.466) (-454.182) -- 0:00:44
321000 -- (-457.832) [-455.778] (-454.366) (-454.953) * (-454.464) (-455.544) [-455.700] (-456.102) -- 0:00:44
321500 -- (-458.127) (-455.354) (-454.668) [-454.251] * [-456.284] (-457.499) (-455.644) (-454.505) -- 0:00:44
322000 -- (-457.270) (-454.929) (-455.611) [-455.359] * (-459.297) (-456.035) [-455.753] (-459.887) -- 0:00:44
322500 -- [-454.918] (-455.009) (-454.358) (-454.314) * (-453.755) (-460.134) (-455.942) [-456.351] -- 0:00:44
323000 -- (-453.847) (-457.364) (-453.728) [-459.518] * (-454.613) (-457.044) (-463.599) [-459.249] -- 0:00:44
323500 -- (-454.033) (-456.974) [-455.257] (-454.990) * (-453.881) (-455.149) [-455.013] (-462.888) -- 0:00:43
324000 -- (-457.937) [-457.316] (-455.288) (-456.634) * (-456.711) (-456.408) [-456.502] (-454.546) -- 0:00:43
324500 -- [-455.788] (-454.390) (-457.348) (-455.557) * (-455.375) [-457.414] (-457.581) (-455.015) -- 0:00:43
325000 -- (-456.545) (-454.509) [-459.172] (-456.494) * (-454.167) (-454.832) [-455.059] (-454.066) -- 0:00:43
Average standard deviation of split frequencies: 0.010936
325500 -- (-460.376) (-458.288) (-456.866) [-456.379] * (-458.164) (-458.875) [-455.819] (-455.419) -- 0:00:43
326000 -- (-460.571) (-460.256) [-454.293] (-456.863) * (-455.012) (-456.903) [-456.885] (-454.471) -- 0:00:43
326500 -- (-460.058) [-457.803] (-454.768) (-458.130) * [-454.795] (-456.202) (-454.641) (-454.978) -- 0:00:43
327000 -- (-463.077) (-455.281) (-455.167) [-456.526] * [-458.906] (-454.747) (-454.953) (-455.409) -- 0:00:43
327500 -- (-454.900) [-456.981] (-457.925) (-459.186) * (-456.198) (-454.009) [-455.848] (-454.985) -- 0:00:45
328000 -- [-454.709] (-455.385) (-456.181) (-457.982) * (-455.709) (-454.309) (-456.864) [-455.715] -- 0:00:45
328500 -- (-457.979) (-456.554) (-455.573) [-455.588] * [-455.937] (-455.512) (-457.800) (-456.941) -- 0:00:44
329000 -- (-458.088) [-453.622] (-453.936) (-455.544) * (-456.440) (-458.230) (-457.562) [-455.035] -- 0:00:44
329500 -- (-457.677) (-458.935) [-457.156] (-455.627) * (-455.584) [-454.438] (-454.607) (-454.218) -- 0:00:44
330000 -- [-453.881] (-456.504) (-455.407) (-453.855) * [-454.939] (-454.792) (-459.513) (-456.202) -- 0:00:44
Average standard deviation of split frequencies: 0.010158
330500 -- [-453.787] (-454.768) (-457.774) (-459.477) * (-456.541) (-457.488) [-458.473] (-456.327) -- 0:00:44
331000 -- (-456.274) (-459.153) (-461.265) [-459.511] * (-457.191) (-457.781) [-458.121] (-455.741) -- 0:00:44
331500 -- (-455.229) (-455.932) [-454.646] (-456.662) * (-455.733) (-459.397) [-457.811] (-462.007) -- 0:00:44
332000 -- (-457.897) (-457.047) [-456.048] (-455.745) * (-455.923) (-459.013) [-454.888] (-456.043) -- 0:00:44
332500 -- (-454.212) (-454.834) (-455.331) [-456.420] * [-455.795] (-459.132) (-455.360) (-456.515) -- 0:00:44
333000 -- (-455.340) (-462.075) (-453.964) [-454.395] * (-461.999) (-459.825) (-454.989) [-455.157] -- 0:00:44
333500 -- (-455.914) (-454.866) [-455.333] (-458.880) * (-456.903) (-455.749) (-458.377) [-457.271] -- 0:00:43
334000 -- (-455.859) (-455.127) [-455.546] (-459.084) * (-455.804) (-456.454) (-459.001) [-455.747] -- 0:00:43
334500 -- [-459.526] (-455.269) (-455.867) (-455.932) * (-455.303) (-457.155) [-454.338] (-456.517) -- 0:00:43
335000 -- [-454.225] (-456.164) (-461.636) (-455.605) * (-456.257) (-458.858) (-454.643) [-456.296] -- 0:00:43
Average standard deviation of split frequencies: 0.010564
335500 -- (-455.307) [-455.409] (-454.736) (-455.325) * (-459.182) (-456.145) (-457.096) [-455.594] -- 0:00:43
336000 -- [-455.651] (-454.946) (-459.884) (-455.421) * (-455.304) [-456.924] (-455.181) (-454.964) -- 0:00:43
336500 -- (-459.738) (-455.420) [-454.529] (-453.692) * (-454.717) [-455.168] (-460.225) (-457.164) -- 0:00:43
337000 -- (-458.160) (-456.224) [-453.816] (-459.000) * [-453.533] (-460.423) (-456.822) (-455.813) -- 0:00:43
337500 -- [-456.162] (-457.802) (-454.955) (-456.864) * (-455.921) [-459.131] (-460.756) (-454.715) -- 0:00:43
338000 -- (-456.917) [-456.545] (-458.270) (-454.067) * (-458.071) [-454.423] (-454.579) (-454.167) -- 0:00:43
338500 -- [-457.469] (-456.123) (-458.340) (-458.167) * (-456.998) (-456.903) (-456.002) [-455.948] -- 0:00:42
339000 -- (-455.425) (-456.015) (-458.762) [-458.038] * (-453.964) (-455.338) [-455.354] (-456.684) -- 0:00:42
339500 -- (-457.628) [-456.884] (-456.723) (-460.613) * (-456.039) [-455.913] (-454.705) (-455.132) -- 0:00:42
340000 -- [-456.084] (-454.555) (-454.827) (-458.459) * [-456.853] (-455.731) (-453.797) (-454.552) -- 0:00:42
Average standard deviation of split frequencies: 0.010984
340500 -- [-455.760] (-456.869) (-456.488) (-456.261) * (-455.005) (-454.230) [-458.531] (-457.517) -- 0:00:42
341000 -- (-454.063) (-454.494) (-456.596) [-454.637] * (-453.665) [-459.555] (-459.247) (-457.432) -- 0:00:42
341500 -- (-459.916) [-453.912] (-455.391) (-456.518) * [-454.724] (-456.589) (-455.619) (-458.770) -- 0:00:42
342000 -- (-461.409) (-456.104) (-454.380) [-459.995] * [-455.494] (-455.494) (-454.645) (-457.240) -- 0:00:42
342500 -- (-460.549) (-455.092) [-456.156] (-461.841) * (-455.621) (-453.635) [-457.033] (-456.142) -- 0:00:42
343000 -- [-454.690] (-459.339) (-455.340) (-462.381) * (-458.156) [-454.239] (-463.939) (-454.767) -- 0:00:44
343500 -- (-458.581) (-457.960) [-455.270] (-460.262) * [-454.165] (-455.768) (-455.941) (-456.785) -- 0:00:43
344000 -- (-456.655) (-454.867) [-456.233] (-456.184) * [-457.656] (-455.644) (-456.529) (-455.721) -- 0:00:43
344500 -- (-454.465) (-457.025) (-455.043) [-456.516] * [-456.804] (-457.064) (-457.892) (-459.303) -- 0:00:43
345000 -- (-457.146) (-457.032) [-453.944] (-455.737) * (-458.616) [-454.491] (-457.924) (-455.854) -- 0:00:43
Average standard deviation of split frequencies: 0.010980
345500 -- (-460.650) [-454.352] (-454.250) (-455.895) * (-455.262) [-456.086] (-462.350) (-456.732) -- 0:00:43
346000 -- (-461.402) (-456.552) [-454.523] (-458.442) * [-454.132] (-458.841) (-454.828) (-455.336) -- 0:00:43
346500 -- (-465.098) [-455.943] (-455.374) (-457.978) * (-456.166) (-457.842) [-455.545] (-454.111) -- 0:00:43
347000 -- (-455.944) (-457.291) [-457.063] (-456.197) * (-454.685) (-456.236) [-454.715] (-455.627) -- 0:00:43
347500 -- (-458.029) (-457.174) [-454.526] (-455.846) * (-456.441) (-457.297) (-454.335) [-457.416] -- 0:00:43
348000 -- [-456.101] (-455.277) (-457.439) (-456.971) * (-455.364) (-456.626) [-455.185] (-455.188) -- 0:00:43
348500 -- (-456.667) (-454.965) [-455.512] (-454.145) * [-458.291] (-455.146) (-458.726) (-454.559) -- 0:00:42
349000 -- (-457.057) [-455.715] (-457.683) (-457.899) * (-458.770) [-454.613] (-456.542) (-457.192) -- 0:00:42
349500 -- (-456.434) (-455.205) (-454.804) [-454.899] * (-458.495) (-454.235) [-457.008] (-456.843) -- 0:00:42
350000 -- (-460.264) (-455.575) [-456.826] (-455.583) * (-454.429) (-457.272) (-457.068) [-455.615] -- 0:00:42
Average standard deviation of split frequencies: 0.011007
350500 -- (-460.700) (-457.208) (-454.686) [-455.116] * (-455.394) (-454.457) (-456.653) [-455.112] -- 0:00:42
351000 -- (-455.367) (-456.150) [-455.327] (-454.345) * (-455.840) (-456.303) (-455.959) [-456.876] -- 0:00:42
351500 -- (-460.762) (-457.867) [-455.666] (-455.911) * (-455.404) [-456.860] (-455.183) (-455.774) -- 0:00:42
352000 -- (-460.702) (-458.717) (-454.369) [-454.799] * [-456.350] (-455.219) (-457.747) (-456.841) -- 0:00:42
352500 -- (-453.898) [-457.444] (-457.829) (-454.031) * (-458.638) (-458.186) [-457.882] (-457.355) -- 0:00:42
353000 -- (-456.792) (-456.076) [-454.057] (-455.230) * (-455.069) (-455.102) [-456.436] (-459.321) -- 0:00:42
353500 -- [-454.715] (-456.027) (-455.057) (-454.391) * (-456.031) (-455.072) [-457.444] (-459.408) -- 0:00:42
354000 -- (-461.528) (-456.342) [-456.479] (-455.763) * (-455.319) (-454.278) [-460.204] (-457.563) -- 0:00:41
354500 -- (-458.166) (-456.894) (-457.917) [-454.224] * (-454.889) [-455.385] (-454.153) (-456.221) -- 0:00:41
355000 -- (-455.083) (-453.826) (-454.662) [-455.581] * (-454.963) (-457.827) [-456.161] (-459.121) -- 0:00:41
Average standard deviation of split frequencies: 0.010180
355500 -- (-456.326) (-456.449) [-454.836] (-459.454) * (-458.545) [-459.381] (-454.878) (-455.256) -- 0:00:41
356000 -- [-454.209] (-457.499) (-455.650) (-456.316) * (-454.275) (-458.156) [-455.237] (-453.946) -- 0:00:41
356500 -- (-456.259) (-456.978) [-455.738] (-455.032) * (-457.896) [-454.214] (-457.700) (-455.100) -- 0:00:41
357000 -- [-455.391] (-457.446) (-456.266) (-456.424) * [-458.183] (-456.188) (-455.709) (-456.670) -- 0:00:43
357500 -- [-454.613] (-456.128) (-456.782) (-454.638) * (-454.765) (-453.768) [-456.676] (-454.679) -- 0:00:43
358000 -- (-454.581) (-454.742) (-457.361) [-454.502] * (-455.397) (-457.257) [-459.481] (-454.909) -- 0:00:43
358500 -- (-459.526) (-455.180) (-460.979) [-455.378] * (-456.831) (-458.692) [-457.644] (-453.852) -- 0:00:42
359000 -- (-455.922) (-455.074) [-454.331] (-458.140) * (-455.799) (-455.765) [-457.657] (-454.155) -- 0:00:42
359500 -- (-458.806) (-454.955) (-459.062) [-454.419] * (-454.453) (-456.625) [-456.534] (-453.950) -- 0:00:42
360000 -- (-455.737) (-459.076) (-462.858) [-457.276] * (-454.576) (-457.468) (-458.672) [-455.065] -- 0:00:42
Average standard deviation of split frequencies: 0.009498
360500 -- (-462.509) (-456.930) [-455.806] (-456.078) * [-456.231] (-453.587) (-456.238) (-458.749) -- 0:00:42
361000 -- [-457.314] (-457.988) (-455.644) (-456.751) * [-454.709] (-456.898) (-456.119) (-454.883) -- 0:00:42
361500 -- [-457.599] (-456.827) (-454.317) (-456.565) * [-454.096] (-456.763) (-457.922) (-454.685) -- 0:00:42
362000 -- (-457.048) (-454.333) [-456.648] (-454.687) * [-455.039] (-454.170) (-455.777) (-455.855) -- 0:00:42
362500 -- (-455.327) [-454.859] (-456.109) (-457.702) * (-456.735) [-455.136] (-454.697) (-457.223) -- 0:00:42
363000 -- (-456.194) (-455.780) (-459.562) [-454.429] * (-456.178) [-454.823] (-455.258) (-455.309) -- 0:00:42
363500 -- (-456.325) (-458.590) [-453.926] (-453.748) * (-455.218) [-456.571] (-455.152) (-456.390) -- 0:00:42
364000 -- (-457.296) (-457.229) [-454.792] (-454.450) * (-455.102) (-457.164) [-455.605] (-458.952) -- 0:00:41
364500 -- (-455.713) [-457.597] (-454.654) (-454.365) * (-454.028) (-455.541) [-455.178] (-459.569) -- 0:00:41
365000 -- (-456.607) [-458.209] (-455.105) (-454.386) * (-454.733) (-454.729) [-456.857] (-456.868) -- 0:00:41
Average standard deviation of split frequencies: 0.009016
365500 -- [-454.222] (-455.363) (-455.098) (-457.829) * (-454.204) (-456.175) (-455.771) [-454.764] -- 0:00:41
366000 -- (-453.844) [-454.137] (-457.497) (-459.002) * (-454.172) (-455.647) (-454.365) [-456.504] -- 0:00:41
366500 -- (-456.174) (-456.750) (-456.561) [-454.544] * (-456.249) [-455.306] (-455.426) (-457.504) -- 0:00:41
367000 -- (-456.177) (-456.243) (-455.098) [-458.427] * [-455.926] (-456.451) (-456.820) (-456.960) -- 0:00:41
367500 -- [-455.982] (-456.124) (-456.159) (-456.541) * (-456.277) [-455.957] (-455.509) (-454.490) -- 0:00:41
368000 -- (-458.355) [-454.937] (-456.163) (-456.358) * (-456.178) (-455.404) [-457.790] (-460.764) -- 0:00:41
368500 -- (-456.555) [-459.961] (-454.840) (-455.037) * (-461.204) (-455.331) [-456.184] (-457.593) -- 0:00:41
369000 -- [-455.442] (-456.981) (-455.685) (-457.486) * (-457.303) (-455.019) (-457.875) [-455.271] -- 0:00:41
369500 -- (-454.915) [-456.830] (-454.521) (-458.087) * [-457.200] (-454.489) (-455.171) (-454.440) -- 0:00:40
370000 -- [-454.628] (-461.704) (-455.216) (-456.206) * (-454.466) (-455.810) (-456.073) [-456.910] -- 0:00:40
Average standard deviation of split frequencies: 0.008478
370500 -- (-454.793) (-454.324) (-454.748) [-456.302] * (-454.348) (-457.949) [-457.217] (-454.403) -- 0:00:40
371000 -- (-457.243) (-455.629) [-456.771] (-461.684) * (-459.469) (-460.809) (-455.071) [-458.490] -- 0:00:40
371500 -- (-458.718) [-454.239] (-461.600) (-455.427) * (-454.849) (-456.625) (-455.400) [-457.955] -- 0:00:40
372000 -- [-456.617] (-454.128) (-460.577) (-456.225) * (-457.309) (-457.618) (-454.194) [-454.407] -- 0:00:42
372500 -- (-455.208) [-454.914] (-455.104) (-456.695) * [-457.589] (-454.488) (-456.814) (-454.883) -- 0:00:42
373000 -- (-454.231) (-460.479) (-455.617) [-456.041] * (-457.785) (-458.383) (-455.174) [-455.418] -- 0:00:42
373500 -- (-456.234) [-456.623] (-455.018) (-455.167) * (-454.322) (-461.129) (-455.184) [-453.552] -- 0:00:41
374000 -- [-455.547] (-456.028) (-454.483) (-454.672) * [-457.082] (-454.258) (-455.374) (-455.426) -- 0:00:41
374500 -- (-457.204) (-455.736) (-455.985) [-454.326] * (-457.269) (-454.529) [-458.008] (-454.684) -- 0:00:41
375000 -- (-456.365) (-457.000) [-455.176] (-454.992) * [-454.565] (-454.667) (-455.841) (-455.375) -- 0:00:41
Average standard deviation of split frequencies: 0.009090
375500 -- (-455.924) [-455.710] (-458.009) (-454.885) * (-456.411) (-461.837) [-455.038] (-454.149) -- 0:00:41
376000 -- (-455.326) (-456.604) [-456.614] (-454.095) * (-455.368) (-460.034) [-454.280] (-454.335) -- 0:00:41
376500 -- (-454.404) [-455.239] (-460.890) (-455.060) * [-455.527] (-459.289) (-453.987) (-457.342) -- 0:00:41
377000 -- (-455.935) (-458.735) (-461.371) [-458.357] * (-455.059) [-455.181] (-454.009) (-456.754) -- 0:00:41
377500 -- [-455.763] (-457.625) (-454.716) (-458.765) * (-459.354) (-455.174) (-454.689) [-454.550] -- 0:00:41
378000 -- [-455.053] (-458.873) (-453.985) (-456.119) * (-459.459) (-457.149) [-455.675] (-453.908) -- 0:00:41
378500 -- (-456.941) [-454.055] (-454.375) (-457.674) * (-454.693) (-457.348) (-453.916) [-455.978] -- 0:00:41
379000 -- (-455.691) (-454.542) [-454.372] (-458.309) * (-454.370) (-458.196) (-455.572) [-458.582] -- 0:00:40
379500 -- (-456.687) (-456.740) (-454.209) [-456.913] * [-455.228] (-454.463) (-454.285) (-454.114) -- 0:00:40
380000 -- (-456.715) (-455.059) [-457.803] (-454.472) * (-454.535) [-455.483] (-456.649) (-457.205) -- 0:00:40
Average standard deviation of split frequencies: 0.008091
380500 -- (-458.401) (-457.464) (-457.336) [-458.509] * (-453.852) (-454.412) (-455.854) [-455.097] -- 0:00:40
381000 -- [-454.145] (-458.499) (-459.842) (-454.282) * (-456.333) (-455.614) [-457.093] (-455.659) -- 0:00:40
381500 -- (-457.575) (-456.749) (-457.308) [-454.905] * (-456.828) (-455.245) [-456.453] (-455.958) -- 0:00:40
382000 -- (-454.266) (-456.408) [-454.757] (-457.486) * [-457.666] (-454.085) (-458.868) (-459.620) -- 0:00:40
382500 -- (-454.635) (-456.526) [-455.846] (-455.595) * (-455.445) (-454.775) [-454.306] (-459.215) -- 0:00:40
383000 -- (-454.742) (-454.822) (-458.355) [-461.514] * (-457.368) [-453.724] (-457.181) (-457.564) -- 0:00:40
383500 -- [-454.899] (-454.043) (-458.946) (-455.087) * [-454.666] (-456.545) (-456.931) (-454.302) -- 0:00:40
384000 -- (-456.251) [-460.456] (-454.930) (-454.619) * (-456.714) (-457.735) (-454.235) [-455.575] -- 0:00:40
384500 -- (-458.304) (-463.463) [-454.077] (-454.734) * (-457.454) (-458.306) (-457.673) [-453.813] -- 0:00:40
385000 -- (-459.347) (-460.605) (-454.995) [-457.360] * [-455.030] (-454.697) (-454.064) (-458.361) -- 0:00:39
Average standard deviation of split frequencies: 0.008060
385500 -- (-456.534) (-458.229) (-456.821) [-458.089] * (-455.583) (-454.455) [-457.193] (-457.116) -- 0:00:39
386000 -- [-455.009] (-457.976) (-456.136) (-455.735) * [-454.141] (-454.321) (-456.265) (-455.246) -- 0:00:41
386500 -- (-455.642) (-456.523) (-456.038) [-455.066] * [-454.600] (-458.090) (-457.309) (-455.927) -- 0:00:41
387000 -- (-456.919) (-454.617) [-460.033] (-454.452) * (-453.895) (-455.339) [-457.370] (-458.617) -- 0:00:41
387500 -- (-457.015) [-455.661] (-460.999) (-454.355) * (-454.120) (-454.249) [-463.613] (-456.245) -- 0:00:41
388000 -- (-458.150) (-458.812) (-457.665) [-454.666] * (-455.114) (-454.617) [-460.019] (-456.700) -- 0:00:41
388500 -- (-454.789) [-454.184] (-456.893) (-458.619) * (-457.841) [-458.550] (-455.810) (-455.400) -- 0:00:40
389000 -- [-454.516] (-455.404) (-458.085) (-457.406) * (-454.077) (-454.909) [-457.199] (-454.397) -- 0:00:40
389500 -- (-456.314) (-455.962) [-454.921] (-459.788) * (-455.249) (-456.089) (-460.852) [-457.703] -- 0:00:40
390000 -- (-455.011) (-457.406) [-455.911] (-458.607) * [-457.543] (-454.678) (-457.259) (-456.987) -- 0:00:40
Average standard deviation of split frequencies: 0.008366
390500 -- [-455.111] (-457.356) (-456.815) (-457.064) * (-455.425) [-454.717] (-458.388) (-455.655) -- 0:00:40
391000 -- (-456.199) (-457.037) (-455.660) [-457.213] * (-455.714) (-457.207) (-459.799) [-457.481] -- 0:00:40
391500 -- (-457.503) (-454.815) (-455.088) [-455.783] * (-456.426) (-454.523) (-456.896) [-456.397] -- 0:00:40
392000 -- (-457.213) (-457.287) [-454.702] (-456.014) * (-453.993) (-455.574) (-455.440) [-456.257] -- 0:00:40
392500 -- (-456.124) (-456.739) [-456.679] (-456.206) * (-454.248) [-457.903] (-456.434) (-456.993) -- 0:00:40
393000 -- (-456.012) (-454.555) (-458.634) [-456.796] * [-458.120] (-456.200) (-457.386) (-456.615) -- 0:00:40
393500 -- (-461.613) (-454.023) (-462.506) [-458.582] * [-455.820] (-455.567) (-458.350) (-456.523) -- 0:00:40
394000 -- (-456.407) (-453.929) [-457.032] (-455.084) * (-454.951) (-454.441) [-455.921] (-455.118) -- 0:00:39
394500 -- (-455.160) (-458.996) (-454.757) [-455.586] * [-455.171] (-455.810) (-456.226) (-455.145) -- 0:00:39
395000 -- (-454.830) [-458.073] (-462.719) (-456.400) * (-455.229) (-454.386) [-453.783] (-467.441) -- 0:00:39
Average standard deviation of split frequencies: 0.007857
395500 -- (-454.138) [-456.217] (-461.756) (-455.341) * (-455.595) [-455.542] (-456.017) (-460.355) -- 0:00:39
396000 -- (-455.651) (-459.106) [-455.612] (-455.408) * [-456.362] (-459.088) (-459.342) (-461.163) -- 0:00:39
396500 -- (-454.287) [-457.389] (-453.861) (-456.861) * [-454.532] (-459.300) (-457.673) (-458.060) -- 0:00:39
397000 -- (-454.744) (-459.734) [-454.811] (-456.817) * (-461.954) (-455.223) [-456.887] (-459.147) -- 0:00:39
397500 -- (-455.299) [-456.783] (-455.578) (-454.744) * (-457.933) (-455.033) [-454.843] (-460.536) -- 0:00:39
398000 -- (-457.255) (-454.099) (-457.981) [-454.419] * (-458.140) (-454.066) (-454.584) [-455.627] -- 0:00:39
398500 -- (-459.122) (-460.100) [-458.004] (-454.393) * (-456.092) (-454.184) [-454.182] (-457.913) -- 0:00:39
399000 -- [-454.904] (-458.602) (-457.397) (-456.751) * (-456.221) (-459.897) (-456.533) [-457.251] -- 0:00:39
399500 -- [-454.756] (-455.849) (-458.510) (-457.288) * (-454.403) (-460.186) [-455.200] (-454.614) -- 0:00:39
400000 -- [-458.018] (-454.976) (-458.344) (-457.231) * [-454.968] (-454.997) (-455.894) (-456.771) -- 0:00:39
Average standard deviation of split frequencies: 0.008157
400500 -- (-455.058) (-455.905) (-456.065) [-456.855] * [-455.682] (-457.130) (-459.625) (-458.062) -- 0:00:40
401000 -- [-454.367] (-455.290) (-458.416) (-457.231) * (-461.411) [-458.535] (-458.962) (-457.215) -- 0:00:40
401500 -- (-457.700) (-454.197) [-455.981] (-456.132) * (-456.572) [-454.651] (-464.390) (-455.031) -- 0:00:40
402000 -- [-455.484] (-456.756) (-457.310) (-457.434) * (-456.689) (-456.230) (-456.057) [-454.259] -- 0:00:40
402500 -- (-455.562) [-454.441] (-460.838) (-458.012) * (-459.432) (-457.691) [-455.373] (-454.333) -- 0:00:40
403000 -- [-456.355] (-459.423) (-461.183) (-459.119) * (-456.174) (-454.628) (-455.538) [-456.354] -- 0:00:39
403500 -- (-455.781) (-457.506) [-454.871] (-459.862) * (-454.832) [-456.377] (-455.727) (-457.786) -- 0:00:39
404000 -- (-455.472) (-457.919) (-454.385) [-454.818] * [-454.625] (-455.967) (-455.975) (-455.287) -- 0:00:39
404500 -- (-453.953) (-460.977) [-456.919] (-459.170) * (-457.622) (-454.717) [-457.982] (-454.437) -- 0:00:39
405000 -- (-453.996) (-455.980) (-454.505) [-454.413] * [-454.429] (-457.035) (-456.764) (-455.629) -- 0:00:39
Average standard deviation of split frequencies: 0.007508
405500 -- (-456.331) [-453.783] (-459.785) (-457.569) * (-457.959) [-455.596] (-456.802) (-457.648) -- 0:00:39
406000 -- (-457.008) (-455.009) [-457.754] (-456.235) * (-455.260) (-458.608) [-455.521] (-456.451) -- 0:00:39
406500 -- [-454.830] (-455.059) (-457.198) (-455.528) * (-455.254) (-458.717) (-454.561) [-457.980] -- 0:00:39
407000 -- (-456.356) (-455.419) [-458.017] (-456.487) * [-454.966] (-457.098) (-453.820) (-454.937) -- 0:00:39
407500 -- (-457.091) (-454.616) (-459.438) [-455.088] * (-459.657) (-455.009) [-455.390] (-456.820) -- 0:00:39
408000 -- (-458.209) (-457.167) [-453.849] (-457.179) * (-456.468) [-456.919] (-455.710) (-462.324) -- 0:00:39
408500 -- [-454.954] (-455.183) (-455.701) (-458.026) * (-455.809) (-456.602) (-455.613) [-456.034] -- 0:00:39
409000 -- (-457.472) (-456.029) [-458.598] (-455.856) * (-459.978) (-453.736) [-454.572] (-454.439) -- 0:00:39
409500 -- (-455.854) (-457.975) (-455.946) [-457.872] * (-461.864) (-453.530) (-456.881) [-454.715] -- 0:00:38
410000 -- (-454.845) (-454.530) (-457.980) [-454.433] * (-460.606) (-454.045) (-455.703) [-459.462] -- 0:00:38
Average standard deviation of split frequencies: 0.007040
410500 -- (-456.428) (-456.210) (-456.711) [-456.251] * (-457.979) (-453.585) [-455.502] (-454.726) -- 0:00:38
411000 -- [-453.974] (-455.950) (-460.594) (-455.685) * [-457.160] (-454.436) (-453.709) (-461.846) -- 0:00:38
411500 -- (-455.295) (-454.327) (-456.044) [-456.827] * (-456.970) (-459.646) [-454.544] (-457.909) -- 0:00:38
412000 -- [-454.112] (-456.182) (-459.634) (-456.345) * [-454.533] (-464.466) (-455.111) (-456.399) -- 0:00:38
412500 -- (-455.093) [-454.096] (-461.287) (-456.798) * (-456.263) (-456.600) [-454.770] (-455.981) -- 0:00:38
413000 -- (-455.544) (-455.216) [-454.909] (-454.892) * (-456.847) (-456.977) (-455.038) [-455.821] -- 0:00:38
413500 -- (-454.518) (-456.087) (-454.677) [-454.806] * (-454.756) (-458.183) (-458.652) [-455.124] -- 0:00:38
414000 -- (-455.923) (-456.441) (-455.345) [-454.187] * (-459.362) [-454.175] (-453.499) (-456.242) -- 0:00:38
414500 -- (-458.201) (-457.663) [-461.708] (-455.182) * (-456.838) (-455.701) (-462.506) [-457.611] -- 0:00:39
415000 -- (-457.434) (-455.722) [-461.538] (-461.979) * (-457.367) [-458.273] (-455.282) (-455.215) -- 0:00:39
Average standard deviation of split frequencies: 0.007252
415500 -- (-459.128) [-454.747] (-455.336) (-455.965) * (-454.676) [-454.983] (-454.264) (-454.984) -- 0:00:39
416000 -- [-457.431] (-454.787) (-456.792) (-458.299) * (-463.263) (-455.507) (-454.701) [-454.212] -- 0:00:39
416500 -- [-457.478] (-455.595) (-463.602) (-455.702) * (-459.721) (-459.552) [-456.326] (-454.650) -- 0:00:39
417000 -- (-455.214) (-455.057) (-461.462) [-455.094] * [-457.453] (-455.693) (-455.810) (-456.115) -- 0:00:39
417500 -- (-457.296) (-455.257) [-457.288] (-455.619) * [-460.140] (-456.321) (-455.128) (-455.970) -- 0:00:39
418000 -- (-461.628) (-459.574) [-454.986] (-455.812) * (-456.855) (-456.502) (-456.209) [-454.062] -- 0:00:38
418500 -- (-456.270) (-455.226) (-455.789) [-455.085] * (-458.106) [-457.278] (-455.134) (-454.667) -- 0:00:38
419000 -- (-461.198) (-455.411) (-456.553) [-454.070] * (-456.825) (-457.361) (-461.153) [-459.247] -- 0:00:38
419500 -- [-454.991] (-454.491) (-455.785) (-454.103) * (-454.063) [-455.681] (-456.460) (-457.497) -- 0:00:38
420000 -- (-458.262) (-455.038) (-460.379) [-458.164] * (-468.637) (-453.896) (-455.625) [-454.140] -- 0:00:38
Average standard deviation of split frequencies: 0.007545
420500 -- (-455.311) [-454.754] (-455.975) (-454.984) * (-457.169) (-455.308) (-454.439) [-454.417] -- 0:00:38
421000 -- (-454.975) [-455.568] (-455.321) (-454.992) * (-460.852) [-457.961] (-455.939) (-457.193) -- 0:00:38
421500 -- (-461.500) [-455.522] (-456.905) (-460.684) * (-456.500) (-457.915) (-454.776) [-454.459] -- 0:00:38
422000 -- (-456.174) [-455.881] (-457.713) (-455.383) * [-455.165] (-457.401) (-455.431) (-454.279) -- 0:00:38
422500 -- (-456.601) [-454.607] (-455.725) (-455.432) * [-454.200] (-457.214) (-454.860) (-455.624) -- 0:00:38
423000 -- (-455.193) [-457.729] (-455.733) (-454.879) * (-456.257) (-455.011) [-454.847] (-455.329) -- 0:00:38
423500 -- [-456.544] (-456.329) (-456.712) (-455.514) * (-457.900) (-454.340) (-455.851) [-455.023] -- 0:00:38
424000 -- (-458.692) [-455.252] (-456.208) (-455.414) * [-456.631] (-455.762) (-456.257) (-455.402) -- 0:00:38
424500 -- (-460.446) (-457.380) (-455.670) [-454.734] * (-455.885) (-457.334) [-458.138] (-457.460) -- 0:00:37
425000 -- (-456.124) [-456.569] (-455.973) (-455.239) * (-455.657) (-454.947) (-455.438) [-457.597] -- 0:00:37
Average standard deviation of split frequencies: 0.008369
425500 -- [-455.511] (-454.168) (-454.271) (-459.466) * [-458.480] (-456.400) (-458.751) (-454.746) -- 0:00:37
426000 -- [-456.418] (-455.273) (-454.150) (-458.110) * [-460.698] (-456.555) (-455.685) (-456.153) -- 0:00:37
426500 -- (-456.514) [-459.476] (-454.422) (-460.284) * (-457.813) (-456.207) (-454.502) [-454.821] -- 0:00:37
427000 -- (-456.168) [-455.936] (-456.689) (-458.762) * (-454.375) [-455.379] (-459.035) (-455.278) -- 0:00:37
427500 -- (-454.990) [-459.175] (-458.378) (-458.280) * (-455.697) (-454.866) (-456.987) [-457.806] -- 0:00:37
428000 -- [-455.770] (-463.208) (-456.410) (-455.609) * (-455.411) [-456.182] (-459.302) (-460.970) -- 0:00:37
428500 -- (-457.508) [-459.724] (-454.697) (-462.548) * [-454.896] (-455.053) (-456.996) (-455.568) -- 0:00:38
429000 -- (-457.460) (-459.203) (-456.342) [-457.276] * (-455.177) [-456.199] (-455.925) (-454.631) -- 0:00:38
429500 -- (-457.397) (-454.080) [-456.262] (-457.323) * [-456.547] (-454.473) (-456.968) (-453.566) -- 0:00:38
430000 -- (-457.797) (-454.323) (-457.863) [-454.096] * (-455.426) [-453.644] (-456.210) (-455.394) -- 0:00:38
Average standard deviation of split frequencies: 0.007589
430500 -- (-454.469) (-454.158) [-458.520] (-454.955) * (-455.874) (-454.588) (-454.349) [-457.005] -- 0:00:38
431000 -- (-458.781) (-455.082) [-454.913] (-459.231) * [-455.552] (-456.056) (-454.184) (-455.365) -- 0:00:38
431500 -- (-458.829) (-454.141) [-455.505] (-459.234) * (-454.411) [-457.640] (-453.975) (-455.610) -- 0:00:38
432000 -- (-457.651) [-455.115] (-457.455) (-455.677) * (-458.246) [-456.523] (-456.284) (-455.878) -- 0:00:38
432500 -- [-456.007] (-458.178) (-459.967) (-456.192) * (-457.551) (-455.346) (-456.024) [-457.775] -- 0:00:38
433000 -- (-455.709) (-459.275) (-456.816) [-454.678] * (-453.778) (-455.152) (-457.949) [-453.647] -- 0:00:37
433500 -- (-455.854) [-456.481] (-458.817) (-461.032) * (-454.786) (-457.069) (-458.821) [-453.668] -- 0:00:37
434000 -- (-461.211) (-455.627) (-461.214) [-458.858] * [-456.170] (-454.357) (-455.672) (-453.893) -- 0:00:37
434500 -- [-454.701] (-458.836) (-457.415) (-455.027) * (-454.023) (-454.799) [-455.473] (-456.517) -- 0:00:37
435000 -- (-456.937) (-456.534) (-454.616) [-456.652] * (-457.703) [-454.038] (-455.716) (-455.071) -- 0:00:37
Average standard deviation of split frequencies: 0.007929
435500 -- [-459.478] (-458.035) (-455.981) (-458.380) * (-455.776) [-455.773] (-456.197) (-456.938) -- 0:00:37
436000 -- (-454.709) (-454.745) (-455.569) [-458.899] * (-458.454) (-456.043) [-454.443] (-457.591) -- 0:00:37
436500 -- (-458.448) (-458.057) (-455.522) [-454.592] * (-457.713) [-456.178] (-457.632) (-455.034) -- 0:00:37
437000 -- (-453.882) (-456.598) [-454.918] (-455.391) * (-456.263) [-457.412] (-457.626) (-456.311) -- 0:00:37
437500 -- (-454.404) [-455.504] (-454.972) (-458.677) * (-458.680) [-455.159] (-457.423) (-455.962) -- 0:00:37
438000 -- (-454.988) [-455.681] (-454.967) (-455.352) * (-457.366) (-454.229) [-456.161] (-457.306) -- 0:00:37
438500 -- (-454.906) (-454.946) (-454.424) [-457.146] * (-457.322) (-454.197) [-454.995] (-455.401) -- 0:00:37
439000 -- (-454.012) (-457.292) (-455.142) [-455.451] * (-456.131) [-458.435] (-455.619) (-456.385) -- 0:00:37
439500 -- (-456.214) [-454.120] (-459.199) (-456.995) * (-460.871) [-458.141] (-455.817) (-454.246) -- 0:00:36
440000 -- (-454.790) (-454.737) [-455.079] (-456.352) * [-453.669] (-454.856) (-456.713) (-459.006) -- 0:00:36
Average standard deviation of split frequencies: 0.007560
440500 -- [-455.387] (-456.388) (-455.272) (-456.594) * (-454.317) (-455.239) [-454.858] (-459.009) -- 0:00:36
441000 -- (-456.358) (-457.010) (-455.047) [-454.091] * (-457.414) [-455.226] (-455.410) (-457.920) -- 0:00:36
441500 -- (-454.758) (-454.989) (-455.460) [-455.004] * (-454.480) [-454.004] (-457.687) (-455.003) -- 0:00:36
442000 -- (-454.055) (-457.757) [-456.202] (-454.842) * (-457.825) [-456.111] (-456.404) (-455.555) -- 0:00:36
442500 -- [-454.789] (-457.881) (-461.181) (-458.626) * (-454.408) (-459.836) [-454.954] (-454.739) -- 0:00:36
443000 -- (-454.290) (-456.198) [-454.558] (-454.994) * (-455.619) (-456.395) (-457.510) [-453.897] -- 0:00:36
443500 -- (-454.322) (-455.996) [-456.869] (-455.273) * (-460.034) (-454.277) (-460.195) [-454.068] -- 0:00:36
444000 -- (-455.338) [-457.411] (-454.977) (-465.024) * (-456.180) (-457.650) [-454.666] (-458.412) -- 0:00:37
444500 -- (-453.738) (-459.048) [-455.025] (-460.725) * (-456.712) (-454.003) (-457.485) [-455.921] -- 0:00:37
445000 -- (-455.435) (-454.156) [-455.862] (-457.632) * (-461.704) (-456.862) (-455.454) [-455.893] -- 0:00:37
Average standard deviation of split frequencies: 0.007531
445500 -- (-457.305) [-457.218] (-457.239) (-458.884) * (-455.389) [-456.625] (-456.969) (-455.535) -- 0:00:37
446000 -- (-455.162) (-456.552) (-454.343) [-459.938] * [-455.318] (-456.554) (-455.680) (-454.856) -- 0:00:37
446500 -- (-455.441) [-455.656] (-454.021) (-455.749) * [-454.586] (-454.743) (-457.475) (-456.728) -- 0:00:37
447000 -- (-454.585) (-456.179) (-454.363) [-455.164] * [-455.150] (-455.411) (-463.958) (-455.595) -- 0:00:37
447500 -- [-456.996] (-455.555) (-456.323) (-455.688) * (-462.214) [-455.868] (-455.289) (-455.979) -- 0:00:37
448000 -- (-456.222) [-454.605] (-458.423) (-454.682) * [-456.118] (-454.563) (-454.663) (-458.038) -- 0:00:36
448500 -- (-453.694) (-455.167) (-456.147) [-455.511] * [-456.577] (-454.224) (-457.040) (-455.159) -- 0:00:36
449000 -- (-454.798) (-456.097) [-456.386] (-454.448) * [-454.993] (-454.958) (-456.504) (-455.952) -- 0:00:36
449500 -- (-456.212) [-458.189] (-457.963) (-456.461) * (-456.159) (-457.170) [-454.062] (-455.277) -- 0:00:36
450000 -- [-456.124] (-459.429) (-455.605) (-456.024) * [-454.308] (-458.062) (-454.772) (-455.306) -- 0:00:36
Average standard deviation of split frequencies: 0.007910
450500 -- (-456.927) (-458.019) (-457.984) [-453.558] * (-456.552) [-457.823] (-455.090) (-459.235) -- 0:00:36
451000 -- (-459.571) [-455.134] (-456.045) (-453.608) * [-458.250] (-455.840) (-456.099) (-455.580) -- 0:00:36
451500 -- (-456.469) (-455.181) [-454.361] (-454.709) * (-457.843) (-456.204) [-455.047] (-454.291) -- 0:00:36
452000 -- (-456.569) (-455.871) [-457.086] (-459.219) * [-454.916] (-454.658) (-457.659) (-455.202) -- 0:00:36
452500 -- (-454.808) [-455.739] (-456.856) (-455.622) * [-456.005] (-455.381) (-459.215) (-456.721) -- 0:00:36
453000 -- (-455.959) [-457.731] (-454.585) (-455.038) * (-455.667) (-454.821) (-454.741) [-458.844] -- 0:00:36
453500 -- (-457.254) (-455.893) (-455.057) [-454.157] * (-455.029) (-454.283) [-456.185] (-458.188) -- 0:00:36
454000 -- (-457.882) [-454.531] (-455.787) (-456.824) * (-457.769) (-456.504) (-453.707) [-454.375] -- 0:00:36
454500 -- (-457.269) (-454.030) [-454.332] (-459.243) * [-456.188] (-455.470) (-457.029) (-457.021) -- 0:00:36
455000 -- (-454.666) (-454.399) [-455.045] (-455.698) * (-454.224) (-455.279) [-456.246] (-457.843) -- 0:00:35
Average standard deviation of split frequencies: 0.008529
455500 -- [-457.512] (-455.101) (-454.380) (-459.616) * (-457.811) [-456.087] (-455.027) (-457.459) -- 0:00:35
456000 -- (-457.066) (-456.832) (-458.034) [-455.174] * [-455.612] (-458.157) (-456.892) (-460.096) -- 0:00:35
456500 -- [-453.699] (-457.626) (-459.488) (-454.268) * [-456.353] (-456.607) (-460.042) (-456.828) -- 0:00:35
457000 -- (-454.012) [-454.802] (-453.851) (-454.718) * (-458.047) [-457.441] (-456.829) (-454.629) -- 0:00:35
457500 -- [-460.238] (-457.555) (-456.701) (-457.070) * [-462.616] (-458.652) (-459.524) (-455.650) -- 0:00:35
458000 -- (-459.738) [-456.922] (-455.395) (-454.500) * (-458.536) (-458.104) (-457.159) [-457.434] -- 0:00:35
458500 -- (-456.903) (-458.585) (-456.021) [-454.524] * (-455.076) (-457.010) [-453.910] (-455.774) -- 0:00:35
459000 -- (-455.316) [-454.856] (-454.563) (-457.537) * (-458.856) (-458.219) [-455.347] (-455.390) -- 0:00:35
459500 -- (-458.395) (-456.885) [-454.956] (-454.806) * (-456.990) (-457.050) (-455.851) [-455.703] -- 0:00:35
460000 -- (-457.334) (-453.966) [-457.501] (-459.434) * (-461.399) (-458.096) [-454.408] (-454.919) -- 0:00:36
Average standard deviation of split frequencies: 0.008800
460500 -- (-456.188) [-454.648] (-456.616) (-455.505) * (-457.634) [-455.470] (-456.504) (-458.900) -- 0:00:36
461000 -- (-456.885) (-455.109) [-457.038] (-454.789) * (-455.321) (-454.334) (-455.797) [-454.941] -- 0:00:36
461500 -- (-456.486) (-457.637) (-454.935) [-458.038] * (-456.652) (-456.554) (-458.919) [-455.341] -- 0:00:36
462000 -- [-454.641] (-456.674) (-456.572) (-458.323) * (-454.416) [-456.962] (-456.208) (-454.862) -- 0:00:36
462500 -- (-454.567) (-455.231) (-456.893) [-456.621] * (-455.323) [-455.484] (-455.557) (-455.405) -- 0:00:36
463000 -- (-456.917) (-454.696) [-454.580] (-456.445) * (-455.085) [-454.047] (-455.416) (-456.588) -- 0:00:35
463500 -- (-459.216) [-457.198] (-457.245) (-454.157) * [-455.149] (-461.540) (-454.296) (-454.838) -- 0:00:35
464000 -- (-457.008) [-454.456] (-457.247) (-455.153) * [-458.124] (-456.345) (-454.011) (-456.806) -- 0:00:35
464500 -- (-454.216) (-454.500) (-456.489) [-455.222] * (-457.037) (-456.302) (-456.066) [-455.196] -- 0:00:35
465000 -- (-458.186) [-456.232] (-456.037) (-454.454) * [-458.840] (-456.720) (-456.497) (-458.098) -- 0:00:35
Average standard deviation of split frequencies: 0.008632
465500 -- (-454.516) [-454.798] (-454.576) (-456.489) * [-458.005] (-455.637) (-454.949) (-458.564) -- 0:00:35
466000 -- [-454.759] (-453.986) (-456.436) (-455.132) * (-457.425) [-456.557] (-458.073) (-458.029) -- 0:00:35
466500 -- (-457.508) (-454.995) [-455.671] (-454.917) * (-457.971) (-457.648) [-455.061] (-457.376) -- 0:00:35
467000 -- (-455.461) (-456.828) [-454.682] (-457.093) * (-457.255) (-454.126) (-456.522) [-455.532] -- 0:00:35
467500 -- (-457.035) [-455.136] (-454.695) (-457.581) * [-455.532] (-456.381) (-458.286) (-456.575) -- 0:00:35
468000 -- (-456.551) (-456.067) (-456.513) [-455.470] * (-455.476) (-454.804) [-456.305] (-454.458) -- 0:00:35
468500 -- (-455.381) (-455.341) (-456.183) [-456.371] * (-455.628) (-455.194) (-456.059) [-454.949] -- 0:00:35
469000 -- (-454.429) [-456.395] (-456.065) (-456.808) * (-456.833) [-456.827] (-457.934) (-454.752) -- 0:00:35
469500 -- (-457.316) [-456.528] (-455.934) (-454.403) * (-454.339) [-454.704] (-455.211) (-457.250) -- 0:00:35
470000 -- (-457.363) [-454.718] (-462.593) (-454.555) * (-454.764) (-459.841) [-454.593] (-456.372) -- 0:00:34
Average standard deviation of split frequencies: 0.008814
470500 -- [-454.157] (-455.304) (-455.645) (-454.642) * (-456.754) (-454.115) (-455.581) [-454.606] -- 0:00:34
471000 -- (-455.271) (-454.972) [-454.022] (-455.134) * (-457.343) (-455.883) (-455.389) [-455.648] -- 0:00:34
471500 -- (-460.295) (-457.847) [-455.029] (-455.278) * (-455.838) (-460.140) (-457.534) [-454.376] -- 0:00:34
472000 -- (-456.091) [-455.094] (-459.710) (-456.571) * (-456.491) (-455.076) (-460.059) [-458.937] -- 0:00:34
472500 -- (-457.863) [-454.422] (-456.421) (-455.638) * (-455.717) (-454.641) [-456.352] (-454.598) -- 0:00:34
473000 -- (-458.267) (-454.222) [-457.727] (-455.977) * (-455.697) (-457.081) (-455.168) [-456.192] -- 0:00:34
473500 -- (-455.141) (-457.063) (-457.258) [-456.378] * (-456.454) [-455.902] (-463.786) (-456.745) -- 0:00:34
474000 -- (-454.343) (-456.616) [-454.921] (-454.420) * (-454.626) (-456.882) (-458.478) [-455.447] -- 0:00:34
474500 -- (-455.884) (-457.962) [-455.619] (-457.432) * (-453.972) (-454.683) (-455.304) [-460.037] -- 0:00:35
475000 -- (-455.095) (-458.779) [-455.162] (-455.378) * (-453.681) (-453.912) (-456.227) [-454.716] -- 0:00:35
Average standard deviation of split frequencies: 0.008649
475500 -- (-454.837) [-456.771] (-455.211) (-456.515) * (-457.225) (-456.022) [-458.238] (-455.815) -- 0:00:35
476000 -- (-453.878) (-458.988) [-454.474] (-455.885) * [-457.726] (-456.028) (-454.122) (-458.623) -- 0:00:35
476500 -- (-454.060) (-454.525) [-456.131] (-459.472) * [-456.060] (-455.425) (-459.207) (-455.442) -- 0:00:35
477000 -- (-455.913) [-453.883] (-453.842) (-456.585) * (-458.310) [-454.393] (-455.496) (-456.919) -- 0:00:35
477500 -- (-455.922) (-454.716) [-454.436] (-454.261) * (-454.482) (-454.272) [-456.769] (-454.372) -- 0:00:35
478000 -- (-454.941) (-455.970) [-456.004] (-454.859) * (-454.519) (-458.935) [-459.783] (-457.171) -- 0:00:34
478500 -- [-456.063] (-459.559) (-461.924) (-459.090) * (-456.811) [-455.092] (-454.259) (-456.479) -- 0:00:34
479000 -- (-454.531) (-455.395) (-454.326) [-456.338] * [-454.227] (-456.085) (-454.036) (-454.213) -- 0:00:34
479500 -- (-455.892) (-457.553) [-456.624] (-454.343) * [-455.374] (-458.930) (-454.438) (-453.937) -- 0:00:34
480000 -- [-455.836] (-457.389) (-454.704) (-456.944) * (-457.975) (-455.644) (-456.327) [-454.010] -- 0:00:34
Average standard deviation of split frequencies: 0.009153
480500 -- [-455.484] (-457.796) (-455.687) (-456.515) * (-456.367) [-454.199] (-454.510) (-458.586) -- 0:00:34
481000 -- [-458.550] (-453.948) (-456.980) (-460.222) * (-457.580) (-459.135) (-458.777) [-457.870] -- 0:00:34
481500 -- (-456.322) (-455.931) [-454.862] (-457.337) * (-455.477) (-456.026) (-456.667) [-456.779] -- 0:00:34
482000 -- (-455.803) (-457.051) [-456.965] (-454.577) * (-455.019) (-457.520) (-460.872) [-457.154] -- 0:00:34
482500 -- (-457.261) (-455.545) [-455.567] (-460.458) * (-454.153) (-454.623) (-455.933) [-458.243] -- 0:00:34
483000 -- [-459.411] (-456.847) (-455.606) (-456.935) * (-453.788) (-457.509) [-457.424] (-457.367) -- 0:00:34
483500 -- [-456.048] (-454.844) (-454.021) (-454.895) * (-454.966) (-458.308) [-458.040] (-457.361) -- 0:00:34
484000 -- (-457.574) (-454.606) [-454.663] (-454.458) * (-455.507) (-461.152) [-453.600] (-454.723) -- 0:00:34
484500 -- (-455.735) (-455.212) (-458.952) [-454.296] * [-456.556] (-456.722) (-454.904) (-453.967) -- 0:00:34
485000 -- (-454.386) (-455.081) (-457.230) [-455.372] * (-454.941) [-456.590] (-457.330) (-455.547) -- 0:00:33
Average standard deviation of split frequencies: 0.008988
485500 -- [-456.212] (-456.915) (-456.247) (-456.618) * (-458.688) [-454.869] (-456.502) (-455.179) -- 0:00:33
486000 -- (-456.271) (-464.202) (-455.193) [-454.970] * (-462.759) [-454.488] (-455.598) (-456.864) -- 0:00:33
486500 -- (-454.880) (-457.470) (-455.546) [-454.655] * (-457.614) [-460.102] (-455.554) (-455.608) -- 0:00:33
487000 -- (-455.224) [-454.597] (-457.027) (-455.954) * (-458.129) [-454.578] (-455.347) (-458.403) -- 0:00:33
487500 -- (-454.778) [-454.690] (-456.473) (-455.775) * (-454.747) [-455.076] (-456.361) (-454.502) -- 0:00:33
488000 -- [-454.682] (-456.866) (-455.370) (-458.085) * [-457.242] (-457.246) (-454.838) (-454.437) -- 0:00:33
488500 -- (-454.799) (-457.320) [-454.907] (-454.121) * (-457.515) [-458.759] (-455.198) (-455.054) -- 0:00:33
489000 -- (-455.100) [-456.401] (-455.133) (-456.202) * (-456.862) (-455.427) (-454.582) [-454.705] -- 0:00:33
489500 -- [-455.420] (-456.945) (-456.713) (-455.325) * (-454.220) (-453.774) [-453.993] (-454.808) -- 0:00:34
490000 -- (-458.762) (-455.113) [-457.427] (-456.161) * (-455.612) (-457.666) (-456.255) [-454.643] -- 0:00:34
Average standard deviation of split frequencies: 0.009607
490500 -- (-454.667) [-456.232] (-454.894) (-454.660) * (-456.774) (-457.824) [-456.404] (-459.919) -- 0:00:34
491000 -- (-458.379) (-455.168) [-455.485] (-455.598) * (-456.077) [-455.971] (-457.457) (-455.071) -- 0:00:34
491500 -- (-455.081) [-455.485] (-457.259) (-455.691) * (-454.551) [-454.622] (-454.499) (-454.819) -- 0:00:34
492000 -- (-460.911) [-457.416] (-456.294) (-463.879) * (-458.681) [-455.270] (-456.219) (-456.249) -- 0:00:34
492500 -- (-456.818) (-462.293) (-456.721) [-456.916] * [-454.997] (-454.278) (-458.547) (-456.778) -- 0:00:34
493000 -- (-456.084) (-455.754) (-456.678) [-457.528] * (-458.751) [-456.850] (-456.147) (-455.015) -- 0:00:33
493500 -- [-455.847] (-453.582) (-456.919) (-455.035) * [-454.870] (-461.791) (-456.277) (-457.062) -- 0:00:33
494000 -- (-457.018) (-454.698) (-455.302) [-454.394] * (-454.726) (-456.272) [-456.452] (-457.660) -- 0:00:33
494500 -- (-454.304) [-454.783] (-455.588) (-456.434) * (-454.823) [-455.497] (-455.465) (-454.713) -- 0:00:33
495000 -- [-457.881] (-455.462) (-455.492) (-462.185) * (-456.054) (-457.156) [-462.305] (-454.253) -- 0:00:33
Average standard deviation of split frequencies: 0.009504
495500 -- (-454.684) [-454.906] (-455.779) (-461.346) * [-453.768] (-455.423) (-460.270) (-454.711) -- 0:00:33
496000 -- (-462.312) (-454.795) [-454.468] (-456.448) * (-456.301) (-463.279) [-454.701] (-454.484) -- 0:00:33
496500 -- (-455.312) [-453.657] (-455.843) (-458.794) * (-455.798) [-456.040] (-454.000) (-454.510) -- 0:00:33
497000 -- (-459.028) (-456.988) (-458.023) [-454.077] * (-456.352) [-455.370] (-454.195) (-455.702) -- 0:00:33
497500 -- (-457.551) (-454.488) [-457.159] (-453.508) * (-456.030) [-455.801] (-456.517) (-455.454) -- 0:00:33
498000 -- [-455.469] (-460.959) (-456.702) (-456.032) * (-455.878) (-454.949) [-455.738] (-458.709) -- 0:00:33
498500 -- (-454.923) (-454.835) (-454.519) [-456.595] * (-455.317) (-454.631) (-455.575) [-457.965] -- 0:00:33
499000 -- [-457.901] (-455.833) (-454.302) (-455.471) * (-453.984) [-455.033] (-455.168) (-457.020) -- 0:00:33
499500 -- (-456.976) (-457.616) [-456.312] (-454.689) * (-455.266) (-457.727) [-455.064] (-458.722) -- 0:00:33
500000 -- (-456.802) [-459.035] (-457.539) (-457.901) * (-456.512) [-456.845] (-456.372) (-455.133) -- 0:00:33
Average standard deviation of split frequencies: 0.009290
500500 -- (-463.785) (-460.967) (-457.466) [-455.398] * (-461.561) (-457.522) [-457.306] (-462.994) -- 0:00:32
501000 -- (-456.265) (-462.097) (-457.399) [-453.844] * (-456.751) (-456.712) [-455.693] (-455.194) -- 0:00:32
501500 -- (-455.695) [-457.214] (-455.180) (-459.118) * (-455.753) [-457.688] (-456.425) (-454.078) -- 0:00:32
502000 -- [-456.581] (-454.302) (-457.866) (-454.746) * (-458.671) [-454.188] (-456.114) (-455.490) -- 0:00:32
502500 -- (-456.990) [-454.868] (-454.904) (-455.294) * (-457.712) (-456.366) [-456.845] (-455.343) -- 0:00:32
503000 -- [-456.013] (-456.020) (-455.694) (-455.039) * [-457.545] (-459.589) (-454.974) (-455.206) -- 0:00:32
503500 -- [-455.192] (-454.622) (-455.793) (-455.116) * (-455.952) (-456.073) (-460.240) [-454.306] -- 0:00:32
504000 -- [-455.009] (-456.399) (-455.899) (-458.806) * (-455.550) (-455.193) [-461.310] (-454.529) -- 0:00:32
504500 -- (-458.312) (-455.140) (-455.625) [-455.019] * (-457.155) (-454.746) [-457.201] (-462.752) -- 0:00:32
505000 -- (-456.168) [-454.409] (-456.304) (-455.881) * (-455.975) [-456.454] (-455.283) (-455.837) -- 0:00:32
Average standard deviation of split frequencies: 0.008944
505500 -- (-457.689) (-455.603) [-457.970] (-460.163) * (-455.335) [-454.837] (-456.681) (-455.056) -- 0:00:32
506000 -- (-458.328) [-453.762] (-459.191) (-458.821) * (-457.562) [-454.388] (-454.879) (-456.313) -- 0:00:33
506500 -- (-454.711) [-455.724] (-457.237) (-457.091) * (-458.178) (-454.339) (-455.527) [-456.469] -- 0:00:33
507000 -- (-456.067) (-457.561) (-460.633) [-454.689] * (-455.270) [-456.172] (-455.123) (-459.675) -- 0:00:33
507500 -- (-455.032) (-455.991) [-456.936] (-456.760) * (-454.284) (-459.488) [-455.827] (-454.379) -- 0:00:32
508000 -- (-455.150) (-458.161) (-454.219) [-453.628] * (-454.665) (-453.748) [-456.849] (-454.289) -- 0:00:32
508500 -- (-458.181) (-455.645) [-454.985] (-457.671) * (-454.655) [-454.338] (-457.708) (-454.711) -- 0:00:32
509000 -- (-454.675) (-454.955) (-463.097) [-455.962] * (-456.855) [-455.387] (-456.225) (-457.364) -- 0:00:32
509500 -- (-457.359) (-457.650) [-455.602] (-454.482) * (-456.798) [-457.668] (-457.619) (-456.835) -- 0:00:32
510000 -- (-455.614) (-461.093) (-456.208) [-456.720] * [-455.473] (-459.603) (-460.081) (-455.227) -- 0:00:32
Average standard deviation of split frequencies: 0.009170
510500 -- (-455.372) (-454.716) (-458.454) [-456.284] * (-459.201) [-459.274] (-455.073) (-458.316) -- 0:00:32
511000 -- (-455.148) (-455.962) (-456.882) [-454.504] * (-456.815) (-456.780) [-455.399] (-459.944) -- 0:00:32
511500 -- (-455.994) (-457.842) [-456.420] (-454.787) * [-456.280] (-458.687) (-457.995) (-454.719) -- 0:00:32
512000 -- (-455.286) (-455.507) [-455.059] (-461.025) * (-456.874) [-457.040] (-460.464) (-456.388) -- 0:00:32
512500 -- (-455.310) (-460.197) (-455.596) [-454.618] * (-456.068) (-456.182) [-460.547] (-454.287) -- 0:00:32
513000 -- (-454.645) [-457.496] (-456.559) (-455.757) * (-456.379) (-456.248) (-461.120) [-456.100] -- 0:00:32
513500 -- (-455.077) (-460.852) [-454.172] (-457.864) * (-455.827) (-456.130) [-458.667] (-455.307) -- 0:00:32
514000 -- (-457.584) (-459.274) (-455.416) [-455.015] * (-465.177) (-458.443) [-454.850] (-455.770) -- 0:00:32
514500 -- (-456.364) (-459.840) (-462.075) [-454.898] * [-458.069] (-463.203) (-455.595) (-455.482) -- 0:00:32
515000 -- [-454.768] (-454.807) (-461.640) (-455.368) * (-458.365) [-455.081] (-459.684) (-457.084) -- 0:00:32
Average standard deviation of split frequencies: 0.008953
515500 -- (-456.903) [-454.518] (-460.350) (-457.097) * (-456.736) (-457.640) (-457.754) [-457.521] -- 0:00:31
516000 -- [-454.735] (-456.087) (-457.439) (-457.687) * (-454.938) [-457.009] (-457.751) (-456.962) -- 0:00:31
516500 -- [-455.405] (-454.775) (-463.728) (-456.540) * (-457.557) (-454.493) [-455.874] (-461.592) -- 0:00:31
517000 -- (-459.812) (-456.805) (-455.384) [-457.552] * (-455.065) (-456.726) (-457.099) [-454.611] -- 0:00:31
517500 -- (-454.648) (-455.505) (-456.689) [-457.358] * (-454.591) [-458.027] (-454.752) (-459.415) -- 0:00:31
518000 -- (-454.458) (-457.338) (-454.527) [-454.887] * [-455.821] (-456.237) (-455.972) (-458.107) -- 0:00:31
518500 -- (-457.615) (-460.940) [-454.124] (-454.249) * (-458.617) [-455.820] (-458.581) (-457.231) -- 0:00:31
519000 -- (-458.505) (-459.091) [-454.141] (-454.491) * (-456.079) (-455.492) [-458.244] (-455.183) -- 0:00:31
519500 -- (-459.015) [-458.557] (-455.275) (-456.909) * [-458.409] (-454.323) (-455.293) (-456.818) -- 0:00:31
520000 -- (-456.044) (-455.917) (-455.273) [-458.328] * [-453.793] (-455.151) (-454.475) (-456.837) -- 0:00:31
Average standard deviation of split frequencies: 0.008812
520500 -- (-454.863) (-454.449) (-459.059) [-458.172] * (-454.842) [-453.630] (-457.249) (-458.531) -- 0:00:31
521000 -- (-454.592) [-457.196] (-456.694) (-455.033) * [-454.862] (-454.963) (-458.140) (-455.759) -- 0:00:31
521500 -- (-454.432) (-458.415) [-455.681] (-453.862) * (-457.220) (-456.389) (-457.800) [-454.316] -- 0:00:31
522000 -- [-454.570] (-456.072) (-455.013) (-456.050) * (-458.244) (-456.053) (-458.770) [-455.509] -- 0:00:32
522500 -- (-455.309) (-455.585) [-458.177] (-456.087) * (-454.742) [-455.429] (-456.797) (-456.243) -- 0:00:31
523000 -- [-455.352] (-455.282) (-458.942) (-456.042) * (-456.472) (-458.033) (-458.196) [-454.529] -- 0:00:31
523500 -- (-457.890) (-455.177) (-454.882) [-454.720] * (-455.809) [-457.948] (-454.712) (-455.534) -- 0:00:31
524000 -- (-460.367) [-453.750] (-457.407) (-457.001) * (-455.838) (-455.218) (-456.589) [-459.573] -- 0:00:31
524500 -- (-458.190) [-454.924] (-455.896) (-455.433) * [-454.386] (-459.080) (-455.643) (-454.072) -- 0:00:31
525000 -- (-457.391) (-458.397) (-454.907) [-455.110] * (-456.059) (-459.189) (-455.196) [-453.891] -- 0:00:31
Average standard deviation of split frequencies: 0.009380
525500 -- (-459.521) (-454.244) [-460.038] (-459.502) * [-454.414] (-455.084) (-455.203) (-455.908) -- 0:00:31
526000 -- (-456.684) [-455.128] (-459.719) (-453.768) * [-454.999] (-456.657) (-454.409) (-458.081) -- 0:00:31
526500 -- (-458.018) [-454.208] (-456.909) (-456.745) * [-455.351] (-456.515) (-455.947) (-456.998) -- 0:00:31
527000 -- (-458.617) (-454.598) (-455.617) [-455.993] * (-453.677) [-454.745] (-453.949) (-456.550) -- 0:00:31
527500 -- (-455.590) [-460.836] (-453.986) (-456.668) * (-453.583) [-454.309] (-456.566) (-456.319) -- 0:00:31
528000 -- (-455.265) (-460.602) [-455.925] (-456.327) * [-454.584] (-458.046) (-454.343) (-457.382) -- 0:00:31
528500 -- (-456.248) [-457.771] (-456.270) (-453.723) * (-455.873) [-454.573] (-456.228) (-454.442) -- 0:00:31
529000 -- (-456.236) (-456.693) [-456.710] (-455.761) * (-455.974) (-455.642) (-456.057) [-455.678] -- 0:00:31
529500 -- (-454.489) (-460.733) [-455.939] (-454.430) * (-454.922) (-454.696) (-454.277) [-455.842] -- 0:00:31
530000 -- (-459.526) [-456.565] (-456.096) (-456.803) * (-454.976) (-454.106) (-457.788) [-458.312] -- 0:00:31
Average standard deviation of split frequencies: 0.009416
530500 -- [-454.827] (-455.378) (-456.817) (-455.035) * (-457.962) [-457.562] (-456.019) (-460.160) -- 0:00:30
531000 -- [-454.248] (-454.040) (-464.072) (-456.089) * (-456.617) (-455.146) [-455.561] (-459.568) -- 0:00:30
531500 -- (-459.585) (-464.033) (-457.057) [-458.471] * [-456.356] (-464.901) (-453.764) (-464.750) -- 0:00:30
532000 -- (-455.097) (-461.982) [-456.885] (-456.847) * (-454.362) [-459.380] (-453.725) (-458.421) -- 0:00:30
532500 -- (-456.128) (-458.414) [-455.111] (-457.362) * [-455.299] (-456.593) (-455.291) (-458.934) -- 0:00:30
533000 -- (-456.870) (-456.296) (-453.850) [-455.439] * (-455.668) (-457.982) [-454.537] (-454.872) -- 0:00:30
533500 -- (-458.138) (-454.940) (-455.084) [-456.683] * (-457.031) (-457.139) [-454.713] (-457.062) -- 0:00:30
534000 -- [-454.911] (-457.977) (-456.929) (-456.342) * (-455.165) [-455.676] (-454.421) (-455.924) -- 0:00:30
534500 -- [-457.332] (-456.084) (-458.018) (-458.615) * (-458.385) (-453.971) [-454.693] (-455.989) -- 0:00:30
535000 -- [-458.201] (-454.983) (-457.064) (-455.817) * (-457.672) (-455.387) [-456.718] (-456.882) -- 0:00:30
Average standard deviation of split frequencies: 0.009205
535500 -- (-459.388) (-457.409) [-454.003] (-454.830) * [-456.414] (-454.711) (-454.131) (-455.912) -- 0:00:30
536000 -- [-456.410] (-455.975) (-454.032) (-454.399) * (-455.348) (-455.981) [-453.675] (-457.210) -- 0:00:30
536500 -- (-456.033) [-455.524] (-454.473) (-456.888) * (-456.770) (-457.970) [-456.366] (-454.906) -- 0:00:30
537000 -- (-454.806) (-456.661) [-454.830] (-460.173) * (-454.885) (-459.727) [-455.057] (-455.279) -- 0:00:30
537500 -- [-454.806] (-454.750) (-456.975) (-463.766) * (-455.985) (-458.425) [-455.009] (-454.699) -- 0:00:30
538000 -- (-457.884) [-456.880] (-455.879) (-458.018) * [-455.792] (-456.169) (-456.267) (-457.046) -- 0:00:30
538500 -- (-456.795) (-456.003) [-459.082] (-455.464) * (-454.805) (-456.290) (-455.626) [-455.867] -- 0:00:30
539000 -- (-456.053) [-457.135] (-456.779) (-455.035) * [-454.748] (-454.384) (-456.762) (-459.363) -- 0:00:30
539500 -- [-454.122] (-456.161) (-456.867) (-457.618) * (-457.969) [-455.127] (-454.116) (-455.535) -- 0:00:30
540000 -- (-454.835) (-455.751) (-458.220) [-455.019] * (-457.816) (-455.226) (-458.895) [-457.295] -- 0:00:30
Average standard deviation of split frequencies: 0.009010
540500 -- (-462.881) (-457.829) [-456.067] (-457.692) * (-456.777) (-454.808) (-456.842) [-456.683] -- 0:00:30
541000 -- [-458.249] (-455.769) (-456.797) (-457.237) * (-456.741) (-454.824) (-457.829) [-457.897] -- 0:00:30
541500 -- (-459.214) [-456.130] (-460.493) (-455.338) * (-457.584) [-457.206] (-455.209) (-458.643) -- 0:00:30
542000 -- (-458.676) (-456.863) (-455.643) [-456.372] * (-456.124) (-454.804) [-454.815] (-458.228) -- 0:00:30
542500 -- (-462.833) (-454.693) (-455.189) [-456.892] * (-456.484) (-455.342) [-453.997] (-456.374) -- 0:00:30
543000 -- (-460.553) [-455.332] (-455.570) (-454.818) * (-455.016) [-458.885] (-453.890) (-455.690) -- 0:00:30
543500 -- [-459.582] (-457.387) (-459.865) (-456.827) * (-454.845) [-457.060] (-454.375) (-454.328) -- 0:00:30
544000 -- (-455.998) (-456.561) [-457.431] (-455.510) * (-455.154) (-457.605) [-455.010] (-459.915) -- 0:00:30
544500 -- (-455.352) (-456.970) [-457.549] (-457.055) * (-455.799) [-454.077] (-458.767) (-456.072) -- 0:00:30
545000 -- (-458.452) (-456.162) (-457.396) [-453.648] * (-455.494) [-454.838] (-455.277) (-454.944) -- 0:00:30
Average standard deviation of split frequencies: 0.008806
545500 -- (-457.310) [-457.011] (-457.466) (-453.622) * [-455.653] (-455.083) (-455.151) (-458.902) -- 0:00:29
546000 -- (-460.285) [-455.788] (-453.997) (-454.438) * (-455.294) (-455.343) (-455.881) [-455.978] -- 0:00:29
546500 -- (-455.651) (-460.089) [-455.098] (-457.296) * [-455.274] (-455.176) (-456.808) (-459.540) -- 0:00:29
547000 -- (-462.265) (-457.151) [-454.970] (-457.647) * (-454.730) [-455.593] (-454.753) (-458.736) -- 0:00:29
547500 -- (-454.796) [-455.019] (-454.581) (-458.600) * (-454.498) [-455.200] (-456.011) (-459.909) -- 0:00:29
548000 -- [-455.737] (-455.809) (-457.156) (-457.399) * (-454.999) [-456.556] (-457.055) (-463.184) -- 0:00:29
548500 -- (-458.865) (-455.648) [-454.780] (-454.477) * (-456.178) (-454.216) (-458.646) [-455.037] -- 0:00:29
549000 -- (-466.052) (-456.927) (-455.200) [-455.527] * [-457.304] (-458.278) (-456.541) (-455.234) -- 0:00:29
549500 -- (-455.079) (-457.094) [-455.285] (-454.327) * (-456.622) [-454.808] (-462.279) (-455.695) -- 0:00:29
550000 -- [-457.529] (-456.272) (-453.938) (-455.136) * [-455.302] (-453.707) (-462.167) (-453.756) -- 0:00:29
Average standard deviation of split frequencies: 0.008618
550500 -- (-455.949) (-455.258) [-456.058] (-455.224) * (-461.141) [-454.252] (-458.467) (-457.791) -- 0:00:29
551000 -- [-456.146] (-455.473) (-454.610) (-459.661) * [-458.235] (-454.320) (-458.703) (-461.908) -- 0:00:29
551500 -- (-457.921) [-454.991] (-454.900) (-461.251) * (-456.374) [-453.772] (-455.550) (-458.002) -- 0:00:29
552000 -- [-459.547] (-457.676) (-456.168) (-454.653) * (-457.915) (-457.173) (-458.129) [-457.361] -- 0:00:29
552500 -- [-454.499] (-455.471) (-454.900) (-454.035) * (-453.968) [-454.554] (-458.622) (-455.877) -- 0:00:29
553000 -- (-455.676) [-462.769] (-455.082) (-454.035) * (-457.389) (-458.726) (-461.380) [-457.346] -- 0:00:29
553500 -- (-453.848) (-455.012) (-458.095) [-454.965] * (-454.642) (-453.768) [-455.020] (-456.813) -- 0:00:29
554000 -- (-457.626) [-456.191] (-457.174) (-456.512) * [-455.504] (-454.656) (-455.462) (-460.663) -- 0:00:29
554500 -- (-454.293) [-456.371] (-454.418) (-454.161) * (-455.038) (-454.027) [-454.517] (-455.636) -- 0:00:29
555000 -- [-456.748] (-456.478) (-459.252) (-459.883) * (-456.987) (-454.183) [-455.278] (-457.737) -- 0:00:29
Average standard deviation of split frequencies: 0.008648
555500 -- [-457.482] (-455.811) (-454.665) (-455.743) * (-454.253) (-454.894) [-457.174] (-458.424) -- 0:00:29
556000 -- (-455.573) (-454.441) (-454.735) [-454.490] * (-456.297) (-455.355) (-454.198) [-453.626] -- 0:00:29
556500 -- [-455.524] (-455.331) (-454.457) (-455.048) * [-456.181] (-457.688) (-454.500) (-456.298) -- 0:00:29
557000 -- (-454.609) (-457.887) (-454.178) [-455.480] * (-454.641) (-457.404) [-457.733] (-457.061) -- 0:00:29
557500 -- (-456.250) (-454.732) [-454.241] (-455.580) * (-454.703) (-454.367) (-455.761) [-458.713] -- 0:00:29
558000 -- (-456.759) (-455.226) [-454.034] (-455.669) * (-454.765) [-456.450] (-453.849) (-459.533) -- 0:00:29
558500 -- (-454.540) [-455.429] (-460.090) (-454.749) * [-459.768] (-456.897) (-454.672) (-455.043) -- 0:00:29
559000 -- [-456.887] (-455.637) (-455.584) (-455.516) * (-460.069) [-453.930] (-463.137) (-458.546) -- 0:00:29
559500 -- (-456.176) [-457.400] (-455.577) (-455.275) * [-459.663] (-454.439) (-458.004) (-454.978) -- 0:00:29
560000 -- [-456.318] (-454.926) (-456.027) (-459.142) * (-459.645) (-453.708) [-457.414] (-456.601) -- 0:00:29
Average standard deviation of split frequencies: 0.008520
560500 -- (-455.273) (-456.168) (-454.731) [-459.148] * [-458.318] (-454.966) (-456.569) (-455.577) -- 0:00:29
561000 -- [-456.906] (-455.603) (-454.695) (-459.506) * (-458.801) (-457.345) (-459.494) [-455.037] -- 0:00:28
561500 -- (-457.763) (-456.151) [-454.059] (-460.272) * [-455.032] (-454.468) (-455.029) (-456.961) -- 0:00:28
562000 -- (-455.965) (-454.278) [-456.937] (-454.755) * [-454.527] (-455.559) (-456.668) (-456.188) -- 0:00:28
562500 -- (-458.130) (-453.869) (-455.878) [-453.799] * (-455.510) [-454.271] (-456.166) (-456.869) -- 0:00:28
563000 -- (-456.960) [-454.461] (-454.901) (-453.960) * (-454.146) [-458.593] (-455.593) (-460.382) -- 0:00:28
563500 -- [-457.583] (-455.997) (-456.202) (-457.457) * (-456.263) [-458.772] (-454.454) (-456.991) -- 0:00:28
564000 -- [-454.648] (-456.073) (-454.744) (-455.491) * (-457.060) (-454.809) (-456.919) [-455.352] -- 0:00:28
564500 -- [-456.488] (-457.194) (-457.830) (-458.117) * (-457.889) (-455.870) (-454.337) [-459.279] -- 0:00:28
565000 -- (-460.683) (-456.028) (-455.107) [-456.632] * [-457.757] (-456.210) (-455.056) (-456.527) -- 0:00:28
Average standard deviation of split frequencies: 0.008606
565500 -- (-455.813) (-456.845) [-454.273] (-456.375) * (-455.670) [-455.122] (-456.999) (-456.554) -- 0:00:28
566000 -- (-463.372) (-455.925) [-455.422] (-458.914) * [-454.574] (-459.702) (-455.338) (-461.024) -- 0:00:28
566500 -- [-454.634] (-454.960) (-456.453) (-456.349) * [-458.223] (-455.873) (-454.592) (-457.434) -- 0:00:28
567000 -- (-455.077) (-460.322) (-454.925) [-457.691] * (-457.942) (-456.762) [-455.970] (-457.234) -- 0:00:28
567500 -- (-458.647) (-455.058) (-455.210) [-457.217] * (-457.970) (-455.237) (-455.115) [-457.769] -- 0:00:28
568000 -- (-457.787) [-454.528] (-454.798) (-458.798) * (-460.041) (-455.775) [-455.094] (-456.336) -- 0:00:28
568500 -- (-457.039) (-460.936) (-454.554) [-456.848] * [-455.180] (-454.804) (-456.987) (-459.556) -- 0:00:28
569000 -- [-456.186] (-456.960) (-455.226) (-454.826) * [-458.442] (-454.288) (-455.234) (-460.491) -- 0:00:28
569500 -- (-454.744) [-458.301] (-456.273) (-455.231) * (-455.898) [-456.315] (-454.038) (-457.003) -- 0:00:28
570000 -- (-458.310) (-455.479) (-457.613) [-454.344] * [-455.402] (-458.711) (-456.856) (-455.003) -- 0:00:28
Average standard deviation of split frequencies: 0.008591
570500 -- (-457.214) (-456.361) [-461.536] (-456.133) * (-459.486) (-457.771) [-454.932] (-458.047) -- 0:00:28
571000 -- (-458.091) (-453.759) [-454.503] (-457.542) * [-456.363] (-459.728) (-459.968) (-456.707) -- 0:00:28
571500 -- (-457.649) [-456.288] (-455.771) (-454.841) * (-455.935) (-456.171) (-459.274) [-455.436] -- 0:00:28
572000 -- (-456.571) (-454.770) [-456.156] (-455.289) * (-455.738) [-456.573] (-456.593) (-456.568) -- 0:00:28
572500 -- (-457.353) [-458.284] (-458.065) (-456.487) * (-456.324) (-456.607) (-455.821) [-457.156] -- 0:00:28
573000 -- (-455.016) [-457.702] (-460.387) (-457.557) * (-457.151) (-454.593) [-455.602] (-456.517) -- 0:00:28
573500 -- (-454.484) [-458.140] (-454.976) (-456.169) * (-457.208) (-454.743) [-453.790] (-454.352) -- 0:00:28
574000 -- (-455.169) (-453.818) (-457.906) [-454.353] * (-456.727) (-457.084) [-454.513] (-455.669) -- 0:00:28
574500 -- [-454.115] (-456.860) (-458.209) (-455.460) * [-456.403] (-461.958) (-454.348) (-456.375) -- 0:00:28
575000 -- (-458.388) [-454.935] (-456.278) (-458.848) * (-459.793) (-458.374) (-454.736) [-455.349] -- 0:00:28
Average standard deviation of split frequencies: 0.008621
575500 -- [-455.982] (-455.906) (-456.309) (-459.790) * (-456.383) [-456.246] (-454.397) (-457.007) -- 0:00:28
576000 -- (-457.797) (-457.340) (-457.727) [-455.815] * [-455.487] (-454.606) (-455.222) (-454.549) -- 0:00:27
576500 -- (-455.784) (-458.639) [-457.428] (-454.307) * (-458.645) (-454.865) [-455.498] (-454.613) -- 0:00:27
577000 -- (-459.233) (-454.229) [-456.709] (-459.343) * (-455.380) [-454.573] (-455.194) (-457.271) -- 0:00:27
577500 -- (-458.954) (-457.570) (-455.909) [-456.671] * (-454.396) (-457.022) [-454.209] (-457.664) -- 0:00:27
578000 -- [-455.466] (-457.613) (-453.896) (-460.362) * (-456.333) [-455.252] (-453.956) (-455.479) -- 0:00:27
578500 -- (-455.928) (-458.717) [-458.087] (-459.105) * (-459.282) (-456.840) (-455.834) [-453.744] -- 0:00:27
579000 -- (-454.544) (-457.050) (-457.876) [-455.369] * (-456.385) (-454.924) [-456.716] (-455.945) -- 0:00:27
579500 -- (-454.756) (-460.689) (-454.267) [-454.776] * (-455.281) (-454.356) [-457.504] (-456.347) -- 0:00:27
580000 -- [-455.588] (-457.300) (-456.517) (-457.723) * (-460.252) (-455.661) [-454.328] (-455.672) -- 0:00:27
Average standard deviation of split frequencies: 0.008497
580500 -- (-455.824) (-455.360) [-455.510] (-458.505) * [-456.771] (-456.817) (-454.221) (-455.286) -- 0:00:27
581000 -- (-458.504) [-457.221] (-455.171) (-458.359) * (-456.784) (-456.614) (-455.941) [-457.359] -- 0:00:27
581500 -- (-458.796) (-454.140) [-455.084] (-456.026) * (-455.771) (-455.909) (-456.595) [-456.546] -- 0:00:27
582000 -- (-457.058) [-454.985] (-457.181) (-455.992) * (-456.860) (-454.959) [-458.568] (-454.285) -- 0:00:27
582500 -- (-457.362) (-456.451) (-456.477) [-455.680] * [-457.887] (-456.168) (-458.121) (-454.186) -- 0:00:27
583000 -- (-456.636) (-456.907) (-455.064) [-454.640] * (-457.534) [-455.087] (-455.157) (-455.476) -- 0:00:27
583500 -- (-456.783) (-455.153) (-455.834) [-454.087] * (-455.014) (-454.817) (-455.984) [-454.711] -- 0:00:27
584000 -- (-460.771) (-455.240) [-458.796] (-454.899) * (-454.586) (-456.087) [-455.905] (-455.231) -- 0:00:27
584500 -- (-460.040) [-457.140] (-455.277) (-458.737) * [-455.208] (-454.270) (-456.335) (-454.191) -- 0:00:27
585000 -- (-456.094) [-456.001] (-455.204) (-454.032) * (-459.324) (-459.347) [-460.225] (-454.878) -- 0:00:27
Average standard deviation of split frequencies: 0.008527
585500 -- (-456.531) [-453.828] (-455.866) (-456.076) * (-454.633) [-455.973] (-455.052) (-455.595) -- 0:00:27
586000 -- (-456.911) (-456.716) (-456.577) [-459.002] * [-454.785] (-456.576) (-459.391) (-457.032) -- 0:00:27
586500 -- (-454.462) [-456.764] (-458.067) (-458.971) * [-453.919] (-456.344) (-459.723) (-457.256) -- 0:00:27
587000 -- (-457.439) (-457.172) (-456.825) [-455.379] * (-454.862) [-457.501] (-458.165) (-455.512) -- 0:00:27
587500 -- [-455.740] (-461.973) (-459.097) (-459.277) * (-456.747) [-458.538] (-457.056) (-454.489) -- 0:00:27
588000 -- (-461.418) [-456.448] (-455.972) (-456.311) * (-458.048) [-457.977] (-457.521) (-456.176) -- 0:00:27
588500 -- (-459.826) [-454.838] (-455.442) (-455.381) * (-455.321) [-457.299] (-455.145) (-458.489) -- 0:00:27
589000 -- (-456.514) (-456.001) [-456.039] (-454.548) * (-455.240) (-456.901) (-456.579) [-455.730] -- 0:00:27
589500 -- [-455.220] (-454.472) (-454.189) (-455.571) * [-454.210] (-457.722) (-456.928) (-454.418) -- 0:00:27
590000 -- (-455.285) (-456.727) [-454.109] (-457.224) * (-455.012) (-456.820) [-457.591] (-456.360) -- 0:00:27
Average standard deviation of split frequencies: 0.008141
590500 -- [-455.437] (-456.264) (-461.773) (-453.876) * (-456.828) (-454.764) [-455.422] (-458.250) -- 0:00:27
591000 -- (-456.954) (-455.355) (-458.638) [-454.593] * (-456.467) (-456.336) (-455.343) [-455.543] -- 0:00:26
591500 -- (-453.933) (-455.353) (-456.449) [-459.211] * (-455.285) [-454.956] (-454.686) (-455.899) -- 0:00:26
592000 -- (-463.329) (-457.836) [-456.609] (-454.355) * (-456.110) (-458.218) (-455.152) [-457.775] -- 0:00:26
592500 -- (-454.689) (-454.063) [-455.026] (-454.211) * (-456.236) (-460.669) (-454.892) [-454.840] -- 0:00:26
593000 -- (-456.253) (-456.419) (-454.383) [-456.004] * (-457.016) (-455.036) [-455.505] (-456.177) -- 0:00:26
593500 -- (-454.835) (-456.720) [-454.097] (-456.322) * (-458.283) (-455.221) [-455.844] (-454.562) -- 0:00:26
594000 -- (-456.390) [-463.671] (-458.587) (-456.931) * [-454.314] (-456.965) (-454.716) (-454.614) -- 0:00:26
594500 -- (-456.225) (-464.576) (-457.718) [-460.583] * (-454.664) [-455.640] (-453.889) (-456.757) -- 0:00:26
595000 -- (-455.861) [-458.591] (-460.466) (-456.980) * (-454.171) [-457.300] (-455.399) (-454.947) -- 0:00:26
Average standard deviation of split frequencies: 0.008489
595500 -- [-457.149] (-454.075) (-454.731) (-461.113) * [-456.798] (-454.107) (-458.206) (-456.117) -- 0:00:26
596000 -- (-459.586) [-455.288] (-458.235) (-456.505) * (-455.606) [-454.157] (-456.673) (-455.521) -- 0:00:26
596500 -- (-456.775) (-454.338) [-457.527] (-456.614) * (-458.612) (-455.805) (-456.080) [-457.495] -- 0:00:26
597000 -- [-453.789] (-455.779) (-456.888) (-455.918) * [-454.691] (-456.730) (-454.453) (-457.688) -- 0:00:26
597500 -- (-458.594) (-458.233) [-455.842] (-455.485) * (-456.815) [-456.655] (-454.439) (-455.790) -- 0:00:26
598000 -- (-456.534) (-455.166) [-455.210] (-454.986) * [-458.994] (-458.382) (-459.224) (-459.576) -- 0:00:26
598500 -- (-453.891) (-457.473) (-456.101) [-455.951] * (-459.193) (-461.999) (-458.462) [-456.242] -- 0:00:26
599000 -- [-454.737] (-456.113) (-455.359) (-455.312) * (-454.772) [-455.041] (-456.192) (-454.658) -- 0:00:26
599500 -- (-455.872) [-454.953] (-456.222) (-457.323) * [-457.270] (-454.999) (-458.085) (-456.106) -- 0:00:26
600000 -- [-457.398] (-456.510) (-456.565) (-458.546) * (-455.925) [-455.429] (-458.131) (-455.825) -- 0:00:26
Average standard deviation of split frequencies: 0.007953
600500 -- (-456.031) [-455.380] (-454.616) (-455.015) * (-456.357) (-457.184) [-456.791] (-453.940) -- 0:00:26
601000 -- (-454.523) [-455.783] (-456.800) (-455.581) * [-455.049] (-462.447) (-459.834) (-453.904) -- 0:00:26
601500 -- (-456.228) [-454.185] (-456.224) (-458.082) * (-457.870) [-455.361] (-456.856) (-453.747) -- 0:00:26
602000 -- (-455.959) [-454.779] (-455.789) (-457.273) * (-457.280) [-455.777] (-457.994) (-456.619) -- 0:00:26
602500 -- (-459.863) (-457.260) (-457.427) [-454.530] * (-457.942) (-455.574) (-455.930) [-454.848] -- 0:00:26
603000 -- (-458.548) (-457.085) [-455.932] (-457.556) * [-453.929] (-457.483) (-457.482) (-456.014) -- 0:00:26
603500 -- (-459.458) (-455.991) (-455.307) [-456.822] * (-457.627) (-456.817) (-454.685) [-455.141] -- 0:00:26
604000 -- (-458.772) [-457.569] (-454.448) (-458.292) * [-456.179] (-458.003) (-454.781) (-454.912) -- 0:00:26
604500 -- (-459.348) (-457.054) (-453.887) [-455.184] * [-457.134] (-457.178) (-456.594) (-455.589) -- 0:00:26
605000 -- (-454.771) (-461.222) (-453.684) [-455.530] * [-455.860] (-455.843) (-455.486) (-458.224) -- 0:00:26
Average standard deviation of split frequencies: 0.008246
605500 -- [-455.675] (-454.269) (-454.971) (-456.759) * (-456.954) (-457.989) [-454.268] (-455.685) -- 0:00:26
606000 -- (-457.201) [-454.409] (-454.365) (-456.803) * (-455.994) [-459.190] (-458.209) (-456.248) -- 0:00:26
606500 -- (-456.754) [-456.038] (-456.864) (-456.375) * [-454.669] (-457.284) (-457.223) (-455.361) -- 0:00:25
607000 -- (-456.063) (-456.561) (-458.032) [-459.709] * (-454.523) (-459.430) (-456.086) [-460.019] -- 0:00:25
607500 -- (-456.231) [-455.861] (-459.470) (-461.102) * (-459.813) (-456.894) (-457.513) [-454.547] -- 0:00:25
608000 -- [-454.467] (-454.161) (-455.319) (-456.848) * (-454.655) [-454.452] (-458.328) (-455.259) -- 0:00:25
608500 -- (-454.040) (-456.059) (-454.486) [-454.217] * (-458.010) (-457.540) [-455.753] (-458.804) -- 0:00:25
609000 -- (-456.229) (-455.351) [-454.211] (-455.635) * (-458.949) (-454.911) [-455.478] (-454.846) -- 0:00:25
609500 -- (-455.529) (-457.423) (-455.513) [-453.794] * (-454.134) [-454.615] (-454.552) (-454.690) -- 0:00:25
610000 -- (-454.763) (-458.403) (-454.686) [-455.275] * (-457.010) [-456.826] (-455.278) (-459.914) -- 0:00:25
Average standard deviation of split frequencies: 0.008286
610500 -- (-455.457) [-460.828] (-454.802) (-455.129) * (-455.970) [-456.476] (-453.965) (-458.352) -- 0:00:25
611000 -- (-457.897) (-458.221) (-457.473) [-456.487] * (-456.048) (-454.870) [-454.067] (-458.350) -- 0:00:25
611500 -- [-457.517] (-460.081) (-453.840) (-455.542) * (-457.965) [-455.437] (-457.238) (-454.675) -- 0:00:25
612000 -- (-459.006) (-455.648) [-458.497] (-458.640) * (-455.759) [-457.998] (-454.043) (-455.623) -- 0:00:25
612500 -- (-455.198) [-456.948] (-454.398) (-455.921) * [-453.972] (-455.196) (-456.480) (-458.183) -- 0:00:25
613000 -- [-457.352] (-455.835) (-456.526) (-455.662) * [-454.259] (-454.765) (-456.640) (-457.008) -- 0:00:25
613500 -- [-454.715] (-455.220) (-460.872) (-454.806) * [-455.447] (-455.959) (-457.658) (-456.702) -- 0:00:25
614000 -- (-455.700) (-455.210) [-458.862] (-459.369) * (-455.004) (-454.215) (-456.783) [-458.302] -- 0:00:25
614500 -- (-458.444) (-456.418) (-457.703) [-456.415] * (-456.568) (-455.308) (-458.883) [-454.942] -- 0:00:25
615000 -- (-454.458) (-455.701) [-457.345] (-462.746) * (-456.811) (-455.249) [-455.119] (-454.113) -- 0:00:25
Average standard deviation of split frequencies: 0.008848
615500 -- [-457.912] (-456.159) (-457.185) (-455.187) * (-460.375) (-454.214) (-455.747) [-456.129] -- 0:00:25
616000 -- [-459.460] (-455.072) (-455.528) (-454.974) * (-456.246) [-454.247] (-455.297) (-459.309) -- 0:00:25
616500 -- (-456.199) [-458.085] (-455.373) (-455.698) * [-456.756] (-455.559) (-458.792) (-455.947) -- 0:00:25
617000 -- (-454.716) (-457.218) (-454.898) [-459.310] * (-456.516) (-454.692) (-454.582) [-457.916] -- 0:00:25
617500 -- (-456.815) (-455.875) [-454.410] (-455.894) * [-456.504] (-457.194) (-458.969) (-456.593) -- 0:00:25
618000 -- (-455.759) [-455.563] (-453.944) (-459.942) * (-455.080) (-457.856) [-457.405] (-454.824) -- 0:00:25
618500 -- [-458.282] (-456.634) (-454.273) (-454.270) * (-455.336) (-456.707) (-459.624) [-458.231] -- 0:00:25
619000 -- (-456.191) (-453.877) [-454.228] (-454.990) * [-454.210] (-454.547) (-454.572) (-455.368) -- 0:00:25
619500 -- (-463.243) [-454.220] (-457.650) (-456.767) * [-453.839] (-454.537) (-455.277) (-456.582) -- 0:00:25
620000 -- (-455.851) (-458.264) (-454.542) [-457.839] * (-457.762) (-457.547) (-455.636) [-456.400] -- 0:00:25
Average standard deviation of split frequencies: 0.009257
620500 -- (-454.708) (-458.542) [-457.054] (-454.598) * (-455.619) [-453.902] (-455.401) (-456.751) -- 0:00:25
621000 -- (-454.303) (-456.757) (-455.055) [-455.072] * (-454.733) [-456.892] (-454.878) (-460.587) -- 0:00:25
621500 -- (-455.500) [-455.357] (-453.961) (-458.000) * (-458.586) (-456.008) (-453.647) [-455.175] -- 0:00:24
622000 -- (-455.713) (-455.743) [-453.641] (-458.417) * (-455.332) (-454.338) [-456.389] (-454.101) -- 0:00:24
622500 -- (-454.978) [-456.307] (-457.234) (-456.584) * (-456.055) (-461.764) (-458.155) [-456.186] -- 0:00:24
623000 -- [-458.015] (-456.194) (-456.010) (-455.104) * (-458.572) (-458.037) [-454.232] (-461.279) -- 0:00:24
623500 -- [-460.635] (-454.626) (-454.974) (-454.912) * (-456.766) (-453.737) [-455.584] (-456.601) -- 0:00:24
624000 -- [-458.400] (-454.249) (-459.461) (-461.423) * [-455.579] (-455.729) (-456.225) (-453.984) -- 0:00:24
624500 -- (-456.131) [-455.634] (-455.797) (-458.383) * (-454.785) (-456.455) (-455.729) [-454.424] -- 0:00:24
625000 -- (-457.850) (-453.918) [-454.900] (-456.938) * (-456.732) (-456.497) [-454.694] (-457.588) -- 0:00:24
Average standard deviation of split frequencies: 0.008848
625500 -- (-458.204) (-454.653) [-455.849] (-456.052) * [-454.674] (-457.359) (-455.852) (-456.333) -- 0:00:24
626000 -- (-455.786) (-455.407) [-459.370] (-456.772) * (-455.907) (-457.813) [-455.011] (-462.188) -- 0:00:24
626500 -- [-455.865] (-455.400) (-453.822) (-457.169) * [-454.939] (-454.938) (-456.341) (-456.762) -- 0:00:24
627000 -- (-458.889) (-459.157) [-454.776] (-455.908) * (-458.127) [-454.283] (-456.249) (-458.256) -- 0:00:24
627500 -- (-454.746) (-458.273) [-454.559] (-456.789) * (-457.181) (-454.513) [-454.861] (-458.251) -- 0:00:24
628000 -- (-455.608) [-455.716] (-456.083) (-455.777) * (-455.760) (-456.288) (-454.935) [-454.666] -- 0:00:24
628500 -- (-454.859) (-457.610) [-455.351] (-455.248) * (-453.649) (-455.194) (-455.333) [-460.494] -- 0:00:24
629000 -- [-454.922] (-454.866) (-459.726) (-454.872) * (-454.692) (-456.433) (-455.611) [-455.016] -- 0:00:24
629500 -- (-457.250) (-456.697) (-458.372) [-456.490] * [-455.437] (-458.046) (-455.181) (-453.579) -- 0:00:24
630000 -- [-456.940] (-459.234) (-460.997) (-458.001) * [-455.523] (-458.717) (-456.905) (-456.162) -- 0:00:24
Average standard deviation of split frequencies: 0.008829
630500 -- (-455.436) [-454.292] (-460.659) (-460.974) * (-456.663) [-457.715] (-455.933) (-453.806) -- 0:00:24
631000 -- (-454.869) [-454.606] (-456.445) (-458.210) * [-456.457] (-455.578) (-455.888) (-454.513) -- 0:00:24
631500 -- (-456.772) [-455.171] (-454.735) (-457.222) * (-453.965) (-455.873) [-457.186] (-456.756) -- 0:00:24
632000 -- (-455.112) [-455.588] (-453.999) (-458.618) * (-459.004) (-455.711) [-454.934] (-456.646) -- 0:00:24
632500 -- [-458.827] (-455.632) (-459.491) (-455.806) * (-456.531) (-456.135) (-454.730) [-455.655] -- 0:00:24
633000 -- (-454.797) (-455.789) [-455.666] (-454.546) * (-456.255) (-454.780) [-455.010] (-458.924) -- 0:00:24
633500 -- [-455.202] (-457.525) (-456.774) (-455.290) * [-456.946] (-458.016) (-455.125) (-455.022) -- 0:00:24
634000 -- (-455.606) (-456.320) [-455.418] (-455.877) * (-456.531) [-455.190] (-454.495) (-456.947) -- 0:00:24
634500 -- [-455.130] (-459.247) (-456.032) (-457.295) * (-460.212) (-457.593) (-456.373) [-454.358] -- 0:00:24
635000 -- (-455.394) (-456.418) (-460.872) [-455.547] * (-455.838) (-459.130) [-459.696] (-453.998) -- 0:00:24
Average standard deviation of split frequencies: 0.008524
635500 -- (-454.191) (-456.140) [-456.765] (-455.539) * (-457.589) (-458.990) [-457.180] (-454.875) -- 0:00:24
636000 -- [-454.535] (-457.184) (-458.458) (-455.723) * (-456.778) [-456.343] (-457.494) (-455.675) -- 0:00:24
636500 -- (-456.758) (-455.919) [-454.415] (-458.463) * (-457.589) (-460.613) (-454.895) [-455.751] -- 0:00:23
637000 -- [-454.694] (-455.163) (-455.877) (-456.366) * (-456.804) (-454.455) (-454.844) [-455.818] -- 0:00:23
637500 -- (-457.245) [-455.820] (-454.759) (-456.141) * (-454.737) [-453.686] (-455.694) (-458.695) -- 0:00:23
638000 -- (-456.850) [-454.073] (-458.991) (-456.840) * (-455.279) (-454.086) (-456.499) [-454.898] -- 0:00:23
638500 -- [-454.964] (-455.734) (-459.014) (-459.887) * (-463.570) [-454.353] (-460.683) (-458.624) -- 0:00:23
639000 -- (-454.112) (-453.921) [-454.661] (-461.000) * [-458.511] (-454.348) (-455.029) (-457.595) -- 0:00:23
639500 -- (-454.236) [-458.173] (-453.991) (-460.089) * (-455.455) (-454.508) [-454.439] (-455.517) -- 0:00:23
640000 -- (-458.318) (-460.873) [-454.630] (-455.376) * (-457.470) [-455.306] (-456.509) (-456.189) -- 0:00:23
Average standard deviation of split frequencies: 0.008045
640500 -- (-462.531) [-459.030] (-454.306) (-456.201) * (-455.091) [-456.868] (-456.910) (-460.427) -- 0:00:23
641000 -- (-460.009) (-455.982) (-453.581) [-460.436] * (-454.379) (-456.089) [-455.817] (-455.556) -- 0:00:23
641500 -- (-461.812) [-454.784] (-455.936) (-458.161) * (-454.872) (-455.166) (-455.907) [-455.256] -- 0:00:23
642000 -- (-458.533) [-455.801] (-458.462) (-457.179) * (-461.172) (-455.215) [-455.678] (-455.121) -- 0:00:23
642500 -- (-457.685) (-454.891) [-458.709] (-455.186) * (-457.864) [-455.294] (-457.792) (-455.929) -- 0:00:23
643000 -- (-456.215) (-455.540) [-457.196] (-459.393) * [-454.171] (-454.310) (-454.832) (-455.919) -- 0:00:23
643500 -- (-455.541) [-454.273] (-455.089) (-456.122) * (-457.399) [-458.067] (-456.129) (-456.441) -- 0:00:23
644000 -- [-456.566] (-454.141) (-454.754) (-457.421) * (-454.077) (-456.210) (-458.404) [-454.926] -- 0:00:23
644500 -- (-456.556) [-454.053] (-454.976) (-456.641) * (-456.650) [-455.881] (-455.302) (-454.334) -- 0:00:23
645000 -- (-457.599) [-454.580] (-454.011) (-456.810) * (-456.144) (-460.071) [-454.348] (-458.939) -- 0:00:23
Average standard deviation of split frequencies: 0.008301
645500 -- (-457.152) (-456.443) (-454.930) [-456.013] * (-453.706) (-456.901) (-455.207) [-453.681] -- 0:00:23
646000 -- [-455.954] (-454.957) (-455.096) (-457.401) * (-454.292) (-462.625) (-455.302) [-456.847] -- 0:00:23
646500 -- (-455.643) [-457.581] (-458.456) (-458.759) * (-455.143) (-454.441) (-454.421) [-456.968] -- 0:00:23
647000 -- (-454.929) (-456.230) (-455.999) [-455.244] * (-455.716) (-457.835) [-454.797] (-455.090) -- 0:00:23
647500 -- (-457.956) (-457.280) (-455.175) [-454.556] * (-457.074) (-458.788) [-455.519] (-454.437) -- 0:00:23
648000 -- [-455.590] (-455.367) (-455.643) (-456.906) * [-460.267] (-455.095) (-455.026) (-453.902) -- 0:00:23
648500 -- [-455.830] (-454.404) (-457.388) (-456.432) * (-456.227) (-455.724) (-454.727) [-455.797] -- 0:00:23
649000 -- [-454.706] (-455.261) (-457.605) (-454.167) * (-455.399) [-455.983] (-454.248) (-455.790) -- 0:00:23
649500 -- [-455.459] (-458.034) (-455.787) (-454.518) * (-453.684) (-459.594) [-455.911] (-455.506) -- 0:00:23
650000 -- [-453.935] (-459.553) (-457.333) (-453.925) * (-453.684) (-461.507) [-455.708] (-458.261) -- 0:00:23
Average standard deviation of split frequencies: 0.008114
650500 -- (-454.637) [-457.626] (-458.220) (-455.208) * (-453.944) (-459.001) (-454.816) [-455.449] -- 0:00:23
651000 -- (-454.379) (-455.820) [-455.995] (-454.901) * [-458.984] (-454.043) (-458.773) (-454.586) -- 0:00:23
651500 -- (-458.404) (-454.035) (-456.228) [-456.218] * [-457.714] (-453.661) (-458.765) (-456.453) -- 0:00:23
652000 -- [-455.320] (-455.983) (-458.717) (-457.618) * (-456.326) (-457.795) [-456.863] (-463.226) -- 0:00:22
652500 -- (-458.265) (-458.441) [-454.372] (-457.848) * (-457.123) (-458.549) [-456.064] (-463.376) -- 0:00:22
653000 -- (-458.957) (-454.245) (-454.627) [-456.791] * (-456.716) (-455.642) [-458.426] (-458.157) -- 0:00:22
653500 -- (-460.253) (-454.422) [-456.253] (-459.890) * (-456.158) [-455.319] (-455.650) (-455.693) -- 0:00:22
654000 -- (-460.970) [-454.186] (-457.906) (-457.204) * (-457.291) (-454.940) [-460.069] (-456.157) -- 0:00:22
654500 -- (-458.102) [-457.316] (-455.344) (-457.858) * (-459.316) [-454.096] (-454.538) (-455.567) -- 0:00:22
655000 -- [-458.010] (-454.336) (-458.955) (-457.067) * (-454.296) [-455.807] (-456.860) (-457.309) -- 0:00:22
Average standard deviation of split frequencies: 0.007809
655500 -- (-454.468) (-454.639) (-457.119) [-454.490] * (-455.919) [-454.272] (-456.448) (-460.101) -- 0:00:22
656000 -- (-454.241) (-454.074) (-456.189) [-454.199] * (-454.871) [-458.002] (-456.057) (-455.336) -- 0:00:22
656500 -- (-459.505) (-454.086) (-455.935) [-454.874] * [-456.463] (-458.658) (-458.892) (-457.935) -- 0:00:22
657000 -- (-458.484) [-457.861] (-455.269) (-454.978) * (-454.561) [-459.676] (-456.172) (-453.835) -- 0:00:22
657500 -- (-454.907) [-455.870] (-456.159) (-454.322) * (-454.995) [-455.506] (-456.259) (-453.823) -- 0:00:22
658000 -- [-458.362] (-459.096) (-454.637) (-455.253) * (-454.668) [-457.212] (-456.858) (-455.509) -- 0:00:22
658500 -- [-453.933] (-455.819) (-457.382) (-456.298) * [-453.845] (-458.139) (-455.512) (-455.773) -- 0:00:22
659000 -- (-456.756) [-457.111] (-456.181) (-457.209) * [-454.183] (-457.683) (-457.631) (-454.120) -- 0:00:22
659500 -- [-454.167] (-457.510) (-454.816) (-454.505) * [-457.696] (-455.751) (-455.761) (-456.640) -- 0:00:22
660000 -- [-454.522] (-461.848) (-456.197) (-455.718) * (-465.814) [-460.756] (-454.372) (-458.269) -- 0:00:22
Average standard deviation of split frequencies: 0.007706
660500 -- (-454.549) (-455.929) (-458.956) [-460.075] * (-455.610) (-454.782) [-455.537] (-455.032) -- 0:00:22
661000 -- (-454.783) (-455.435) (-458.307) [-459.277] * (-456.482) (-454.347) (-456.589) [-454.954] -- 0:00:22
661500 -- (-454.062) [-456.566] (-458.280) (-458.423) * (-457.372) [-454.575] (-454.216) (-455.499) -- 0:00:22
662000 -- [-455.173] (-454.987) (-455.334) (-461.049) * [-454.727] (-456.841) (-456.889) (-454.363) -- 0:00:22
662500 -- [-455.988] (-458.607) (-454.403) (-456.381) * (-462.767) (-458.665) [-458.898] (-456.867) -- 0:00:22
663000 -- (-461.200) (-458.655) [-458.028] (-454.327) * (-458.266) (-457.191) (-458.168) [-457.413] -- 0:00:22
663500 -- (-456.242) (-456.600) (-461.599) [-455.712] * (-458.771) (-457.014) (-460.863) [-454.823] -- 0:00:22
664000 -- [-456.637] (-457.261) (-456.982) (-454.736) * (-457.044) (-455.765) [-454.574] (-461.150) -- 0:00:22
664500 -- (-456.342) (-455.744) [-455.648] (-454.290) * (-458.047) [-456.238] (-455.992) (-456.621) -- 0:00:22
665000 -- (-456.654) [-453.906] (-458.012) (-459.424) * [-457.020] (-454.394) (-454.659) (-458.723) -- 0:00:22
Average standard deviation of split frequencies: 0.007880
665500 -- (-456.744) (-458.908) (-457.076) [-456.351] * (-454.084) [-454.380] (-454.216) (-455.363) -- 0:00:22
666000 -- (-455.384) (-455.413) [-454.596] (-453.903) * (-454.105) [-458.248] (-454.197) (-457.781) -- 0:00:22
666500 -- [-454.821] (-456.077) (-455.981) (-459.956) * [-454.292] (-457.780) (-458.811) (-455.467) -- 0:00:22
667000 -- (-455.377) [-454.991] (-455.178) (-455.353) * (-456.029) (-454.785) (-453.632) [-454.842] -- 0:00:21
667500 -- (-458.316) (-455.783) (-454.194) [-458.588] * [-456.309] (-456.461) (-454.591) (-455.747) -- 0:00:21
668000 -- [-456.625] (-455.735) (-454.405) (-454.926) * (-455.481) (-455.908) [-455.017] (-458.342) -- 0:00:21
668500 -- (-455.342) (-456.773) (-454.024) [-458.197] * (-456.043) [-455.265] (-454.933) (-458.070) -- 0:00:21
669000 -- (-460.961) [-455.346] (-456.066) (-461.243) * [-457.028] (-455.951) (-455.612) (-455.771) -- 0:00:21
669500 -- [-458.934] (-454.507) (-459.547) (-457.584) * (-456.824) [-459.629] (-456.549) (-460.129) -- 0:00:21
670000 -- (-456.700) (-456.194) (-454.304) [-457.812] * (-457.851) (-454.832) [-460.312] (-455.984) -- 0:00:21
Average standard deviation of split frequencies: 0.007638
670500 -- [-455.913] (-454.131) (-458.163) (-455.689) * (-456.155) (-456.645) [-454.435] (-457.296) -- 0:00:21
671000 -- (-455.953) (-455.439) (-456.970) [-455.919] * (-454.475) (-457.585) [-457.708] (-458.902) -- 0:00:21
671500 -- (-454.660) (-458.360) [-457.653] (-458.886) * (-456.065) [-456.746] (-457.702) (-454.090) -- 0:00:21
672000 -- [-456.580] (-459.729) (-457.116) (-459.237) * [-455.566] (-456.381) (-456.254) (-455.487) -- 0:00:21
672500 -- (-455.559) [-456.541] (-455.172) (-455.989) * (-458.411) (-455.508) [-454.446] (-456.528) -- 0:00:21
673000 -- (-456.597) [-456.306] (-456.366) (-455.173) * [-459.099] (-455.660) (-455.451) (-456.247) -- 0:00:21
673500 -- (-456.375) [-455.504] (-456.335) (-459.086) * (-457.128) (-454.044) (-454.481) [-455.695] -- 0:00:21
674000 -- (-455.754) (-458.078) [-455.173] (-456.633) * (-454.638) (-454.600) [-456.386] (-454.792) -- 0:00:21
674500 -- (-459.559) [-457.942] (-454.971) (-461.218) * (-456.280) (-456.414) [-455.221] (-454.652) -- 0:00:21
675000 -- [-454.846] (-456.530) (-456.489) (-460.273) * [-454.303] (-458.134) (-456.325) (-455.450) -- 0:00:21
Average standard deviation of split frequencies: 0.007810
675500 -- (-454.067) [-454.554] (-456.908) (-454.007) * [-455.171] (-454.270) (-456.792) (-456.587) -- 0:00:21
676000 -- (-453.742) (-458.606) [-455.504] (-461.574) * (-455.489) [-455.707] (-456.184) (-457.491) -- 0:00:21
676500 -- (-454.210) (-455.229) (-457.844) [-454.440] * (-456.491) (-458.191) [-456.810] (-458.811) -- 0:00:21
677000 -- (-454.287) (-457.582) [-459.830] (-456.701) * [-454.398] (-455.540) (-460.110) (-454.551) -- 0:00:21
677500 -- [-454.675] (-459.068) (-454.714) (-461.921) * [-456.607] (-455.056) (-455.803) (-457.582) -- 0:00:21
678000 -- (-455.085) (-458.520) (-456.871) [-455.706] * [-457.347] (-457.034) (-454.990) (-454.103) -- 0:00:21
678500 -- [-454.801] (-457.954) (-456.507) (-454.927) * (-456.295) (-455.299) (-455.908) [-454.228] -- 0:00:21
679000 -- (-455.611) (-454.443) [-454.148] (-455.475) * (-457.507) [-454.430] (-454.681) (-454.697) -- 0:00:21
679500 -- (-459.359) [-454.396] (-454.870) (-455.050) * (-455.657) (-461.546) (-453.980) [-454.568] -- 0:00:21
680000 -- (-454.902) (-455.208) (-456.286) [-456.232] * (-456.988) (-458.410) (-453.985) [-455.381] -- 0:00:21
Average standard deviation of split frequencies: 0.007572
680500 -- (-454.182) [-455.260] (-454.359) (-456.672) * (-458.431) (-458.347) (-454.339) [-454.078] -- 0:00:21
681000 -- (-454.369) [-455.235] (-455.536) (-455.647) * [-458.541] (-462.744) (-457.949) (-454.324) -- 0:00:21
681500 -- (-455.182) (-455.769) (-463.191) [-455.066] * [-456.310] (-462.854) (-455.481) (-455.495) -- 0:00:21
682000 -- [-457.916] (-456.771) (-464.846) (-455.484) * (-458.366) (-457.649) [-455.772] (-454.999) -- 0:00:20
682500 -- (-457.339) (-456.583) (-456.558) [-459.041] * (-460.086) (-455.544) [-454.851] (-455.558) -- 0:00:20
683000 -- [-455.261] (-454.846) (-455.975) (-453.971) * (-457.616) (-454.218) [-454.130] (-456.036) -- 0:00:20
683500 -- (-459.044) [-454.816] (-455.117) (-458.775) * (-454.479) (-454.011) (-457.504) [-455.535] -- 0:00:20
684000 -- (-464.134) [-456.115] (-456.122) (-454.840) * (-456.800) (-454.808) (-460.088) [-460.438] -- 0:00:20
684500 -- [-456.354] (-454.834) (-455.906) (-454.195) * (-455.253) [-454.556] (-454.897) (-456.971) -- 0:00:20
685000 -- (-454.232) (-458.533) (-454.633) [-455.878] * [-459.846] (-453.895) (-456.042) (-454.526) -- 0:00:20
Average standard deviation of split frequencies: 0.007376
685500 -- (-455.043) (-455.732) [-454.280] (-455.751) * [-455.906] (-457.113) (-454.978) (-456.436) -- 0:00:20
686000 -- (-455.268) [-455.894] (-457.419) (-457.677) * [-454.654] (-456.646) (-457.336) (-458.703) -- 0:00:20
686500 -- (-456.292) (-455.479) [-455.930] (-454.741) * (-455.057) (-454.847) [-454.715] (-455.259) -- 0:00:20
687000 -- (-456.686) (-454.569) (-455.321) [-454.163] * (-454.308) (-455.388) [-456.290] (-457.775) -- 0:00:20
687500 -- (-455.184) [-458.490] (-456.679) (-458.162) * (-458.816) (-455.027) (-454.088) [-453.795] -- 0:00:20
688000 -- (-454.552) [-455.669] (-458.641) (-456.611) * (-456.895) (-460.850) [-454.027] (-454.180) -- 0:00:20
688500 -- (-455.180) (-455.031) [-455.963] (-455.688) * [-454.868] (-454.523) (-454.590) (-459.922) -- 0:00:20
689000 -- [-457.629] (-457.853) (-461.357) (-456.757) * (-457.975) [-455.037] (-454.119) (-456.675) -- 0:00:20
689500 -- (-454.290) (-457.827) (-461.902) [-459.342] * (-456.131) (-456.881) (-456.224) [-456.089] -- 0:00:20
690000 -- [-455.865] (-457.642) (-462.978) (-454.236) * (-455.238) [-455.607] (-457.248) (-455.744) -- 0:00:20
Average standard deviation of split frequencies: 0.007053
690500 -- (-457.800) (-456.731) (-456.322) [-453.977] * (-455.115) (-456.184) (-458.780) [-454.715] -- 0:00:20
691000 -- [-459.734] (-456.185) (-455.460) (-456.362) * [-454.056] (-461.857) (-460.034) (-455.669) -- 0:00:20
691500 -- (-455.377) (-455.634) [-455.732] (-456.679) * (-456.038) [-455.477] (-460.911) (-457.712) -- 0:00:20
692000 -- (-459.754) [-456.156] (-456.349) (-454.663) * (-454.185) (-455.115) [-457.486] (-456.375) -- 0:00:20
692500 -- (-455.750) (-455.570) [-454.384] (-457.527) * (-457.537) (-455.090) (-456.395) [-457.181] -- 0:00:19
693000 -- (-456.180) [-455.074] (-456.799) (-457.715) * (-457.034) [-454.722] (-455.498) (-455.731) -- 0:00:19
693500 -- [-458.243] (-455.546) (-457.583) (-456.510) * (-453.904) (-454.112) (-456.337) [-456.021] -- 0:00:20
694000 -- (-456.280) (-457.266) (-461.967) [-456.931] * [-454.804] (-455.298) (-456.075) (-454.433) -- 0:00:20
694500 -- [-456.137] (-455.536) (-457.496) (-456.123) * (-454.688) (-453.868) [-454.927] (-454.873) -- 0:00:20
695000 -- (-454.969) (-454.598) (-456.757) [-457.504] * (-459.169) (-453.956) [-455.011] (-454.676) -- 0:00:20
Average standard deviation of split frequencies: 0.006818
695500 -- (-457.026) [-459.415] (-454.340) (-456.196) * (-459.883) [-455.866] (-453.818) (-454.647) -- 0:00:20
696000 -- [-455.016] (-457.011) (-454.537) (-458.010) * (-455.576) [-457.084] (-455.721) (-455.183) -- 0:00:20
696500 -- [-459.693] (-459.045) (-455.148) (-460.884) * (-457.161) (-457.609) (-455.422) [-455.088] -- 0:00:20
697000 -- (-459.459) (-460.288) [-454.877] (-461.104) * (-455.539) (-455.963) (-454.736) [-456.826] -- 0:00:19
697500 -- [-462.231] (-458.248) (-456.314) (-457.403) * (-456.153) [-456.393] (-454.144) (-455.955) -- 0:00:19
698000 -- (-462.306) (-456.805) (-454.926) [-454.084] * (-456.466) [-455.563] (-454.329) (-457.012) -- 0:00:19
698500 -- (-461.504) [-454.095] (-454.918) (-454.679) * (-459.060) [-454.350] (-456.045) (-454.071) -- 0:00:19
699000 -- [-454.865] (-459.201) (-454.918) (-455.357) * (-453.733) (-454.410) (-460.783) [-455.093] -- 0:00:19
699500 -- [-453.771] (-456.631) (-454.907) (-456.147) * [-455.243] (-458.188) (-457.319) (-456.440) -- 0:00:19
700000 -- (-461.512) [-455.955] (-455.883) (-454.668) * (-454.769) (-456.308) [-454.414] (-457.120) -- 0:00:19
Average standard deviation of split frequencies: 0.006818
700500 -- (-455.063) (-454.514) (-454.982) [-455.177] * (-454.536) (-454.164) [-455.086] (-454.963) -- 0:00:19
701000 -- [-454.442] (-453.894) (-453.545) (-455.763) * (-455.260) (-458.108) (-457.215) [-455.125] -- 0:00:19
701500 -- (-454.707) (-456.720) [-455.201] (-455.836) * (-454.862) (-456.165) [-453.751] (-463.469) -- 0:00:19
702000 -- (-455.656) (-458.879) [-455.819] (-456.645) * (-454.373) (-456.555) [-455.436] (-456.299) -- 0:00:19
702500 -- [-454.754] (-457.001) (-454.687) (-457.157) * (-455.540) (-454.088) [-455.393] (-456.178) -- 0:00:19
703000 -- (-453.508) (-456.934) [-456.089] (-455.809) * (-455.553) (-458.299) (-455.919) [-454.253] -- 0:00:19
703500 -- (-456.439) (-454.483) [-455.392] (-460.146) * (-457.912) (-456.655) (-455.109) [-453.856] -- 0:00:19
704000 -- (-455.128) (-455.613) (-455.219) [-457.150] * (-455.586) (-455.498) (-455.559) [-454.713] -- 0:00:19
704500 -- (-455.508) (-455.055) [-458.973] (-458.006) * (-457.132) (-456.019) [-454.789] (-456.568) -- 0:00:19
705000 -- (-455.332) (-455.224) (-456.191) [-459.154] * (-455.343) (-454.426) (-454.143) [-455.766] -- 0:00:19
Average standard deviation of split frequencies: 0.007256
705500 -- (-457.247) (-459.701) (-459.503) [-456.203] * [-457.028] (-456.042) (-454.142) (-457.665) -- 0:00:19
706000 -- (-462.492) (-457.599) [-454.649] (-453.997) * (-455.143) (-453.957) (-455.558) [-454.988] -- 0:00:19
706500 -- [-454.767] (-456.803) (-457.334) (-459.642) * [-454.421] (-456.040) (-457.436) (-459.409) -- 0:00:19
707000 -- (-457.815) (-455.850) (-456.212) [-454.486] * (-455.085) [-455.714] (-455.150) (-458.382) -- 0:00:19
707500 -- (-457.828) (-455.354) [-456.016] (-459.117) * (-460.094) (-457.263) [-454.140] (-462.257) -- 0:00:19
708000 -- (-455.031) (-455.529) (-460.346) [-454.175] * [-456.857] (-459.985) (-454.007) (-455.694) -- 0:00:18
708500 -- [-457.210] (-457.500) (-455.054) (-455.450) * [-454.674] (-457.229) (-454.428) (-454.154) -- 0:00:18
709000 -- (-455.861) (-456.112) (-457.799) [-454.228] * (-457.190) (-455.488) (-461.149) [-455.263] -- 0:00:18
709500 -- (-455.020) (-460.266) (-455.523) [-454.504] * (-454.257) [-454.741] (-455.185) (-456.811) -- 0:00:19
710000 -- (-455.260) (-456.168) [-457.113] (-454.421) * [-455.357] (-454.299) (-456.481) (-454.081) -- 0:00:19
Average standard deviation of split frequencies: 0.007341
710500 -- (-454.376) [-455.690] (-454.560) (-455.348) * [-455.582] (-455.821) (-455.680) (-454.951) -- 0:00:19
711000 -- (-455.583) (-457.887) [-456.688] (-458.202) * (-456.400) [-456.307] (-454.567) (-458.461) -- 0:00:19
711500 -- (-457.964) (-458.219) [-456.417] (-454.594) * (-455.848) (-460.980) (-454.328) [-457.965] -- 0:00:19
712000 -- (-456.855) [-460.705] (-455.282) (-457.033) * (-457.416) (-454.467) [-455.797] (-454.853) -- 0:00:19
712500 -- (-458.127) (-456.522) [-457.246] (-459.987) * (-454.566) (-453.961) [-454.879] (-458.708) -- 0:00:18
713000 -- [-454.269] (-457.898) (-457.077) (-455.431) * (-461.613) (-455.412) (-455.091) [-457.527] -- 0:00:18
713500 -- (-461.906) (-455.417) (-458.229) [-454.368] * (-455.082) (-455.493) [-456.552] (-457.590) -- 0:00:18
714000 -- (-457.739) [-456.099] (-454.976) (-455.730) * (-454.961) (-457.781) [-454.146] (-455.941) -- 0:00:18
714500 -- (-457.494) (-457.616) (-454.315) [-454.709] * (-457.635) [-457.514] (-454.529) (-455.983) -- 0:00:18
715000 -- (-455.303) (-455.565) (-454.323) [-455.154] * [-455.767] (-455.410) (-456.194) (-457.951) -- 0:00:18
Average standard deviation of split frequencies: 0.007462
715500 -- (-455.961) (-454.691) (-454.591) [-455.936] * (-456.413) (-455.669) (-455.009) [-453.825] -- 0:00:18
716000 -- (-458.020) (-457.066) [-455.012] (-458.577) * (-461.189) (-456.311) [-455.848] (-453.670) -- 0:00:18
716500 -- (-457.397) (-455.854) [-455.664] (-456.762) * (-461.482) (-460.319) [-454.431] (-454.125) -- 0:00:18
717000 -- (-454.215) [-454.932] (-457.841) (-457.558) * (-459.072) (-457.051) [-455.167] (-457.083) -- 0:00:18
717500 -- [-454.293] (-457.144) (-454.842) (-456.353) * (-454.007) (-458.392) (-455.994) [-455.907] -- 0:00:18
718000 -- [-455.206] (-457.104) (-455.425) (-455.442) * (-456.370) [-457.351] (-458.292) (-456.529) -- 0:00:18
718500 -- (-454.964) (-457.492) [-455.770] (-456.361) * [-454.874] (-455.520) (-455.265) (-455.781) -- 0:00:18
719000 -- (-460.046) (-456.732) (-456.488) [-455.623] * [-456.346] (-456.374) (-455.633) (-455.059) -- 0:00:18
719500 -- [-455.751] (-455.607) (-458.056) (-454.867) * (-456.821) (-457.855) (-455.591) [-457.257] -- 0:00:18
720000 -- (-459.137) (-456.866) [-455.808] (-455.109) * (-456.295) (-456.552) (-455.341) [-455.996] -- 0:00:18
Average standard deviation of split frequencies: 0.007370
720500 -- (-457.651) (-458.902) [-457.012] (-456.244) * [-457.000] (-454.327) (-457.864) (-456.643) -- 0:00:18
721000 -- [-454.492] (-456.651) (-455.030) (-455.964) * (-457.230) (-455.864) [-455.619] (-453.828) -- 0:00:18
721500 -- (-456.612) [-456.361] (-456.232) (-455.406) * (-455.411) [-456.597] (-456.812) (-459.548) -- 0:00:18
722000 -- [-454.628] (-455.814) (-456.869) (-456.725) * (-458.375) [-456.630] (-456.897) (-457.360) -- 0:00:18
722500 -- (-454.168) (-456.487) [-459.700] (-460.291) * (-456.763) (-456.683) (-454.931) [-458.061] -- 0:00:18
723000 -- (-453.842) [-457.082] (-456.244) (-457.080) * (-455.566) (-456.294) (-453.666) [-456.268] -- 0:00:18
723500 -- (-454.095) [-455.029] (-455.906) (-458.134) * (-458.479) [-455.782] (-454.816) (-457.417) -- 0:00:17
724000 -- (-454.870) [-456.067] (-456.398) (-458.904) * (-458.341) (-455.743) [-455.236] (-455.760) -- 0:00:17
724500 -- (-455.197) [-457.819] (-456.605) (-454.748) * [-457.613] (-455.820) (-458.711) (-455.141) -- 0:00:17
725000 -- (-453.875) (-454.138) [-457.695] (-458.433) * [-457.104] (-457.347) (-455.387) (-454.346) -- 0:00:17
Average standard deviation of split frequencies: 0.007316
725500 -- (-454.598) (-456.045) [-454.961] (-454.677) * (-456.699) (-459.233) (-457.435) [-455.497] -- 0:00:18
726000 -- (-459.272) [-454.471] (-455.956) (-458.024) * [-462.201] (-454.781) (-455.070) (-456.848) -- 0:00:18
726500 -- (-456.124) [-455.768] (-454.950) (-456.536) * [-460.087] (-455.872) (-456.904) (-457.210) -- 0:00:18
727000 -- (-456.755) [-454.856] (-454.409) (-454.817) * (-457.743) (-459.637) (-455.365) [-456.564] -- 0:00:18
727500 -- [-455.755] (-459.204) (-459.236) (-454.874) * [-455.767] (-454.903) (-455.756) (-456.987) -- 0:00:17
728000 -- (-457.037) (-457.972) [-454.009] (-457.668) * (-460.483) (-457.552) [-460.152] (-455.433) -- 0:00:17
728500 -- (-454.998) (-455.478) (-456.893) [-461.116] * (-460.367) (-455.406) (-460.638) [-455.453] -- 0:00:17
729000 -- [-458.353] (-460.680) (-458.335) (-458.967) * [-456.900] (-456.916) (-455.856) (-456.566) -- 0:00:17
729500 -- [-455.844] (-459.798) (-460.273) (-457.976) * (-456.573) [-455.286] (-454.503) (-458.013) -- 0:00:17
730000 -- (-458.462) (-458.427) (-460.538) [-458.734] * (-454.194) (-455.908) [-454.893] (-454.879) -- 0:00:17
Average standard deviation of split frequencies: 0.007355
730500 -- (-454.911) [-456.969] (-454.957) (-457.079) * [-455.512] (-460.604) (-456.023) (-461.391) -- 0:00:17
731000 -- (-457.099) (-455.719) [-453.734] (-456.468) * (-457.214) (-458.010) [-455.810] (-455.755) -- 0:00:17
731500 -- [-454.897] (-453.748) (-455.288) (-455.029) * [-456.953] (-457.258) (-455.312) (-456.845) -- 0:00:17
732000 -- (-456.938) [-454.956] (-455.234) (-455.590) * [-456.058] (-454.287) (-456.512) (-456.834) -- 0:00:17
732500 -- (-456.134) (-457.019) (-455.129) [-455.140] * (-457.775) (-454.685) (-457.476) [-454.705] -- 0:00:17
733000 -- (-461.697) (-456.059) [-455.180] (-456.057) * (-456.496) (-458.499) (-457.380) [-455.087] -- 0:00:17
733500 -- (-456.368) [-457.934] (-454.837) (-455.291) * (-454.230) [-454.353] (-459.311) (-456.240) -- 0:00:17
734000 -- (-455.617) (-457.112) (-455.263) [-454.654] * (-455.443) (-454.721) [-454.962] (-456.883) -- 0:00:17
734500 -- (-453.957) (-457.153) (-454.147) [-458.258] * (-455.888) (-456.003) (-456.460) [-456.295] -- 0:00:17
735000 -- (-455.801) (-454.250) (-456.073) [-456.408] * (-456.660) [-459.079] (-456.352) (-455.782) -- 0:00:17
Average standard deviation of split frequencies: 0.007387
735500 -- (-454.329) [-454.869] (-455.528) (-453.917) * [-455.844] (-457.541) (-455.650) (-458.933) -- 0:00:17
736000 -- [-454.105] (-455.252) (-457.123) (-455.319) * (-453.689) (-455.834) (-455.476) [-459.269] -- 0:00:17
736500 -- (-455.907) (-455.348) [-456.409] (-456.100) * [-454.597] (-454.687) (-455.808) (-461.316) -- 0:00:17
737000 -- (-455.743) (-454.867) [-454.321] (-457.114) * [-454.637] (-453.800) (-458.217) (-457.113) -- 0:00:17
737500 -- [-456.310] (-455.703) (-460.412) (-455.206) * [-454.158] (-457.063) (-458.901) (-458.534) -- 0:00:17
738000 -- (-455.637) (-457.245) (-457.721) [-454.837] * [-457.939] (-455.409) (-454.718) (-462.678) -- 0:00:17
738500 -- [-456.431] (-458.557) (-456.619) (-455.529) * (-456.369) (-459.447) [-456.563] (-458.233) -- 0:00:16
739000 -- (-454.689) (-456.565) [-459.253] (-456.158) * (-455.348) [-454.283] (-457.812) (-456.660) -- 0:00:16
739500 -- (-457.132) (-456.415) (-455.936) [-455.212] * (-456.609) (-456.090) (-455.951) [-455.728] -- 0:00:16
740000 -- (-456.952) [-455.952] (-458.408) (-454.863) * [-457.951] (-456.541) (-459.144) (-456.336) -- 0:00:16
Average standard deviation of split frequencies: 0.007383
740500 -- (-453.686) [-455.422] (-456.125) (-458.637) * [-460.920] (-458.923) (-454.865) (-457.495) -- 0:00:16
741000 -- (-456.902) [-454.777] (-454.162) (-455.899) * (-457.081) (-455.620) (-455.129) [-458.541] -- 0:00:17
741500 -- (-456.215) [-456.503] (-454.845) (-455.571) * [-457.787] (-455.037) (-458.639) (-455.175) -- 0:00:17
742000 -- (-457.354) (-457.897) (-457.352) [-456.197] * (-456.992) [-455.431] (-455.588) (-456.326) -- 0:00:17
742500 -- (-458.561) (-456.426) (-455.756) [-456.571] * (-458.932) [-456.864] (-456.230) (-455.360) -- 0:00:16
743000 -- [-458.219] (-460.089) (-457.324) (-454.194) * (-456.146) (-454.644) (-455.704) [-453.814] -- 0:00:16
743500 -- (-455.189) (-456.058) (-454.680) [-454.776] * (-456.344) (-454.406) [-454.700] (-455.516) -- 0:00:16
744000 -- (-456.994) [-454.451] (-455.524) (-456.303) * [-454.497] (-454.889) (-453.762) (-459.657) -- 0:00:16
744500 -- [-454.202] (-453.897) (-456.216) (-456.090) * [-454.462] (-456.840) (-456.569) (-455.642) -- 0:00:16
745000 -- (-461.099) (-458.122) [-457.133] (-456.968) * [-455.841] (-456.454) (-454.216) (-454.422) -- 0:00:16
Average standard deviation of split frequencies: 0.007414
745500 -- (-459.734) (-459.866) (-455.841) [-454.924] * [-455.322] (-458.075) (-456.988) (-456.213) -- 0:00:16
746000 -- [-457.692] (-455.630) (-459.446) (-455.990) * (-458.940) (-455.844) [-455.615] (-463.873) -- 0:00:16
746500 -- [-454.958] (-455.193) (-456.142) (-454.757) * (-455.404) (-455.949) [-457.185] (-454.421) -- 0:00:16
747000 -- (-453.893) [-454.766] (-455.261) (-454.173) * [-454.854] (-460.800) (-456.088) (-457.886) -- 0:00:16
747500 -- [-453.716] (-455.780) (-453.903) (-457.602) * [-455.717] (-455.368) (-457.965) (-458.554) -- 0:00:16
748000 -- [-454.896] (-456.659) (-454.628) (-457.717) * (-454.828) (-454.471) [-455.899] (-455.644) -- 0:00:16
748500 -- (-455.130) [-458.118] (-455.646) (-455.274) * [-456.518] (-456.926) (-461.185) (-455.787) -- 0:00:16
749000 -- (-455.828) [-454.185] (-453.915) (-455.014) * (-456.676) [-457.124] (-455.429) (-454.530) -- 0:00:16
749500 -- (-457.979) (-454.589) (-454.362) [-456.812] * (-457.877) [-456.139] (-456.286) (-454.741) -- 0:00:16
750000 -- (-455.740) [-454.583] (-454.434) (-458.077) * (-455.380) (-454.285) [-457.809] (-453.987) -- 0:00:16
Average standard deviation of split frequencies: 0.007410
750500 -- (-455.926) (-453.916) [-458.679] (-456.514) * (-461.532) (-454.712) [-457.043] (-454.705) -- 0:00:16
751000 -- (-455.842) [-454.651] (-458.699) (-454.676) * [-457.649] (-454.893) (-454.931) (-455.911) -- 0:00:16
751500 -- [-456.710] (-454.637) (-454.474) (-454.725) * (-455.536) (-455.562) [-456.956] (-455.942) -- 0:00:16
752000 -- (-459.300) (-459.289) (-454.928) [-455.522] * (-456.383) [-454.567] (-455.462) (-458.953) -- 0:00:16
752500 -- (-454.813) (-456.511) [-455.103] (-457.557) * [-456.234] (-456.279) (-459.164) (-457.346) -- 0:00:16
753000 -- (-455.654) (-457.806) [-453.993] (-458.351) * (-453.784) (-456.283) [-454.542] (-456.180) -- 0:00:16
753500 -- (-457.365) [-456.154] (-456.351) (-455.990) * [-454.059] (-454.050) (-455.269) (-455.256) -- 0:00:16
754000 -- [-454.745] (-461.148) (-456.593) (-455.296) * [-459.150] (-454.542) (-455.078) (-454.416) -- 0:00:15
754500 -- (-456.334) (-454.724) (-456.104) [-456.135] * [-454.707] (-455.072) (-454.463) (-455.998) -- 0:00:15
755000 -- (-455.525) (-455.362) [-458.607] (-455.534) * (-456.177) (-456.639) (-454.430) [-455.760] -- 0:00:15
Average standard deviation of split frequencies: 0.007233
755500 -- (-458.182) (-456.465) (-456.850) [-456.041] * (-454.688) (-454.216) (-455.217) [-453.945] -- 0:00:15
756000 -- (-455.790) [-459.755] (-457.958) (-464.364) * (-454.074) [-454.394] (-456.105) (-457.257) -- 0:00:15
756500 -- (-454.919) [-457.311] (-456.172) (-457.018) * (-454.709) (-456.910) (-455.026) [-456.829] -- 0:00:15
757000 -- (-454.522) [-458.665] (-458.190) (-459.470) * (-454.832) [-454.209] (-454.532) (-456.792) -- 0:00:15
757500 -- (-454.005) (-460.647) [-453.860] (-456.177) * [-455.524] (-456.663) (-454.467) (-457.687) -- 0:00:16
758000 -- (-455.740) (-457.862) [-454.150] (-458.081) * (-457.127) [-459.329] (-456.284) (-454.974) -- 0:00:15
758500 -- [-454.875] (-455.189) (-455.979) (-457.291) * (-460.979) (-461.679) [-456.833] (-455.520) -- 0:00:15
759000 -- (-455.107) (-455.529) (-455.139) [-454.666] * (-462.977) [-454.908] (-454.845) (-457.453) -- 0:00:15
759500 -- (-455.314) (-454.780) [-455.180] (-454.984) * (-457.116) (-456.496) (-456.509) [-455.814] -- 0:00:15
760000 -- [-456.690] (-455.277) (-458.658) (-457.975) * (-456.194) [-456.533] (-455.256) (-456.499) -- 0:00:15
Average standard deviation of split frequencies: 0.006900
760500 -- (-455.334) (-455.055) [-454.011] (-458.116) * (-455.913) (-454.782) (-454.554) [-453.885] -- 0:00:15
761000 -- (-454.830) [-455.335] (-455.313) (-454.404) * (-456.702) [-456.069] (-456.568) (-453.616) -- 0:00:15
761500 -- (-456.007) (-455.989) [-455.216] (-455.115) * (-456.574) [-458.286] (-456.561) (-458.078) -- 0:00:15
762000 -- (-458.480) [-457.162] (-454.988) (-456.754) * (-454.528) [-456.154] (-456.414) (-458.166) -- 0:00:15
762500 -- (-457.276) (-454.417) (-455.155) [-454.319] * [-455.712] (-456.851) (-454.606) (-455.546) -- 0:00:15
763000 -- (-457.160) (-457.349) [-455.554] (-457.390) * (-455.085) (-455.655) [-455.214] (-457.631) -- 0:00:15
763500 -- (-458.060) (-457.294) (-454.491) [-455.449] * [-454.959] (-459.338) (-456.914) (-455.383) -- 0:00:15
764000 -- (-454.735) (-457.517) [-454.594] (-456.717) * [-455.696] (-458.096) (-454.819) (-456.412) -- 0:00:15
764500 -- [-456.575] (-458.707) (-455.690) (-453.576) * (-454.139) (-459.650) [-454.818] (-454.250) -- 0:00:15
765000 -- (-454.831) (-457.228) (-457.871) [-454.022] * (-456.138) [-455.341] (-454.179) (-454.152) -- 0:00:15
Average standard deviation of split frequencies: 0.007885
765500 -- (-455.720) (-455.364) [-455.671] (-455.043) * (-458.660) [-454.564] (-457.277) (-454.754) -- 0:00:15
766000 -- (-455.145) (-457.457) [-456.817] (-457.775) * (-455.617) [-456.715] (-454.560) (-456.878) -- 0:00:15
766500 -- (-458.851) (-458.646) [-458.259] (-456.630) * (-455.456) (-457.914) (-454.249) [-453.793] -- 0:00:15
767000 -- [-460.184] (-456.983) (-454.950) (-456.879) * (-456.208) (-455.652) [-454.542] (-455.439) -- 0:00:15
767500 -- [-455.405] (-458.338) (-456.654) (-454.935) * (-456.617) (-459.175) (-454.259) [-456.062] -- 0:00:15
768000 -- (-454.778) [-456.255] (-455.722) (-454.036) * [-455.669] (-464.189) (-455.852) (-456.558) -- 0:00:15
768500 -- (-457.344) (-454.632) [-453.983] (-455.858) * (-457.169) (-464.001) [-454.563] (-454.204) -- 0:00:15
769000 -- (-455.468) (-458.001) [-455.485] (-454.595) * (-455.322) [-454.244] (-458.727) (-456.947) -- 0:00:15
769500 -- (-455.356) [-455.543] (-457.218) (-454.433) * (-456.948) (-456.263) [-457.115] (-455.130) -- 0:00:14
770000 -- (-454.623) (-457.634) (-454.429) [-454.446] * (-454.955) (-454.709) (-455.800) [-457.528] -- 0:00:14
Average standard deviation of split frequencies: 0.007585
770500 -- (-454.051) (-454.530) [-454.295] (-459.756) * [-456.861] (-454.113) (-453.898) (-455.301) -- 0:00:14
771000 -- (-454.509) (-453.726) (-455.528) [-455.944] * (-455.294) [-454.565] (-455.671) (-455.810) -- 0:00:14
771500 -- (-454.826) [-455.430] (-455.769) (-456.625) * (-457.400) (-455.315) [-454.948] (-455.259) -- 0:00:14
772000 -- (-455.037) [-456.272] (-458.894) (-456.265) * (-457.320) (-454.436) [-454.740] (-458.654) -- 0:00:14
772500 -- (-459.714) [-456.986] (-457.704) (-454.432) * (-456.563) (-454.344) (-454.385) [-454.181] -- 0:00:14
773000 -- (-457.457) [-454.857] (-456.615) (-454.025) * [-454.295] (-456.640) (-455.438) (-454.086) -- 0:00:14
773500 -- (-461.401) [-455.356] (-455.627) (-458.032) * (-454.713) (-454.792) (-455.998) [-455.903] -- 0:00:14
774000 -- (-456.455) [-456.088] (-454.755) (-458.954) * (-459.630) [-455.614] (-457.734) (-456.731) -- 0:00:14
774500 -- [-454.761] (-458.907) (-458.081) (-455.330) * [-454.927] (-454.718) (-454.062) (-454.217) -- 0:00:14
775000 -- (-456.505) (-457.943) [-455.598] (-455.338) * (-457.083) (-455.360) [-457.472] (-455.750) -- 0:00:14
Average standard deviation of split frequencies: 0.007411
775500 -- (-456.469) (-456.006) (-455.980) [-456.460] * [-454.567] (-457.461) (-453.732) (-456.335) -- 0:00:14
776000 -- (-454.093) [-455.530] (-454.609) (-456.819) * (-455.920) (-456.885) (-454.564) [-458.420] -- 0:00:14
776500 -- (-457.361) (-456.807) [-454.524] (-457.077) * [-457.665] (-457.377) (-455.766) (-460.332) -- 0:00:14
777000 -- (-456.235) [-458.987] (-457.225) (-457.320) * [-455.592] (-454.178) (-456.781) (-455.144) -- 0:00:14
777500 -- (-457.496) (-454.535) (-457.788) [-454.689] * (-455.608) (-458.523) (-461.458) [-454.460] -- 0:00:14
778000 -- [-457.374] (-454.624) (-456.092) (-454.769) * [-460.261] (-459.155) (-455.494) (-454.603) -- 0:00:14
778500 -- (-455.641) (-457.304) [-459.417] (-454.539) * (-454.989) (-457.132) [-456.188] (-453.837) -- 0:00:14
779000 -- (-457.085) (-453.801) (-454.406) [-456.697] * [-459.381] (-456.443) (-458.075) (-454.094) -- 0:00:14
779500 -- [-453.704] (-454.711) (-453.584) (-462.330) * (-460.454) (-455.778) (-456.470) [-455.088] -- 0:00:14
780000 -- (-455.742) [-454.915] (-454.501) (-461.545) * (-458.220) [-456.300] (-458.468) (-454.568) -- 0:00:14
Average standard deviation of split frequencies: 0.007367
780500 -- [-455.944] (-457.998) (-456.130) (-454.753) * (-457.096) [-455.597] (-458.488) (-454.500) -- 0:00:14
781000 -- (-457.215) [-456.488] (-457.548) (-456.921) * (-456.873) (-454.583) [-454.822] (-455.705) -- 0:00:14
781500 -- (-456.821) (-457.030) [-455.239] (-457.292) * (-456.894) [-455.056] (-457.702) (-455.485) -- 0:00:14
782000 -- (-455.305) (-459.298) [-459.544] (-456.903) * [-455.918] (-455.455) (-457.483) (-455.491) -- 0:00:14
782500 -- [-456.016] (-456.179) (-455.038) (-454.742) * (-455.682) [-455.632] (-455.629) (-456.295) -- 0:00:14
783000 -- (-456.173) [-453.627] (-456.261) (-457.048) * (-456.439) (-454.920) (-455.236) [-454.400] -- 0:00:14
783500 -- (-454.923) [-455.172] (-454.957) (-454.251) * (-457.791) (-455.372) [-456.217] (-454.678) -- 0:00:14
784000 -- (-454.258) (-455.481) [-454.269] (-457.771) * [-455.202] (-456.549) (-458.952) (-454.595) -- 0:00:14
784500 -- (-456.280) [-455.972] (-453.724) (-454.725) * [-455.033] (-456.228) (-458.878) (-455.029) -- 0:00:14
785000 -- [-455.574] (-454.095) (-456.744) (-454.726) * [-455.029] (-457.863) (-456.214) (-455.247) -- 0:00:13
Average standard deviation of split frequencies: 0.007237
785500 -- (-454.801) (-455.548) (-460.255) [-456.385] * (-454.804) (-458.401) [-454.959] (-459.485) -- 0:00:13
786000 -- (-456.770) [-456.678] (-457.176) (-458.331) * (-455.062) (-459.846) (-455.589) [-455.617] -- 0:00:13
786500 -- (-459.869) (-456.281) [-456.626] (-457.183) * (-455.488) (-454.440) [-454.345] (-454.100) -- 0:00:13
787000 -- (-456.756) (-455.744) [-455.646] (-456.082) * (-461.433) (-456.134) [-454.734] (-459.264) -- 0:00:13
787500 -- [-456.193] (-455.272) (-459.079) (-454.913) * (-457.969) (-457.254) (-455.978) [-455.581] -- 0:00:13
788000 -- (-455.947) (-454.576) (-455.254) [-454.862] * (-456.693) (-458.732) [-454.829] (-458.675) -- 0:00:13
788500 -- (-456.352) (-457.423) [-458.252] (-456.517) * (-460.281) (-457.737) (-456.278) [-456.700] -- 0:00:13
789000 -- (-456.608) [-454.548] (-458.118) (-457.728) * (-456.778) (-456.064) [-454.855] (-455.338) -- 0:00:13
789500 -- (-454.427) [-456.655] (-455.926) (-455.821) * (-456.825) (-455.996) (-455.380) [-459.755] -- 0:00:13
790000 -- (-460.120) (-456.331) (-456.408) [-459.903] * (-455.914) [-459.615] (-455.825) (-454.218) -- 0:00:13
Average standard deviation of split frequencies: 0.007155
790500 -- [-454.313] (-454.976) (-456.385) (-455.483) * (-458.269) (-454.409) [-454.805] (-456.163) -- 0:00:13
791000 -- (-456.083) (-453.881) [-453.713] (-457.591) * (-457.029) (-455.138) [-455.385] (-454.796) -- 0:00:13
791500 -- (-456.106) (-457.017) (-454.056) [-462.617] * (-458.875) [-455.367] (-459.400) (-459.625) -- 0:00:13
792000 -- (-458.849) (-454.046) [-454.107] (-456.659) * [-455.401] (-456.451) (-455.122) (-455.490) -- 0:00:13
792500 -- (-455.743) [-453.946] (-455.585) (-454.546) * [-454.480] (-458.704) (-456.231) (-461.012) -- 0:00:13
793000 -- (-455.228) (-455.093) (-457.246) [-453.877] * [-454.573] (-456.607) (-456.617) (-457.556) -- 0:00:13
793500 -- [-456.679] (-456.189) (-457.036) (-454.142) * [-457.106] (-459.639) (-455.336) (-457.089) -- 0:00:13
794000 -- (-456.207) (-456.849) [-456.843] (-455.937) * [-460.750] (-459.179) (-455.870) (-459.000) -- 0:00:13
794500 -- (-455.118) (-457.410) (-454.923) [-454.282] * (-458.696) (-459.391) (-456.524) [-459.199] -- 0:00:13
795000 -- (-456.393) (-455.152) (-453.932) [-455.277] * (-458.981) (-455.014) (-455.239) [-455.322] -- 0:00:13
Average standard deviation of split frequencies: 0.007067
795500 -- (-455.266) (-457.112) [-457.307] (-460.860) * (-455.118) (-456.914) (-456.740) [-459.716] -- 0:00:13
796000 -- (-458.002) (-462.617) [-455.634] (-454.464) * (-459.771) (-457.702) (-453.937) [-455.507] -- 0:00:13
796500 -- (-456.429) (-458.243) [-456.878] (-457.775) * (-455.172) [-454.213] (-458.868) (-456.126) -- 0:00:13
797000 -- (-455.776) [-455.629] (-456.120) (-456.660) * (-454.384) (-455.325) [-456.613] (-454.712) -- 0:00:13
797500 -- (-455.634) [-456.514] (-456.002) (-458.101) * [-454.029] (-456.027) (-456.193) (-456.241) -- 0:00:13
798000 -- (-454.483) [-457.165] (-454.746) (-457.221) * [-454.942] (-455.299) (-459.445) (-455.449) -- 0:00:13
798500 -- (-456.567) [-457.487] (-457.449) (-454.007) * (-457.062) (-455.451) (-456.810) [-457.246] -- 0:00:13
799000 -- (-456.623) (-457.421) (-456.490) [-455.422] * (-454.705) (-456.114) [-456.613] (-455.424) -- 0:00:13
799500 -- (-457.016) (-454.216) (-455.717) [-457.171] * [-455.084] (-456.117) (-459.718) (-455.584) -- 0:00:13
800000 -- (-459.177) [-453.956] (-454.644) (-457.944) * [-454.247] (-460.173) (-454.850) (-456.066) -- 0:00:12
Average standard deviation of split frequencies: 0.006987
800500 -- [-455.033] (-456.041) (-454.201) (-455.267) * (-455.153) [-457.387] (-454.504) (-457.960) -- 0:00:12
801000 -- (-457.853) (-459.220) (-454.798) [-454.562] * (-454.980) [-454.442] (-461.073) (-454.326) -- 0:00:12
801500 -- [-454.015] (-457.639) (-454.808) (-456.259) * (-458.542) (-455.955) (-458.967) [-455.207] -- 0:00:12
802000 -- (-456.911) (-457.570) (-454.906) [-456.395] * (-454.640) (-456.581) (-455.318) [-453.921] -- 0:00:12
802500 -- [-455.833] (-457.561) (-459.879) (-454.373) * (-455.139) [-453.906] (-459.217) (-454.886) -- 0:00:12
803000 -- [-455.270] (-454.579) (-455.790) (-455.656) * (-454.236) (-454.575) [-456.586] (-457.622) -- 0:00:12
803500 -- (-455.242) [-454.681] (-456.847) (-458.007) * (-456.390) [-455.748] (-457.674) (-456.540) -- 0:00:12
804000 -- (-456.063) (-454.150) (-456.636) [-456.876] * [-454.708] (-454.083) (-456.764) (-454.355) -- 0:00:12
804500 -- (-455.787) [-458.641] (-462.779) (-458.349) * [-453.627] (-456.777) (-457.801) (-459.649) -- 0:00:12
805000 -- (-456.198) (-455.757) [-455.795] (-457.506) * (-455.398) (-453.793) (-458.058) [-455.278] -- 0:00:12
Average standard deviation of split frequencies: 0.007018
805500 -- [-454.773] (-456.606) (-456.013) (-456.019) * (-459.054) (-453.769) [-457.673] (-461.284) -- 0:00:12
806000 -- (-456.241) [-456.828] (-455.588) (-454.559) * (-456.887) (-454.520) (-459.950) [-455.617] -- 0:00:12
806500 -- (-453.642) (-456.866) [-455.895] (-457.304) * (-457.728) (-458.590) (-459.214) [-459.472] -- 0:00:12
807000 -- (-456.451) (-457.602) (-454.798) [-454.231] * (-455.325) [-456.132] (-458.089) (-457.279) -- 0:00:12
807500 -- (-454.636) [-454.596] (-457.702) (-457.982) * (-453.968) (-454.964) (-455.864) [-456.398] -- 0:00:12
808000 -- [-454.235] (-455.118) (-454.423) (-456.204) * (-454.395) (-455.612) (-454.697) [-455.341] -- 0:00:12
808500 -- (-455.952) (-454.547) (-456.614) [-454.028] * (-457.461) (-457.958) [-457.231] (-458.198) -- 0:00:12
809000 -- (-456.617) (-454.827) [-457.793] (-455.293) * [-458.332] (-460.279) (-458.035) (-454.421) -- 0:00:12
809500 -- [-454.776] (-457.625) (-456.160) (-455.497) * (-460.905) (-458.111) [-454.811] (-455.056) -- 0:00:12
810000 -- (-456.591) (-458.108) [-454.987] (-453.729) * (-456.006) [-455.540] (-456.417) (-455.392) -- 0:00:12
Average standard deviation of split frequencies: 0.006784
810500 -- (-454.573) (-456.361) (-458.308) [-455.956] * (-455.541) (-455.930) (-456.905) [-458.037] -- 0:00:12
811000 -- (-455.387) (-456.394) [-458.747] (-458.028) * (-457.067) (-457.814) (-455.328) [-454.363] -- 0:00:12
811500 -- (-455.411) (-454.948) [-455.822] (-456.640) * (-458.269) (-457.164) (-454.705) [-458.003] -- 0:00:12
812000 -- (-453.968) (-464.144) [-455.089] (-453.914) * (-456.928) (-458.566) [-455.282] (-455.991) -- 0:00:12
812500 -- [-455.388] (-466.360) (-455.474) (-455.173) * (-458.835) [-457.092] (-456.021) (-454.749) -- 0:00:12
813000 -- (-456.572) (-458.668) [-454.827] (-454.323) * (-457.931) [-454.802] (-454.933) (-455.520) -- 0:00:12
813500 -- (-454.336) [-458.759] (-454.786) (-457.103) * (-458.406) (-457.369) (-455.760) [-455.181] -- 0:00:12
814000 -- (-456.661) (-454.609) [-454.590] (-461.149) * (-454.373) (-457.619) [-454.791] (-457.128) -- 0:00:12
814500 -- (-457.318) (-459.736) [-460.380] (-456.176) * (-455.391) [-457.372] (-455.152) (-458.124) -- 0:00:12
815000 -- (-457.171) [-454.966] (-456.613) (-455.694) * (-456.194) [-455.878] (-457.996) (-459.968) -- 0:00:12
Average standard deviation of split frequencies: 0.006932
815500 -- (-454.778) [-454.833] (-456.559) (-456.563) * (-454.841) (-456.943) [-455.750] (-456.580) -- 0:00:11
816000 -- [-457.565] (-455.906) (-455.653) (-455.277) * [-457.723] (-455.563) (-456.084) (-459.347) -- 0:00:11
816500 -- [-455.875] (-454.956) (-454.245) (-455.900) * (-456.791) [-457.527] (-455.374) (-457.153) -- 0:00:11
817000 -- [-455.173] (-456.194) (-461.225) (-455.562) * [-456.964] (-458.046) (-455.054) (-456.370) -- 0:00:11
817500 -- (-456.283) (-457.033) (-460.870) [-456.247] * [-454.268] (-464.094) (-455.826) (-455.252) -- 0:00:11
818000 -- (-464.656) (-458.515) (-458.369) [-455.916] * [-454.565] (-455.210) (-458.110) (-457.905) -- 0:00:11
818500 -- (-455.123) (-456.609) [-456.813] (-458.611) * (-455.497) [-456.234] (-457.199) (-455.621) -- 0:00:11
819000 -- (-457.569) (-456.403) [-455.404] (-457.065) * (-455.719) (-456.109) (-456.361) [-457.400] -- 0:00:11
819500 -- (-459.593) (-456.232) (-454.591) [-461.497] * (-455.720) (-455.101) [-455.975] (-455.341) -- 0:00:11
820000 -- (-455.893) [-459.172] (-456.088) (-461.846) * (-456.436) (-455.533) [-456.736] (-455.870) -- 0:00:11
Average standard deviation of split frequencies: 0.006625
820500 -- (-455.990) (-457.953) (-461.301) [-454.401] * (-456.316) [-454.637] (-455.163) (-454.178) -- 0:00:11
821000 -- (-455.937) (-457.281) (-455.335) [-455.052] * (-455.614) (-455.443) (-453.886) [-455.435] -- 0:00:11
821500 -- (-454.873) (-456.428) (-456.698) [-455.192] * (-457.815) (-455.317) [-456.760] (-455.984) -- 0:00:11
822000 -- [-455.390] (-454.924) (-455.912) (-456.436) * (-455.521) (-454.295) (-456.932) [-455.817] -- 0:00:11
822500 -- (-456.893) (-454.472) (-456.312) [-457.965] * [-453.927] (-455.071) (-456.847) (-455.923) -- 0:00:11
823000 -- (-456.905) (-458.115) [-458.799] (-454.580) * [-456.038] (-455.027) (-454.576) (-455.395) -- 0:00:11
823500 -- [-454.409] (-454.243) (-461.473) (-453.987) * [-459.115] (-457.508) (-457.192) (-454.996) -- 0:00:11
824000 -- (-456.239) [-454.021] (-460.579) (-455.213) * (-454.119) (-457.597) [-455.560] (-454.097) -- 0:00:11
824500 -- (-455.186) [-458.004] (-454.107) (-454.870) * [-454.023] (-456.138) (-457.167) (-461.267) -- 0:00:11
825000 -- [-455.877] (-458.273) (-459.111) (-456.461) * (-454.345) (-455.415) (-454.014) [-458.366] -- 0:00:11
Average standard deviation of split frequencies: 0.006696
825500 -- (-457.341) [-456.274] (-457.008) (-460.445) * [-453.972] (-458.974) (-454.973) (-456.809) -- 0:00:11
826000 -- (-457.870) (-454.128) [-455.965] (-455.809) * (-454.452) [-455.605] (-454.960) (-456.218) -- 0:00:11
826500 -- (-455.773) (-454.891) [-454.823] (-455.347) * (-455.093) [-455.448] (-460.720) (-453.909) -- 0:00:11
827000 -- [-456.089] (-455.055) (-455.263) (-454.428) * (-454.516) (-458.181) (-455.049) [-455.890] -- 0:00:11
827500 -- (-454.830) (-455.026) [-456.162] (-455.787) * (-455.509) [-455.526] (-456.048) (-457.182) -- 0:00:11
828000 -- (-453.551) [-454.202] (-457.420) (-454.144) * (-455.112) (-457.765) (-456.831) [-455.797] -- 0:00:11
828500 -- (-456.749) (-454.837) [-456.987] (-455.234) * (-455.426) (-455.870) [-459.978] (-456.008) -- 0:00:11
829000 -- [-455.574] (-458.230) (-459.760) (-455.678) * (-457.637) [-457.386] (-459.342) (-455.517) -- 0:00:11
829500 -- [-457.140] (-455.653) (-457.484) (-456.752) * [-456.369] (-454.482) (-454.708) (-455.131) -- 0:00:11
830000 -- [-454.640] (-455.036) (-456.754) (-455.666) * (-454.804) (-454.293) [-456.354] (-455.155) -- 0:00:11
Average standard deviation of split frequencies: 0.006507
830500 -- (-455.651) (-455.081) [-455.700] (-457.951) * (-454.657) [-454.533] (-454.715) (-455.686) -- 0:00:11
831000 -- (-458.227) (-457.543) [-456.086] (-457.172) * (-455.168) (-456.040) [-455.340] (-462.877) -- 0:00:10
831500 -- (-454.909) (-455.730) [-455.691] (-453.764) * (-458.099) (-454.007) (-455.529) [-456.857] -- 0:00:10
832000 -- (-458.130) [-454.619] (-454.297) (-455.427) * (-454.206) (-455.349) (-456.375) [-455.967] -- 0:00:10
832500 -- (-455.812) [-455.075] (-454.855) (-454.011) * (-455.449) (-459.595) (-454.738) [-457.217] -- 0:00:10
833000 -- (-455.875) (-454.514) (-454.844) [-454.062] * (-455.777) [-457.774] (-455.709) (-454.762) -- 0:00:10
833500 -- (-455.907) [-455.697] (-458.194) (-455.741) * [-457.396] (-456.157) (-458.569) (-457.995) -- 0:00:10
834000 -- (-455.990) (-456.505) (-455.000) [-456.297] * (-459.436) (-462.390) (-455.513) [-457.303] -- 0:00:10
834500 -- (-455.626) (-454.176) (-455.849) [-457.137] * (-453.756) (-455.280) [-457.068] (-461.983) -- 0:00:10
835000 -- (-456.318) (-456.169) [-455.257] (-457.020) * [-454.564] (-456.605) (-457.988) (-460.026) -- 0:00:10
Average standard deviation of split frequencies: 0.006428
835500 -- (-454.492) (-455.601) [-455.402] (-458.295) * (-455.076) (-456.692) [-453.704] (-457.866) -- 0:00:10
836000 -- [-455.359] (-457.676) (-455.136) (-457.942) * (-454.732) [-454.980] (-455.490) (-456.073) -- 0:00:10
836500 -- (-457.329) (-455.303) (-455.988) [-454.973] * (-455.281) [-454.891] (-457.128) (-454.958) -- 0:00:10
837000 -- (-457.207) (-455.063) [-456.276] (-455.069) * [-455.606] (-454.104) (-460.844) (-458.259) -- 0:00:10
837500 -- [-460.494] (-454.194) (-455.763) (-455.529) * (-454.839) [-459.735] (-454.916) (-457.418) -- 0:00:10
838000 -- (-459.991) (-454.663) (-455.771) [-454.554] * (-455.031) [-454.198] (-457.095) (-457.509) -- 0:00:10
838500 -- [-455.756] (-455.093) (-455.930) (-456.754) * (-456.688) (-454.296) (-456.915) [-456.146] -- 0:00:10
839000 -- [-455.300] (-455.173) (-455.732) (-455.984) * (-455.219) [-455.361] (-457.885) (-457.108) -- 0:00:10
839500 -- (-462.459) (-455.234) [-456.485] (-453.737) * [-454.728] (-456.476) (-457.441) (-456.799) -- 0:00:10
840000 -- [-457.336] (-454.913) (-454.610) (-456.506) * (-458.185) (-455.490) (-457.006) [-456.649] -- 0:00:10
Average standard deviation of split frequencies: 0.006654
840500 -- (-461.842) (-454.776) (-456.662) [-454.310] * (-457.306) (-455.519) [-456.966] (-462.903) -- 0:00:10
841000 -- [-456.294] (-455.036) (-456.466) (-457.295) * (-456.206) (-454.791) [-454.567] (-454.893) -- 0:00:10
841500 -- (-456.785) [-457.521] (-459.360) (-465.798) * (-456.073) (-457.872) [-458.716] (-461.228) -- 0:00:10
842000 -- [-455.885] (-457.902) (-454.718) (-459.754) * [-455.004] (-458.974) (-455.252) (-457.103) -- 0:00:10
842500 -- (-454.706) [-455.904] (-454.976) (-454.712) * (-456.183) (-455.506) (-457.038) [-457.027] -- 0:00:10
843000 -- (-454.242) [-459.276] (-455.798) (-459.921) * [-457.195] (-456.266) (-457.900) (-453.755) -- 0:00:10
843500 -- [-457.515] (-455.445) (-455.472) (-454.994) * (-457.681) (-455.109) [-456.721] (-456.655) -- 0:00:10
844000 -- (-455.815) [-456.780] (-454.985) (-459.472) * (-454.960) (-456.896) (-462.019) [-456.530] -- 0:00:10
844500 -- (-456.403) (-458.089) [-453.986] (-454.019) * (-455.300) (-460.147) [-455.076] (-454.413) -- 0:00:10
845000 -- (-454.854) (-457.092) (-455.939) [-455.109] * (-455.571) [-455.038] (-454.552) (-454.981) -- 0:00:10
Average standard deviation of split frequencies: 0.006352
845500 -- (-454.773) [-462.230] (-453.736) (-459.416) * (-456.919) [-457.590] (-454.494) (-456.417) -- 0:00:10
846000 -- (-455.832) (-460.744) (-454.159) [-455.263] * (-454.778) (-455.177) (-455.535) [-456.915] -- 0:00:10
846500 -- [-455.118] (-464.273) (-455.034) (-455.913) * (-458.846) (-457.012) [-456.494] (-457.115) -- 0:00:09
847000 -- (-456.312) [-457.261] (-460.179) (-456.956) * (-455.504) [-457.077] (-454.886) (-453.812) -- 0:00:09
847500 -- (-455.515) (-457.384) (-460.623) [-454.407] * (-455.978) (-455.937) (-459.513) [-454.731] -- 0:00:09
848000 -- (-454.300) (-457.234) (-454.384) [-453.815] * (-454.296) [-455.508] (-456.464) (-454.655) -- 0:00:09
848500 -- [-455.035] (-454.885) (-455.011) (-455.884) * (-455.831) (-455.307) [-456.577] (-455.712) -- 0:00:09
849000 -- (-456.688) (-455.376) (-454.304) [-457.413] * (-456.366) (-454.739) [-457.094] (-455.585) -- 0:00:09
849500 -- (-456.241) (-457.643) [-457.721] (-454.897) * [-457.679] (-453.685) (-456.055) (-455.256) -- 0:00:09
850000 -- (-456.936) [-456.240] (-458.451) (-456.942) * (-456.758) (-457.753) [-458.211] (-456.588) -- 0:00:09
Average standard deviation of split frequencies: 0.006465
850500 -- [-455.110] (-457.472) (-456.712) (-454.135) * (-459.998) (-455.890) (-457.173) [-453.978] -- 0:00:09
851000 -- (-456.471) (-454.826) (-455.670) [-453.960] * (-459.031) (-456.422) [-454.332] (-455.774) -- 0:00:09
851500 -- (-454.411) [-455.740] (-456.919) (-457.042) * (-460.139) (-455.233) (-455.762) [-461.196] -- 0:00:09
852000 -- (-455.743) (-454.171) (-457.091) [-458.691] * (-457.993) (-460.497) [-455.143] (-455.595) -- 0:00:09
852500 -- (-458.084) (-454.505) (-455.737) [-455.334] * [-458.734] (-459.679) (-456.938) (-456.295) -- 0:00:09
853000 -- (-456.310) (-455.197) (-455.297) [-454.952] * (-460.705) [-456.429] (-455.647) (-460.914) -- 0:00:09
853500 -- [-456.170] (-462.639) (-457.071) (-454.137) * [-454.039] (-456.094) (-456.743) (-455.883) -- 0:00:09
854000 -- [-455.463] (-460.154) (-457.432) (-454.792) * [-455.298] (-456.786) (-455.161) (-456.266) -- 0:00:09
854500 -- (-460.636) (-454.820) (-455.171) [-455.197] * [-454.536] (-457.706) (-456.556) (-456.525) -- 0:00:09
855000 -- [-458.116] (-455.557) (-456.181) (-455.296) * (-459.273) [-457.567] (-455.450) (-457.259) -- 0:00:09
Average standard deviation of split frequencies: 0.006388
855500 -- (-455.548) (-455.603) (-454.167) [-457.008] * (-456.985) (-460.226) (-457.139) [-455.616] -- 0:00:09
856000 -- (-455.318) (-455.443) [-455.353] (-455.174) * [-457.097] (-456.804) (-457.135) (-457.265) -- 0:00:09
856500 -- (-455.549) [-454.151] (-454.690) (-456.976) * (-455.976) (-455.332) [-456.275] (-457.357) -- 0:00:09
857000 -- (-455.481) (-456.455) (-455.080) [-454.500] * (-456.782) (-456.686) (-455.883) [-455.692] -- 0:00:09
857500 -- (-456.591) [-454.334] (-454.731) (-457.698) * (-458.358) (-455.240) (-455.989) [-455.757] -- 0:00:09
858000 -- (-455.879) (-454.711) (-455.758) [-457.395] * (-456.475) (-456.777) [-458.338] (-456.856) -- 0:00:09
858500 -- (-456.626) [-457.796] (-458.236) (-457.108) * (-455.703) [-453.754] (-457.538) (-456.184) -- 0:00:09
859000 -- (-454.347) (-458.066) [-455.947] (-458.355) * (-456.510) [-457.341] (-454.192) (-459.957) -- 0:00:09
859500 -- [-455.547] (-455.086) (-456.711) (-457.281) * (-460.144) (-457.008) [-454.092] (-457.147) -- 0:00:09
860000 -- (-454.481) [-455.846] (-457.143) (-456.678) * (-461.295) [-456.784] (-454.410) (-456.386) -- 0:00:09
Average standard deviation of split frequencies: 0.006427
860500 -- [-454.169] (-459.946) (-455.673) (-456.111) * (-457.588) (-455.915) (-456.905) [-455.429] -- 0:00:09
861000 -- (-453.917) (-454.285) [-454.567] (-455.303) * (-457.723) [-454.612] (-455.909) (-454.266) -- 0:00:09
861500 -- (-456.960) [-460.870] (-456.905) (-454.463) * [-455.472] (-459.446) (-458.281) (-454.633) -- 0:00:09
862000 -- (-455.062) (-455.455) [-454.152] (-454.274) * (-455.290) [-456.915] (-455.477) (-459.341) -- 0:00:08
862500 -- (-455.262) (-455.110) (-455.836) [-454.746] * (-456.052) (-455.997) [-456.842] (-460.370) -- 0:00:08
863000 -- (-455.032) [-453.894] (-455.933) (-453.879) * (-456.550) [-456.611] (-456.959) (-454.700) -- 0:00:08
863500 -- (-456.731) (-455.694) (-460.061) [-454.084] * (-456.180) (-454.195) [-455.686] (-454.951) -- 0:00:08
864000 -- [-459.866] (-455.796) (-455.127) (-456.927) * (-456.723) (-454.424) [-454.628] (-454.442) -- 0:00:08
864500 -- (-455.205) (-457.429) (-455.837) [-458.923] * (-455.919) [-454.345] (-456.954) (-459.587) -- 0:00:08
865000 -- (-456.261) (-454.135) [-455.687] (-456.165) * [-462.142] (-454.035) (-456.483) (-461.783) -- 0:00:08
Average standard deviation of split frequencies: 0.006641
865500 -- (-458.132) (-454.905) [-453.779] (-456.515) * [-454.368] (-453.801) (-458.227) (-462.481) -- 0:00:08
866000 -- [-456.426] (-457.751) (-454.719) (-454.013) * (-457.470) [-453.647] (-456.590) (-455.184) -- 0:00:08
866500 -- (-455.814) (-458.358) [-454.850] (-455.333) * (-463.182) (-454.357) [-455.389] (-454.073) -- 0:00:08
867000 -- (-456.290) [-455.300] (-454.703) (-460.145) * (-454.623) (-456.349) (-456.297) [-454.040] -- 0:00:08
867500 -- (-455.264) [-454.592] (-456.055) (-455.000) * (-454.128) (-455.131) [-458.957] (-456.585) -- 0:00:08
868000 -- (-457.258) [-455.560] (-455.567) (-456.273) * (-455.213) (-457.401) (-456.106) [-455.599] -- 0:00:08
868500 -- (-458.121) [-455.618] (-454.448) (-454.767) * [-457.346] (-456.258) (-457.150) (-455.350) -- 0:00:08
869000 -- (-455.345) (-456.199) [-454.383] (-454.757) * (-455.578) (-458.407) [-454.580] (-456.644) -- 0:00:08
869500 -- (-456.113) (-454.776) (-454.447) [-457.155] * (-454.192) (-453.684) (-455.209) [-455.418] -- 0:00:08
870000 -- (-455.120) (-454.217) [-453.941] (-456.866) * (-455.125) (-454.418) (-457.018) [-457.471] -- 0:00:08
Average standard deviation of split frequencies: 0.006100
870500 -- (-456.106) [-457.232] (-455.200) (-456.015) * (-460.217) (-456.321) [-455.469] (-454.898) -- 0:00:08
871000 -- [-457.216] (-456.599) (-455.208) (-460.483) * (-455.318) (-455.773) (-454.885) [-455.696] -- 0:00:08
871500 -- [-456.098] (-459.233) (-454.765) (-458.136) * (-455.982) [-456.565] (-457.199) (-457.728) -- 0:00:08
872000 -- [-455.626] (-454.218) (-455.108) (-459.610) * (-455.961) (-453.626) [-459.177] (-454.226) -- 0:00:08
872500 -- [-454.506] (-455.320) (-455.220) (-458.171) * (-461.030) (-453.624) [-457.861] (-455.454) -- 0:00:08
873000 -- (-454.428) (-455.993) [-456.091] (-460.734) * [-454.579] (-460.930) (-455.484) (-457.267) -- 0:00:08
873500 -- (-454.655) (-455.863) [-454.744] (-454.070) * (-455.065) (-455.985) (-458.215) [-456.025] -- 0:00:08
874000 -- (-456.943) [-454.572] (-456.956) (-454.105) * (-457.378) (-454.698) (-458.227) [-457.338] -- 0:00:08
874500 -- (-456.460) (-455.278) (-455.278) [-454.732] * (-465.271) (-453.907) [-456.755] (-460.189) -- 0:00:08
875000 -- [-461.563] (-455.745) (-456.592) (-455.736) * (-459.545) [-455.512] (-456.829) (-456.004) -- 0:00:08
Average standard deviation of split frequencies: 0.006063
875500 -- (-460.675) (-456.428) [-455.568] (-454.264) * (-461.126) (-455.531) [-455.301] (-456.599) -- 0:00:08
876000 -- [-453.920] (-455.652) (-455.857) (-456.738) * (-457.622) [-454.291] (-455.078) (-461.015) -- 0:00:08
876500 -- (-457.035) (-455.716) [-454.599] (-456.068) * (-455.024) [-453.835] (-456.386) (-458.682) -- 0:00:08
877000 -- (-454.703) [-455.649] (-460.049) (-457.293) * [-456.100] (-457.233) (-454.499) (-455.451) -- 0:00:07
877500 -- (-454.328) (-456.455) (-456.011) [-454.491] * (-455.740) [-454.756] (-454.851) (-456.155) -- 0:00:07
878000 -- (-455.027) (-458.088) [-455.634] (-454.454) * (-457.202) (-454.206) (-455.911) [-454.208] -- 0:00:07
878500 -- (-454.778) (-458.026) (-461.300) [-454.840] * (-454.857) (-456.401) (-456.619) [-454.446] -- 0:00:07
879000 -- (-455.650) (-459.846) [-459.017] (-461.021) * (-456.581) (-454.133) (-454.392) [-455.858] -- 0:00:07
879500 -- (-457.654) (-455.276) [-456.267] (-455.520) * (-459.169) (-455.084) [-455.778] (-456.607) -- 0:00:07
880000 -- (-454.253) [-455.006] (-455.575) (-457.198) * (-456.756) [-454.982] (-456.145) (-457.398) -- 0:00:07
Average standard deviation of split frequencies: 0.006067
880500 -- (-457.810) [-454.907] (-455.686) (-459.542) * (-456.269) (-454.204) [-456.129] (-454.269) -- 0:00:07
881000 -- (-458.278) [-454.661] (-456.321) (-455.437) * (-454.285) [-454.956] (-454.962) (-455.313) -- 0:00:07
881500 -- [-456.098] (-460.615) (-456.754) (-454.377) * (-456.621) (-456.247) [-453.999] (-456.262) -- 0:00:07
882000 -- (-456.808) [-454.583] (-455.529) (-460.644) * (-455.733) [-458.519] (-454.066) (-461.277) -- 0:00:07
882500 -- [-455.218] (-454.699) (-454.063) (-454.433) * (-456.646) (-454.653) (-454.902) [-456.298] -- 0:00:07
883000 -- (-454.094) [-453.948] (-454.053) (-455.029) * (-459.879) (-455.240) [-454.957] (-455.729) -- 0:00:07
883500 -- [-457.113] (-456.877) (-454.606) (-454.948) * (-458.771) (-457.106) [-458.432] (-455.924) -- 0:00:07
884000 -- (-458.805) (-455.761) (-456.680) [-455.932] * (-454.839) (-455.847) (-457.275) [-454.735] -- 0:00:07
884500 -- (-456.683) [-455.234] (-456.224) (-455.972) * [-456.983] (-458.371) (-457.525) (-459.879) -- 0:00:07
885000 -- [-459.315] (-455.903) (-455.703) (-456.248) * [-457.973] (-456.116) (-457.364) (-454.712) -- 0:00:07
Average standard deviation of split frequencies: 0.006491
885500 -- (-455.308) [-456.222] (-456.049) (-456.516) * (-454.850) (-454.746) [-454.477] (-454.527) -- 0:00:07
886000 -- (-455.056) (-454.582) [-455.561] (-455.776) * (-458.527) (-455.869) [-454.996] (-456.170) -- 0:00:07
886500 -- (-454.700) (-459.682) (-455.910) [-454.065] * (-462.271) (-455.925) (-459.302) [-457.772] -- 0:00:07
887000 -- (-454.602) (-455.741) (-454.333) [-455.012] * (-454.417) (-456.840) [-454.440] (-455.710) -- 0:00:07
887500 -- (-454.240) [-455.963] (-454.450) (-456.066) * (-456.473) (-455.200) [-456.075] (-455.254) -- 0:00:07
888000 -- (-454.410) (-456.805) (-453.836) [-457.440] * [-458.059] (-457.433) (-455.808) (-459.726) -- 0:00:07
888500 -- (-455.601) (-458.387) [-453.843] (-456.444) * (-458.620) (-463.002) (-459.361) [-460.371] -- 0:00:07
889000 -- (-454.613) (-455.990) (-453.894) [-458.545] * (-457.302) (-460.622) (-458.864) [-454.367] -- 0:00:07
889500 -- [-455.529] (-455.402) (-455.648) (-455.642) * (-457.124) [-458.331] (-455.072) (-456.730) -- 0:00:07
890000 -- (-454.200) [-457.059] (-456.519) (-456.738) * (-454.696) (-457.320) (-457.071) [-459.379] -- 0:00:07
Average standard deviation of split frequencies: 0.006175
890500 -- (-456.122) (-456.402) (-457.196) [-455.181] * [-455.718] (-457.991) (-456.982) (-457.861) -- 0:00:07
891000 -- (-456.608) (-454.505) [-457.704] (-456.949) * (-455.200) (-455.653) (-454.996) [-456.510] -- 0:00:07
891500 -- (-455.355) (-455.969) (-460.345) [-455.549] * (-455.324) (-454.804) [-455.324] (-456.510) -- 0:00:07
892000 -- [-456.640] (-456.625) (-459.452) (-455.118) * [-456.567] (-455.799) (-456.784) (-454.223) -- 0:00:07
892500 -- (-455.309) (-457.848) (-454.551) [-456.811] * [-455.894] (-456.055) (-455.247) (-456.203) -- 0:00:06
893000 -- [-456.885] (-455.950) (-455.270) (-454.818) * (-456.711) (-456.205) [-456.040] (-456.648) -- 0:00:06
893500 -- (-456.882) [-456.102] (-454.678) (-454.477) * (-454.252) [-455.909] (-455.069) (-458.447) -- 0:00:06
894000 -- (-455.105) [-455.881] (-455.298) (-457.006) * (-455.295) [-456.275] (-456.811) (-456.523) -- 0:00:06
894500 -- [-456.949] (-455.803) (-454.584) (-454.983) * (-455.285) (-457.463) (-457.958) [-455.824] -- 0:00:06
895000 -- [-459.946] (-455.788) (-453.966) (-454.701) * (-454.224) [-459.221] (-459.953) (-456.218) -- 0:00:06
Average standard deviation of split frequencies: 0.006068
895500 -- (-457.541) (-456.341) [-455.660] (-455.445) * [-454.795] (-454.643) (-456.967) (-456.702) -- 0:00:06
896000 -- (-456.435) (-455.654) (-456.630) [-454.900] * (-457.319) (-463.864) (-455.392) [-455.134] -- 0:00:06
896500 -- [-456.604] (-456.666) (-455.147) (-454.489) * [-461.444] (-454.070) (-456.765) (-458.670) -- 0:00:06
897000 -- (-456.851) [-455.319] (-455.423) (-455.153) * [-457.934] (-454.656) (-455.294) (-454.760) -- 0:00:06
897500 -- (-457.755) (-456.218) [-461.758] (-454.885) * (-455.464) [-454.490] (-455.244) (-457.298) -- 0:00:06
898000 -- (-460.202) (-456.619) [-455.449] (-457.038) * [-457.024] (-454.607) (-455.723) (-458.195) -- 0:00:06
898500 -- (-455.052) (-457.065) (-455.951) [-453.884] * (-456.543) (-455.678) [-454.931] (-454.803) -- 0:00:06
899000 -- [-457.506] (-457.452) (-454.588) (-453.817) * (-454.902) (-455.669) [-455.530] (-456.035) -- 0:00:06
899500 -- (-454.758) (-455.463) (-456.196) [-460.223] * (-457.467) [-455.324] (-458.962) (-456.847) -- 0:00:06
900000 -- [-457.385] (-455.290) (-457.164) (-457.764) * (-456.270) [-454.797] (-456.951) (-456.020) -- 0:00:06
Average standard deviation of split frequencies: 0.006351
900500 -- [-457.793] (-455.924) (-458.509) (-456.193) * [-458.102] (-459.023) (-460.044) (-454.496) -- 0:00:06
901000 -- (-456.365) [-454.943] (-454.441) (-458.729) * (-460.960) (-455.576) (-458.221) [-455.600] -- 0:00:06
901500 -- [-453.675] (-457.218) (-460.857) (-458.603) * (-461.628) [-458.149] (-455.491) (-455.636) -- 0:00:06
902000 -- [-453.875] (-458.523) (-455.002) (-459.264) * [-457.210] (-455.853) (-454.287) (-455.368) -- 0:00:06
902500 -- (-455.691) (-459.088) [-454.912] (-459.738) * (-458.126) (-458.445) (-457.928) [-455.740] -- 0:00:06
903000 -- [-455.709] (-455.621) (-454.660) (-456.120) * (-458.184) (-455.364) [-455.918] (-456.912) -- 0:00:06
903500 -- (-456.232) (-458.273) (-460.591) [-456.651] * [-456.566] (-454.855) (-458.381) (-455.071) -- 0:00:06
904000 -- [-455.054] (-455.536) (-454.734) (-456.661) * (-454.295) (-455.705) (-455.517) [-456.411] -- 0:00:06
904500 -- (-454.897) (-457.820) (-454.565) [-455.085] * (-456.021) (-457.322) [-456.167] (-455.262) -- 0:00:06
905000 -- (-457.258) (-455.878) (-456.233) [-456.447] * (-459.033) (-455.156) (-457.232) [-454.581] -- 0:00:06
Average standard deviation of split frequencies: 0.006209
905500 -- (-456.497) (-455.440) [-455.517] (-458.362) * (-455.044) [-455.012] (-457.988) (-454.460) -- 0:00:06
906000 -- [-458.260] (-456.236) (-459.016) (-455.176) * (-457.754) (-462.406) (-464.949) [-460.068] -- 0:00:06
906500 -- [-455.510] (-455.353) (-456.695) (-458.213) * (-455.676) (-454.584) (-456.092) [-454.630] -- 0:00:06
907000 -- (-453.936) (-454.399) (-457.029) [-456.852] * (-456.303) (-460.092) (-463.545) [-454.269] -- 0:00:06
907500 -- (-457.435) [-457.247] (-454.548) (-458.676) * (-454.951) (-455.482) (-454.862) [-457.924] -- 0:00:06
908000 -- (-455.232) (-456.083) (-458.444) [-454.647] * [-454.952] (-453.840) (-454.621) (-458.593) -- 0:00:05
908500 -- [-454.428] (-457.797) (-455.493) (-455.303) * [-455.394] (-454.967) (-457.380) (-454.247) -- 0:00:05
909000 -- [-454.503] (-458.981) (-455.493) (-454.631) * [-455.552] (-456.438) (-458.258) (-458.115) -- 0:00:05
909500 -- (-455.207) [-455.392] (-456.550) (-455.100) * (-455.171) (-455.913) (-456.138) [-456.600] -- 0:00:05
910000 -- (-454.404) (-455.557) (-457.575) [-453.694] * [-454.998] (-456.897) (-455.791) (-454.160) -- 0:00:05
Average standard deviation of split frequencies: 0.006143
910500 -- (-455.976) (-455.235) (-454.794) [-453.529] * (-456.299) (-457.123) [-455.671] (-455.529) -- 0:00:05
911000 -- (-457.097) (-456.246) (-454.602) [-455.172] * (-459.740) [-455.596] (-455.077) (-454.865) -- 0:00:05
911500 -- (-458.575) [-455.854] (-455.434) (-455.897) * [-455.400] (-454.447) (-455.539) (-457.614) -- 0:00:05
912000 -- (-454.315) [-457.531] (-454.655) (-455.618) * [-456.840] (-457.810) (-455.429) (-455.644) -- 0:00:05
912500 -- (-455.722) (-456.457) [-454.914] (-454.429) * (-457.069) (-457.573) (-455.030) [-457.935] -- 0:00:05
913000 -- (-454.033) (-456.430) (-454.838) [-457.165] * (-460.510) (-457.743) [-455.930] (-455.240) -- 0:00:05
913500 -- (-454.292) [-455.144] (-458.757) (-455.243) * [-454.385] (-454.279) (-454.583) (-455.228) -- 0:00:05
914000 -- (-457.044) (-456.756) [-455.540] (-462.041) * (-455.425) [-456.113] (-454.162) (-459.185) -- 0:00:05
914500 -- (-459.373) (-456.375) [-456.350] (-455.273) * (-455.702) [-457.713] (-454.870) (-457.377) -- 0:00:05
915000 -- (-458.702) [-455.318] (-457.053) (-464.441) * (-456.332) (-455.427) (-454.278) [-456.424] -- 0:00:05
Average standard deviation of split frequencies: 0.006073
915500 -- (-454.147) (-456.745) [-457.201] (-460.115) * [-455.268] (-454.460) (-455.356) (-457.564) -- 0:00:05
916000 -- (-456.865) (-455.847) (-458.867) [-460.220] * (-456.609) (-453.941) (-454.590) [-458.361] -- 0:00:05
916500 -- (-453.963) [-456.108] (-456.113) (-457.399) * (-455.991) (-456.752) [-455.985] (-457.290) -- 0:00:05
917000 -- (-456.874) (-454.653) (-458.077) [-456.022] * (-456.604) [-453.910] (-456.277) (-455.509) -- 0:00:05
917500 -- (-457.526) [-456.696] (-456.508) (-456.002) * (-456.132) (-454.659) (-455.135) [-455.355] -- 0:00:05
918000 -- [-455.122] (-454.547) (-456.080) (-454.328) * [-456.804] (-455.739) (-453.867) (-456.578) -- 0:00:05
918500 -- (-454.005) (-454.547) [-458.477] (-455.742) * (-462.765) (-455.608) [-454.152] (-454.765) -- 0:00:05
919000 -- [-456.479] (-457.502) (-459.563) (-453.701) * (-459.796) (-457.363) [-453.727] (-456.082) -- 0:00:05
919500 -- (-459.458) (-456.379) (-455.503) [-453.612] * (-456.668) (-456.336) (-455.596) [-454.698] -- 0:00:05
920000 -- [-456.669] (-453.663) (-456.138) (-454.793) * [-455.144] (-455.154) (-456.089) (-459.736) -- 0:00:05
Average standard deviation of split frequencies: 0.006144
920500 -- (-453.948) (-457.448) (-455.472) [-457.967] * (-458.533) (-459.201) [-455.897] (-458.160) -- 0:00:05
921000 -- (-455.621) [-455.148] (-459.598) (-455.618) * (-454.382) [-460.289] (-455.303) (-455.130) -- 0:00:05
921500 -- (-455.788) (-455.172) (-454.662) [-454.338] * (-458.245) (-456.794) [-454.070] (-456.327) -- 0:00:05
922000 -- (-455.943) (-454.541) (-454.935) [-454.494] * (-454.556) (-454.092) [-454.475] (-458.776) -- 0:00:05
922500 -- (-456.082) (-455.934) [-454.986] (-455.269) * (-456.974) [-454.627] (-455.664) (-455.182) -- 0:00:05
923000 -- (-455.954) [-458.824] (-455.458) (-460.240) * (-459.342) [-454.633] (-455.752) (-455.155) -- 0:00:05
923500 -- (-458.178) [-461.328] (-456.157) (-457.654) * (-456.658) (-453.986) [-453.954] (-455.865) -- 0:00:04
924000 -- [-456.510] (-455.586) (-454.553) (-456.076) * (-456.200) [-454.273] (-458.864) (-455.246) -- 0:00:04
924500 -- (-455.983) (-456.488) (-455.014) [-455.398] * (-455.465) [-456.484] (-454.890) (-455.111) -- 0:00:04
925000 -- (-455.782) (-457.422) (-456.809) [-457.811] * (-455.763) (-457.499) (-454.323) [-456.329] -- 0:00:04
Average standard deviation of split frequencies: 0.005973
925500 -- (-454.346) [-455.815] (-456.143) (-455.065) * (-457.204) [-454.970] (-456.461) (-456.263) -- 0:00:04
926000 -- (-455.068) (-456.830) (-456.203) [-458.432] * (-455.241) (-456.053) (-459.281) [-455.492] -- 0:00:04
926500 -- [-454.857] (-455.616) (-459.253) (-457.435) * (-455.969) (-459.324) (-459.014) [-456.057] -- 0:00:04
927000 -- [-455.528] (-456.818) (-456.727) (-454.453) * (-458.264) [-458.423] (-457.642) (-455.124) -- 0:00:04
927500 -- (-459.864) [-455.935] (-454.668) (-454.178) * (-454.106) (-455.152) (-453.910) [-456.602] -- 0:00:04
928000 -- (-459.584) (-454.286) (-458.000) [-454.513] * (-454.806) (-458.349) [-455.489] (-458.916) -- 0:00:04
928500 -- [-455.629] (-454.743) (-455.020) (-454.500) * (-459.250) (-455.921) (-455.967) [-456.693] -- 0:00:04
929000 -- (-456.902) [-456.458] (-454.001) (-454.573) * [-457.928] (-455.513) (-455.854) (-454.627) -- 0:00:04
929500 -- [-456.138] (-457.186) (-454.617) (-453.963) * [-458.577] (-454.547) (-456.648) (-457.482) -- 0:00:04
930000 -- (-459.915) (-456.035) [-456.672] (-458.399) * (-459.792) (-456.528) [-459.541] (-454.608) -- 0:00:04
Average standard deviation of split frequencies: 0.006078
930500 -- (-453.695) (-459.036) (-455.842) [-454.866] * (-455.023) (-455.276) (-454.491) [-455.083] -- 0:00:04
931000 -- (-454.995) [-454.672] (-458.911) (-454.253) * (-457.407) (-457.638) [-455.769] (-457.638) -- 0:00:04
931500 -- (-459.637) [-454.144] (-458.423) (-458.956) * (-454.636) (-456.024) (-455.644) [-454.784] -- 0:00:04
932000 -- [-460.270] (-457.850) (-457.769) (-454.764) * (-454.359) [-454.025] (-454.932) (-456.910) -- 0:00:04
932500 -- [-455.872] (-457.947) (-459.459) (-455.105) * (-454.663) [-458.330] (-459.892) (-457.365) -- 0:00:04
933000 -- [-455.128] (-455.725) (-455.655) (-454.139) * (-454.431) [-458.201] (-456.442) (-460.029) -- 0:00:04
933500 -- (-455.678) (-455.361) (-455.961) [-456.679] * [-454.491] (-455.868) (-460.713) (-456.374) -- 0:00:04
934000 -- (-456.509) [-458.193] (-454.899) (-463.548) * (-454.248) (-457.066) [-456.148] (-456.099) -- 0:00:04
934500 -- (-454.011) (-453.790) (-454.746) [-457.782] * (-455.335) [-455.356] (-455.570) (-457.378) -- 0:00:04
935000 -- (-454.838) (-453.790) (-458.900) [-459.529] * (-455.553) (-453.993) (-457.536) [-454.751] -- 0:00:04
Average standard deviation of split frequencies: 0.006010
935500 -- (-457.666) [-457.185] (-457.971) (-455.127) * [-456.411] (-454.415) (-457.988) (-456.820) -- 0:00:04
936000 -- (-459.116) [-454.700] (-456.419) (-455.083) * (-456.485) (-457.465) (-454.240) [-454.470] -- 0:00:04
936500 -- (-455.818) [-457.627] (-457.880) (-458.181) * (-455.446) (-456.087) [-457.510] (-454.915) -- 0:00:04
937000 -- (-456.212) (-457.654) (-454.854) [-455.377] * (-460.764) (-456.488) (-457.172) [-455.124] -- 0:00:04
937500 -- (-455.980) (-456.910) [-456.840] (-455.689) * (-456.091) [-454.952] (-454.851) (-454.489) -- 0:00:04
938000 -- (-454.256) [-456.017] (-458.715) (-454.811) * [-456.616] (-455.449) (-460.635) (-454.752) -- 0:00:04
938500 -- (-454.606) (-454.991) [-453.685] (-455.255) * [-456.037] (-454.530) (-456.182) (-455.902) -- 0:00:03
939000 -- (-457.857) [-454.038] (-453.914) (-456.429) * (-454.172) (-455.512) (-454.465) [-456.488] -- 0:00:03
939500 -- (-458.058) (-458.059) (-453.999) [-456.783] * (-454.697) (-459.760) (-459.564) [-454.539] -- 0:00:03
940000 -- [-454.775] (-454.486) (-455.699) (-455.880) * (-455.597) [-456.406] (-454.736) (-457.456) -- 0:00:03
Average standard deviation of split frequencies: 0.005913
940500 -- (-457.262) [-455.518] (-455.408) (-455.592) * (-454.839) (-457.696) [-455.447] (-457.220) -- 0:00:03
941000 -- (-457.691) (-455.070) [-457.157] (-455.953) * [-455.885] (-458.947) (-456.066) (-462.043) -- 0:00:03
941500 -- (-455.202) [-455.634] (-455.599) (-455.914) * (-455.740) (-457.957) (-457.577) [-454.514] -- 0:00:03
942000 -- (-455.530) (-455.041) [-455.413] (-457.017) * (-455.831) (-456.725) [-455.645] (-455.839) -- 0:00:03
942500 -- (-454.802) (-455.030) (-455.523) [-455.260] * [-455.827] (-454.290) (-454.810) (-456.902) -- 0:00:03
943000 -- (-454.717) [-457.969] (-461.692) (-454.007) * (-453.795) (-455.342) (-454.788) [-455.921] -- 0:00:03
943500 -- [-454.379] (-456.595) (-464.521) (-456.323) * (-454.031) [-457.424] (-455.010) (-460.050) -- 0:00:03
944000 -- (-454.200) (-460.044) (-458.227) [-458.543] * (-454.191) [-454.852] (-455.092) (-457.869) -- 0:00:03
944500 -- (-460.809) (-455.755) [-456.198] (-456.950) * (-454.679) (-455.925) [-456.465] (-455.663) -- 0:00:03
945000 -- (-455.481) (-460.288) [-456.477] (-454.431) * (-454.132) (-456.142) (-454.497) [-453.968] -- 0:00:03
Average standard deviation of split frequencies: 0.006179
945500 -- (-457.342) (-455.269) (-456.939) [-455.852] * (-454.669) (-453.651) [-456.681] (-454.431) -- 0:00:03
946000 -- (-455.364) (-455.942) [-456.847] (-457.240) * [-455.543] (-453.635) (-454.507) (-454.301) -- 0:00:03
946500 -- (-454.397) (-459.493) [-460.703] (-458.563) * (-455.416) (-463.337) (-454.638) [-453.523] -- 0:00:03
947000 -- (-454.250) (-455.669) (-456.745) [-456.010] * (-458.111) [-456.640] (-457.503) (-454.460) -- 0:00:03
947500 -- (-454.378) [-455.292] (-457.692) (-455.061) * (-456.892) (-458.039) [-455.770] (-455.574) -- 0:00:03
948000 -- (-455.026) [-454.951] (-454.009) (-455.148) * [-457.519] (-454.077) (-456.231) (-455.262) -- 0:00:03
948500 -- [-455.846] (-454.996) (-457.393) (-455.142) * (-455.861) [-458.387] (-454.879) (-455.812) -- 0:00:03
949000 -- [-454.033] (-455.482) (-454.317) (-459.961) * (-453.926) [-461.451] (-454.109) (-455.215) -- 0:00:03
949500 -- [-455.408] (-458.048) (-455.467) (-455.754) * (-454.995) [-456.403] (-454.183) (-456.405) -- 0:00:03
950000 -- (-459.273) (-455.300) (-458.198) [-453.869] * [-455.774] (-455.275) (-456.319) (-459.589) -- 0:00:03
Average standard deviation of split frequencies: 0.006281
950500 -- (-455.474) [-454.118] (-455.250) (-456.756) * (-457.075) (-454.983) (-458.162) [-456.607] -- 0:00:03
951000 -- (-456.002) (-457.408) [-454.164] (-455.271) * (-457.751) [-455.487] (-457.979) (-454.030) -- 0:00:03
951500 -- (-460.651) (-454.037) [-454.536] (-456.758) * [-457.748] (-454.435) (-459.482) (-459.682) -- 0:00:03
952000 -- (-456.703) [-455.857] (-457.874) (-459.708) * [-455.518] (-457.783) (-457.348) (-457.063) -- 0:00:03
952500 -- (-456.062) [-455.670] (-456.782) (-453.787) * (-458.158) [-456.661] (-455.989) (-457.768) -- 0:00:03
953000 -- (-458.626) [-455.018] (-455.542) (-453.674) * (-453.806) (-454.926) (-455.508) [-458.363] -- 0:00:03
953500 -- [-455.075] (-457.367) (-456.350) (-455.321) * (-455.853) [-454.893] (-460.017) (-458.246) -- 0:00:03
954000 -- (-456.522) (-457.575) [-454.216] (-455.632) * (-453.796) (-455.229) [-457.013] (-462.137) -- 0:00:02
954500 -- (-455.709) (-458.987) [-455.681] (-455.625) * (-454.919) [-453.927] (-458.547) (-459.441) -- 0:00:02
955000 -- (-457.288) (-458.440) (-459.908) [-454.692] * [-454.825] (-455.251) (-457.137) (-460.435) -- 0:00:02
Average standard deviation of split frequencies: 0.006180
955500 -- (-460.019) (-456.829) (-456.470) [-455.192] * [-455.876] (-458.074) (-457.196) (-455.720) -- 0:00:02
956000 -- (-459.704) (-460.348) (-457.378) [-455.532] * [-456.381] (-455.507) (-454.108) (-457.485) -- 0:00:02
956500 -- (-455.222) (-459.202) [-454.503] (-456.453) * (-455.241) (-454.429) (-455.621) [-454.970] -- 0:00:02
957000 -- (-455.355) (-460.012) [-454.441] (-455.562) * (-455.334) (-454.859) [-454.000] (-456.124) -- 0:00:02
957500 -- (-459.245) (-459.983) (-459.092) [-457.827] * [-454.727] (-460.632) (-458.630) (-457.918) -- 0:00:02
958000 -- [-454.233] (-459.875) (-456.464) (-456.382) * (-454.148) [-456.467] (-457.243) (-464.093) -- 0:00:02
958500 -- (-458.755) (-455.940) [-454.031] (-455.422) * (-455.888) (-455.001) [-456.548] (-458.382) -- 0:00:02
959000 -- (-457.579) (-454.206) (-456.445) [-455.426] * [-456.347] (-454.801) (-456.197) (-457.024) -- 0:00:02
959500 -- (-455.054) [-454.198] (-457.217) (-454.541) * (-458.160) (-455.655) [-457.600] (-457.243) -- 0:00:02
960000 -- [-456.261] (-454.107) (-457.106) (-457.457) * [-454.989] (-457.755) (-461.172) (-457.578) -- 0:00:02
Average standard deviation of split frequencies: 0.005987
960500 -- (-454.250) (-455.530) [-455.645] (-455.295) * (-457.877) (-456.237) [-454.791] (-465.792) -- 0:00:02
961000 -- [-453.942] (-454.798) (-461.611) (-454.619) * [-454.214] (-460.774) (-458.549) (-457.696) -- 0:00:02
961500 -- [-455.840] (-455.365) (-457.257) (-454.772) * (-454.856) [-454.870] (-460.348) (-456.700) -- 0:00:02
962000 -- [-454.264] (-455.142) (-454.914) (-454.136) * (-455.885) [-455.359] (-454.425) (-458.059) -- 0:00:02
962500 -- (-455.614) [-455.350] (-462.693) (-455.411) * (-457.013) (-455.328) [-454.987] (-460.221) -- 0:00:02
963000 -- (-456.938) (-457.673) [-455.142] (-455.651) * (-458.260) [-455.690] (-460.272) (-462.883) -- 0:00:02
963500 -- (-456.136) (-456.032) [-458.073] (-455.096) * [-456.555] (-455.187) (-455.693) (-460.842) -- 0:00:02
964000 -- (-456.057) [-454.110] (-454.268) (-456.630) * (-455.257) (-455.463) (-458.577) [-454.857] -- 0:00:02
964500 -- [-455.169] (-455.310) (-454.504) (-456.374) * (-456.817) (-454.055) [-456.630] (-460.018) -- 0:00:02
965000 -- (-458.437) (-455.258) (-459.444) [-455.590] * (-455.767) [-454.469] (-453.923) (-460.731) -- 0:00:02
Average standard deviation of split frequencies: 0.006019
965500 -- [-455.405] (-454.424) (-455.481) (-455.088) * (-458.009) (-456.167) [-456.118] (-453.909) -- 0:00:02
966000 -- (-457.139) (-456.173) (-454.591) [-455.325] * (-454.523) (-457.962) [-454.660] (-454.749) -- 0:00:02
966500 -- [-456.550] (-460.407) (-454.481) (-455.827) * (-458.876) [-456.549] (-455.570) (-455.423) -- 0:00:02
967000 -- (-455.883) (-458.774) (-456.021) [-455.839] * (-456.576) (-455.430) [-457.320] (-455.637) -- 0:00:02
967500 -- [-456.329] (-454.734) (-455.193) (-455.862) * (-454.350) (-455.356) (-457.289) [-454.630] -- 0:00:02
968000 -- [-454.786] (-454.091) (-454.352) (-460.199) * (-456.000) (-454.400) (-454.790) [-456.351] -- 0:00:02
968500 -- [-454.849] (-455.043) (-454.791) (-459.281) * (-456.213) (-454.950) [-455.480] (-453.923) -- 0:00:02
969000 -- (-457.015) [-456.683] (-455.142) (-454.962) * (-455.448) [-455.767] (-454.125) (-456.678) -- 0:00:02
969500 -- (-456.356) (-457.770) [-454.429] (-457.622) * (-457.280) (-458.026) (-459.501) [-457.241] -- 0:00:01
970000 -- (-457.654) [-454.271] (-455.110) (-458.250) * [-455.251] (-456.328) (-454.410) (-459.598) -- 0:00:01
Average standard deviation of split frequencies: 0.005925
970500 -- [-456.120] (-455.945) (-455.866) (-455.612) * [-454.241] (-457.657) (-454.205) (-457.935) -- 0:00:01
971000 -- (-455.773) (-454.174) [-457.049] (-454.899) * (-456.313) [-455.043] (-459.305) (-456.144) -- 0:00:01
971500 -- (-454.917) (-453.814) (-456.196) [-455.240] * (-454.634) (-454.446) (-454.079) [-459.833] -- 0:00:01
972000 -- (-456.945) (-455.031) (-454.265) [-455.092] * (-455.036) [-455.235] (-456.667) (-454.786) -- 0:00:01
972500 -- (-461.774) (-458.559) [-457.110] (-454.531) * (-457.109) (-456.416) (-458.648) [-455.942] -- 0:00:01
973000 -- [-455.962] (-455.667) (-454.267) (-454.106) * (-461.308) (-457.566) [-453.961] (-454.984) -- 0:00:01
973500 -- (-456.819) (-455.006) (-456.020) [-458.008] * (-457.716) (-458.764) (-453.961) [-455.149] -- 0:00:01
974000 -- [-456.790] (-458.431) (-455.306) (-454.486) * (-456.189) [-454.509] (-455.352) (-455.292) -- 0:00:01
974500 -- (-454.043) (-459.097) (-455.928) [-453.707] * (-454.726) (-456.366) [-454.478] (-455.845) -- 0:00:01
975000 -- (-455.621) [-459.952] (-456.009) (-459.179) * [-454.271] (-453.984) (-455.073) (-455.767) -- 0:00:01
Average standard deviation of split frequencies: 0.006247
975500 -- (-455.079) [-456.881] (-458.129) (-453.540) * [-455.945] (-456.804) (-455.417) (-454.558) -- 0:00:01
976000 -- [-454.819] (-457.638) (-457.521) (-453.914) * (-456.396) [-456.234] (-459.542) (-454.064) -- 0:00:01
976500 -- (-455.354) (-460.233) (-459.083) [-455.659] * (-456.823) (-455.105) (-455.798) [-454.028] -- 0:00:01
977000 -- [-453.884] (-456.168) (-457.297) (-456.192) * (-462.292) (-454.587) [-455.780] (-458.415) -- 0:00:01
977500 -- (-457.723) [-455.829] (-456.518) (-455.435) * (-457.758) [-455.137] (-455.407) (-456.663) -- 0:00:01
978000 -- (-458.026) (-455.430) (-456.112) [-454.393] * (-455.052) [-455.727] (-454.528) (-456.509) -- 0:00:01
978500 -- (-454.158) [-455.317] (-458.243) (-453.995) * (-455.414) [-454.841] (-455.442) (-457.548) -- 0:00:01
979000 -- [-454.472] (-456.553) (-454.954) (-453.885) * (-457.209) (-455.152) (-457.475) [-459.739] -- 0:00:01
979500 -- (-455.434) (-455.814) [-455.407] (-455.997) * (-456.824) [-459.246] (-456.048) (-455.584) -- 0:00:01
980000 -- [-456.184] (-458.342) (-455.291) (-457.000) * (-455.863) (-454.534) [-455.754] (-457.250) -- 0:00:01
Average standard deviation of split frequencies: 0.006409
980500 -- (-456.882) [-458.845] (-454.663) (-457.718) * [-455.100] (-457.353) (-455.693) (-455.778) -- 0:00:01
981000 -- (-459.449) (-456.120) [-454.264] (-457.989) * (-454.328) [-455.312] (-455.694) (-454.930) -- 0:00:01
981500 -- (-457.756) (-459.068) (-455.986) [-456.757] * (-455.910) [-454.394] (-457.943) (-459.302) -- 0:00:01
982000 -- (-455.652) (-455.241) (-461.388) [-456.680] * (-453.784) [-458.805] (-455.579) (-454.427) -- 0:00:01
982500 -- (-456.659) [-456.754] (-461.509) (-454.797) * (-459.108) (-457.590) [-456.137] (-454.608) -- 0:00:01
983000 -- (-454.498) (-457.239) [-455.497] (-458.348) * [-457.496] (-459.374) (-458.055) (-456.648) -- 0:00:01
983500 -- [-454.558] (-456.348) (-456.833) (-456.600) * (-455.818) (-455.597) [-454.497] (-455.297) -- 0:00:01
984000 -- (-454.499) (-453.861) [-458.179] (-455.859) * (-459.099) (-455.687) [-455.043] (-455.894) -- 0:00:01
984500 -- (-455.306) [-454.526] (-455.364) (-456.561) * (-455.439) (-456.405) [-457.400] (-455.279) -- 0:00:01
985000 -- [-455.083] (-456.811) (-457.081) (-459.839) * (-459.386) (-458.557) (-457.990) [-455.070] -- 0:00:00
Average standard deviation of split frequencies: 0.006407
985500 -- (-454.821) (-455.750) (-456.403) [-454.091] * [-457.608] (-454.955) (-454.842) (-459.292) -- 0:00:00
986000 -- (-455.811) [-455.741] (-458.154) (-456.827) * (-456.092) (-456.976) [-456.461] (-456.536) -- 0:00:00
986500 -- [-454.526] (-457.167) (-457.624) (-458.801) * (-455.412) (-456.055) (-455.186) [-456.715] -- 0:00:00
987000 -- (-454.693) (-455.542) [-456.538] (-460.280) * [-456.311] (-456.493) (-460.185) (-456.883) -- 0:00:00
987500 -- (-454.707) (-458.254) [-459.428] (-460.836) * [-456.629] (-454.432) (-455.363) (-455.208) -- 0:00:00
988000 -- (-454.123) (-457.538) [-454.988] (-458.132) * [-455.895] (-454.314) (-454.211) (-457.948) -- 0:00:00
988500 -- (-455.703) (-455.792) [-455.378] (-459.555) * (-455.851) [-453.641] (-456.652) (-460.391) -- 0:00:00
989000 -- (-454.557) (-456.901) (-453.753) [-456.604] * (-455.679) [-455.853] (-456.784) (-460.957) -- 0:00:00
989500 -- (-454.047) (-454.977) (-454.783) [-455.560] * (-457.322) (-456.210) [-453.953] (-457.501) -- 0:00:00
990000 -- (-453.631) (-455.347) (-454.860) [-457.976] * (-454.995) (-455.112) [-455.281] (-455.307) -- 0:00:00
Average standard deviation of split frequencies: 0.006567
990500 -- (-457.532) (-454.887) [-456.740] (-454.487) * (-456.244) (-455.534) (-457.043) [-457.053] -- 0:00:00
991000 -- (-456.949) (-454.105) [-455.542] (-454.167) * (-454.273) (-454.093) (-455.159) [-454.692] -- 0:00:00
991500 -- (-454.808) [-454.004] (-455.195) (-456.116) * [-454.340] (-455.620) (-454.808) (-455.384) -- 0:00:00
992000 -- (-457.665) [-454.439] (-454.755) (-456.880) * (-459.514) (-454.217) (-455.285) [-456.410] -- 0:00:00
992500 -- (-458.056) (-455.454) [-456.250] (-458.143) * (-455.865) [-458.649] (-454.593) (-455.989) -- 0:00:00
993000 -- [-455.682] (-456.272) (-458.258) (-456.021) * (-455.731) [-457.814] (-457.954) (-454.990) -- 0:00:00
993500 -- [-454.868] (-457.210) (-457.362) (-459.322) * (-455.224) [-455.367] (-456.655) (-456.765) -- 0:00:00
994000 -- [-458.742] (-457.696) (-459.966) (-455.213) * (-459.103) (-460.360) (-456.729) [-460.272] -- 0:00:00
994500 -- (-456.815) (-456.354) [-458.183] (-458.858) * [-455.398] (-457.687) (-455.016) (-456.145) -- 0:00:00
995000 -- (-456.488) (-455.747) (-453.931) [-459.546] * [-455.929] (-456.723) (-455.490) (-454.067) -- 0:00:00
Average standard deviation of split frequencies: 0.006374
995500 -- (-456.836) (-459.833) (-456.374) [-456.931] * (-455.134) (-455.895) [-454.010] (-454.997) -- 0:00:00
996000 -- (-456.124) (-461.149) [-454.928] (-460.282) * (-455.042) (-456.218) [-454.437] (-455.412) -- 0:00:00
996500 -- [-457.224] (-457.532) (-455.752) (-455.742) * (-456.765) (-455.034) (-456.815) [-455.192] -- 0:00:00
997000 -- (-458.855) (-455.179) [-455.256] (-456.612) * (-455.150) (-455.333) (-456.673) [-455.104] -- 0:00:00
997500 -- (-454.492) (-457.404) (-456.237) [-454.676] * [-457.106] (-459.977) (-458.007) (-457.173) -- 0:00:00
998000 -- (-454.047) (-457.065) (-455.869) [-455.250] * [-456.430] (-454.882) (-454.555) (-462.177) -- 0:00:00
998500 -- (-455.028) (-456.185) (-457.555) [-454.414] * (-454.948) [-453.793] (-457.463) (-460.692) -- 0:00:00
999000 -- (-457.615) (-454.814) (-454.921) [-454.667] * (-457.811) [-454.681] (-457.827) (-457.439) -- 0:00:00
999500 -- [-457.681] (-456.550) (-456.371) (-458.152) * [-454.729] (-455.332) (-456.471) (-454.662) -- 0:00:00
1000000 -- (-455.133) (-456.088) [-460.158] (-460.519) * (-459.661) (-455.604) [-456.353] (-458.578) -- 0:00:00
Average standard deviation of split frequencies: 0.006438
Analysis completed in 1 mins 5 seconds
Analysis used 63.46 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -453.44
Likelihood of best state for "cold" chain of run 2 was -453.44
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.5 % ( 37 %) Dirichlet(Pi{all})
37.2 % ( 32 %) Slider(Pi{all})
78.5 % ( 59 %) Multiplier(Alpha{1,2})
77.6 % ( 45 %) Multiplier(Alpha{3})
25.1 % ( 37 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 33 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.4 % ( 26 %) Dirichlet(Pi{all})
36.6 % ( 33 %) Slider(Pi{all})
78.9 % ( 50 %) Multiplier(Alpha{1,2})
78.4 % ( 51 %) Multiplier(Alpha{3})
25.7 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 96 %) ExtSPR(Tau{all},V{all})
70.0 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166123 0.82 0.67
3 | 166771 166863 0.84
4 | 166670 167182 166391
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166735 0.82 0.67
3 | 166473 167134 0.84
4 | 166530 166675 166453
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -454.97
| 1 |
| |
| 2 2 |
| 2 1 2 |
|2 1 2 2 1 12 1 |
|11 2* 1 1 1 21 1 1 1 2 2 |
| 1 1 1 11 1 2 2 2 2 1 1 2112|
| 2 21 12 1 2 21 11 2 2 1 |
| 21 * * 1 121 2 1 2 2 1 |
| * 2 2 2 121 1 2 1 2 2 2 2 |
| 2 2 2 1 2 * 2 2 2 |
| 1 22 1 * 1 * 11 1|
| 2 2 2 |
| 2 1 1 * |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -456.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -455.18 -458.20
2 -455.21 -458.01
--------------------------------------
TOTAL -455.19 -458.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891295 0.086746 0.360395 1.489011 0.858673 1298.80 1399.90 1.000
r(A<->C){all} 0.146994 0.015633 0.000007 0.397125 0.114391 303.39 368.09 1.003
r(A<->G){all} 0.180975 0.022181 0.000004 0.481592 0.140219 315.20 328.89 1.002
r(A<->T){all} 0.166927 0.019510 0.000023 0.447712 0.129732 242.34 341.75 1.000
r(C<->G){all} 0.173894 0.020874 0.000011 0.456480 0.133775 222.58 315.78 1.001
r(C<->T){all} 0.167110 0.020083 0.000003 0.456569 0.130174 236.90 240.09 1.005
r(G<->T){all} 0.164100 0.019498 0.000032 0.449187 0.130180 148.74 217.23 1.001
pi(A){all} 0.157147 0.000373 0.122006 0.197343 0.156750 1148.46 1321.79 1.000
pi(C){all} 0.320911 0.000646 0.268352 0.366097 0.321096 1386.95 1423.87 1.000
pi(G){all} 0.329247 0.000640 0.277605 0.375904 0.328808 1101.07 1111.23 1.000
pi(T){all} 0.192694 0.000471 0.147862 0.232807 0.192147 1183.79 1310.52 1.000
alpha{1,2} 0.409715 0.231721 0.000134 1.375773 0.237075 1218.75 1267.06 1.000
alpha{3} 0.442637 0.217859 0.000188 1.373491 0.293996 1180.59 1214.51 1.000
pinvar{all} 0.995086 0.000038 0.984359 0.999999 0.997053 1222.10 1305.14 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .***.*
9 -- ..****
10 -- ..*..*
11 -- .*.*..
12 -- ...*.*
13 -- ....**
14 -- ...**.
15 -- ..*.*.
16 -- ..**..
17 -- .*...*
18 -- .****.
19 -- .*..*.
20 -- .**.**
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 449 0.149567 0.000471 0.149234 0.149900 2
8 442 0.147235 0.011306 0.139241 0.155230 2
9 441 0.146902 0.008009 0.141239 0.152565 2
10 438 0.145903 0.001884 0.144570 0.147235 2
11 434 0.144570 0.001884 0.143238 0.145903 2
12 434 0.144570 0.005653 0.140573 0.148568 2
13 433 0.144237 0.002355 0.142572 0.145903 2
14 433 0.144237 0.000471 0.143904 0.144570 2
15 431 0.143571 0.008009 0.137908 0.149234 2
16 423 0.140906 0.004240 0.137908 0.143904 2
17 423 0.140906 0.007066 0.135909 0.145903 2
18 419 0.139574 0.002355 0.137908 0.141239 2
19 419 0.139574 0.019315 0.125916 0.153231 2
20 417 0.138907 0.013662 0.129247 0.148568 2
21 397 0.132245 0.009893 0.125250 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097265 0.010017 0.000007 0.305033 0.065006 1.000 2
length{all}[2] 0.100149 0.010092 0.000004 0.306492 0.069392 1.000 2
length{all}[3] 0.098748 0.009638 0.000002 0.292488 0.068828 1.000 2
length{all}[4] 0.100435 0.010837 0.000051 0.312270 0.067855 1.000 2
length{all}[5] 0.100899 0.010386 0.000055 0.304524 0.068320 1.000 2
length{all}[6] 0.098955 0.009339 0.000048 0.292253 0.069730 1.000 2
length{all}[7] 0.089742 0.007025 0.000288 0.250264 0.069261 1.000 2
length{all}[8] 0.100115 0.009950 0.000505 0.275743 0.069615 0.998 2
length{all}[9] 0.100711 0.011666 0.000134 0.343764 0.064469 1.001 2
length{all}[10] 0.092250 0.007693 0.000195 0.285740 0.067602 0.998 2
length{all}[11] 0.093665 0.007555 0.000008 0.270586 0.071437 0.998 2
length{all}[12] 0.105660 0.011289 0.000010 0.322327 0.070005 0.998 2
length{all}[13] 0.089545 0.008211 0.000105 0.247652 0.061895 0.998 2
length{all}[14] 0.093035 0.007181 0.000042 0.262128 0.067873 1.000 2
length{all}[15] 0.101200 0.010450 0.000515 0.297742 0.069270 0.998 2
length{all}[16] 0.095174 0.010296 0.000130 0.299760 0.064679 0.998 2
length{all}[17] 0.100536 0.010318 0.000029 0.290158 0.067602 0.998 2
length{all}[18] 0.103669 0.012387 0.000026 0.309757 0.067469 1.031 2
length{all}[19] 0.103875 0.011241 0.000658 0.296328 0.069809 1.009 2
length{all}[20] 0.096133 0.008802 0.000122 0.282379 0.070396 0.998 2
length{all}[21] 0.112966 0.012311 0.000292 0.319316 0.082559 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006438
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.031
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 339
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 43 patterns at 113 / 113 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 43 patterns at 113 / 113 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
41968 bytes for conP
3784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079396 0.048728 0.045183 0.078203 0.043736 0.026893 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -471.405069
Iterating by ming2
Initial: fx= 471.405069
x= 0.07940 0.04873 0.04518 0.07820 0.04374 0.02689 0.30000 1.30000
1 h-m-p 0.0000 0.0002 269.4218 +++ 453.710875 m 0.0002 14 | 1/8
2 h-m-p 0.0010 0.0053 61.7338 ++ 447.265903 m 0.0053 25 | 2/8
3 h-m-p 0.0000 0.0001 161.6695 ++ 446.783481 m 0.0001 36 | 3/8
4 h-m-p 0.0000 0.0001 59.9409 ++ 445.877623 m 0.0001 47 | 4/8
5 h-m-p 0.0001 0.0007 33.7746 ----------.. | 4/8
6 h-m-p 0.0000 0.0000 190.0045 ++ 444.369621 m 0.0000 77 | 5/8
7 h-m-p 0.0160 8.0000 11.6282 -------------.. | 5/8
8 h-m-p 0.0000 0.0003 154.7808 +++ 435.967865 m 0.0003 111 | 6/8
9 h-m-p 0.0160 8.0000 7.8396 -------------.. | 6/8
10 h-m-p 0.0000 0.0000 110.5644 ++ 435.795946 m 0.0000 144 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 Y 435.795946 0 0.4000 155 | 7/8
12 h-m-p 0.0160 8.0000 0.0000 -----------C 435.795946 0 0.0000 178
Out..
lnL = -435.795946
179 lfun, 179 eigenQcodon, 1074 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098753 0.101368 0.087969 0.061669 0.054534 0.108304 0.000100 0.815413 0.135005
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.709771
np = 9
lnL0 = -489.892192
Iterating by ming2
Initial: fx= 489.892192
x= 0.09875 0.10137 0.08797 0.06167 0.05453 0.10830 0.00011 0.81541 0.13501
1 h-m-p 0.0000 0.0000 242.9576 ++ 489.499008 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0005 365.1764 +++ 456.247880 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0000 1940.6089 ++ 452.606210 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 79.7299 ++ 452.402467 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0063 23.0320 ---------.. | 4/9
6 h-m-p 0.0000 0.0003 208.8628 +++ 440.993116 m 0.0003 83 | 5/9
7 h-m-p 0.0076 0.1219 6.0339 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 191.1813 ++ 437.238773 m 0.0001 118 | 6/9
9 h-m-p 0.0019 0.0864 8.4716 ------------.. | 6/9
10 h-m-p 0.0000 0.0000 159.1212 ++ 436.621162 m 0.0000 152 | 7/9
11 h-m-p 0.0003 0.0874 8.3654 ----------.. | 7/9
12 h-m-p 0.0000 0.0001 112.7090 ++ 435.796017 m 0.0001 184 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 435.796017 m 8.0000 196 | 7/9
14 h-m-p 0.0160 8.0000 0.0034 +++++ 435.796012 m 8.0000 212 | 7/9
15 h-m-p 0.1014 2.6965 0.2682 +++ 435.795959 m 2.6965 227 | 8/9
16 h-m-p 1.6000 8.0000 0.0000 C 435.795959 0 1.6000 241 | 8/9
17 h-m-p 0.3333 8.0000 0.0000 Y 435.795959 0 0.0833 254 | 8/9
18 h-m-p 0.0010 0.4764 1.7446 +++++ 435.795959 m 0.4764 270 | 9/9
19 h-m-p 0.0160 8.0000 0.0000 Y 435.795959 0 0.0160 282 | 9/9
20 h-m-p 0.0160 8.0000 0.0000 Y 435.795959 0 0.0160 294
Out..
lnL = -435.795959
295 lfun, 885 eigenQcodon, 3540 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.062720 0.104471 0.101751 0.044253 0.104330 0.071157 0.000100 1.441250 0.347976 0.450485 1.486551
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.917244
np = 11
lnL0 = -488.155882
Iterating by ming2
Initial: fx= 488.155882
x= 0.06272 0.10447 0.10175 0.04425 0.10433 0.07116 0.00011 1.44125 0.34798 0.45049 1.48655
1 h-m-p 0.0000 0.0000 252.7991 ++ 487.887851 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0016 155.8829 ++++ 459.508531 m 0.0016 32 | 2/11
3 h-m-p 0.0000 0.0002 317.3915 ++ 450.854232 m 0.0002 46 | 3/11
4 h-m-p 0.0007 0.0033 64.2994 ++ 441.100806 m 0.0033 60 | 4/11
5 h-m-p 0.0000 0.0001 24.7930 ++ 441.089289 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0004 42.2292 +++ 440.684486 m 0.0004 89 | 6/11
7 h-m-p 0.0002 0.0008 37.5034 ++ 440.453712 m 0.0008 103 | 7/11
8 h-m-p 0.0081 0.7489 2.5283 -------------.. | 7/11
9 h-m-p 0.0000 0.0004 107.6941 +++ 435.795993 m 0.0004 143 | 8/11
10 h-m-p 0.8917 8.0000 0.0000 ++ 435.795993 m 8.0000 157 | 8/11
11 h-m-p 0.0160 8.0000 0.0497 ---------Y 435.795993 0 0.0000 183 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 ----Y 435.795993 0 0.0000 204 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 435.795993 m 8.0000 224 | 8/11
14 h-m-p 0.0012 0.6181 3.5649 +++++ 435.795980 m 0.6181 244 | 8/11
15 h-m-p -0.0000 -0.0000 0.2645
h-m-p: -0.00000000e+00 -0.00000000e+00 2.64452166e-01 435.795980
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 435.795980 m 8.0000 275 | 8/11
17 h-m-p 0.0160 8.0000 1.0064 +++++ 435.795919 m 8.0000 295 | 8/11
18 h-m-p 1.6000 8.0000 0.1932 ++ 435.795918 m 8.0000 309 | 8/11
19 h-m-p 0.6884 8.0000 2.2454 +Y 435.795917 0 2.0604 327 | 8/11
20 h-m-p 1.6000 8.0000 0.0032 ++ 435.795917 m 8.0000 341 | 8/11
21 h-m-p 0.6122 8.0000 0.0424 ----Y 435.795917 0 0.0017 362 | 8/11
22 h-m-p 0.0420 8.0000 0.0017 ++++ 435.795917 m 8.0000 381 | 8/11
23 h-m-p 0.0433 8.0000 0.3186 ++Y 435.795917 0 1.2811 400 | 8/11
24 h-m-p 1.6000 8.0000 0.0064 ++ 435.795917 m 8.0000 417 | 8/11
25 h-m-p 0.0379 8.0000 1.3466 +++Y 435.795916 0 2.4286 437 | 8/11
26 h-m-p 1.6000 8.0000 1.1039 ++ 435.795912 m 8.0000 451 | 8/11
27 h-m-p 1.6000 8.0000 4.2973 ++ 435.795905 m 8.0000 465 | 8/11
28 h-m-p 1.6000 8.0000 2.5893 ++ 435.795905 m 8.0000 479 | 8/11
29 h-m-p 1.6000 8.0000 9.8135 ++ 435.795904 m 8.0000 493 | 8/11
30 h-m-p 1.6000 8.0000 0.4197 ++ 435.795904 m 8.0000 507 | 8/11
31 h-m-p 0.9527 8.0000 3.5244 ------C 435.795904 0 0.0001 530 | 8/11
32 h-m-p 1.6000 8.0000 0.0001 --N 435.795904 0 0.0250 546 | 8/11
33 h-m-p 0.0469 8.0000 0.0000 --C 435.795904 0 0.0007 565
Out..
lnL = -435.795904
566 lfun, 2264 eigenQcodon, 10188 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -435.793347 S = -435.793301 -0.000017
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:04
did 20 / 43 patterns 0:04
did 30 / 43 patterns 0:04
did 40 / 43 patterns 0:04
did 43 / 43 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086670 0.061920 0.087611 0.012860 0.051769 0.077219 0.000100 0.458868 1.723981
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.825255
np = 9
lnL0 = -477.079895
Iterating by ming2
Initial: fx= 477.079895
x= 0.08667 0.06192 0.08761 0.01286 0.05177 0.07722 0.00011 0.45887 1.72398
1 h-m-p 0.0000 0.0000 257.9409 ++ 476.389916 m 0.0000 14 | 1/9
2 h-m-p 0.0003 0.1653 10.7645 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 258.2862 ++ 469.128291 m 0.0001 46 | 2/9
4 h-m-p 0.0024 0.1760 10.3684 ------------.. | 2/9
5 h-m-p 0.0000 0.0004 237.6932 +++ 448.092453 m 0.0004 81 | 3/9
6 h-m-p 0.0095 0.2649 8.1541 -------------.. | 3/9
7 h-m-p 0.0000 0.0001 221.5425 ++ 443.478172 m 0.0001 116 | 4/9
8 h-m-p 0.0022 0.4270 8.2708 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 193.3190 ++ 438.151296 m 0.0001 150 | 5/9
10 h-m-p 0.0029 0.6065 7.7089 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 159.8599 ++ 435.908693 m 0.0001 184 | 6/9
12 h-m-p 0.0018 0.8825 6.8930 ------------.. | 6/9
13 h-m-p 0.0000 0.0000 113.9099 ++ 435.796027 m 0.0000 218 | 7/9
14 h-m-p 0.2525 8.0000 0.0000 --------C 435.796027 0 0.0000 238 | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 435.796027 m 8.0000 255 | 6/9
16 h-m-p 0.0033 0.0165 0.0906 -----Y 435.796027 0 0.0000 275 | 6/9
17 h-m-p 0.0160 8.0000 0.0001 ----N 435.796027 0 0.0000 294 | 6/9
18 h-m-p 0.0160 8.0000 0.0000 ------Y 435.796027 0 0.0000 315
Out..
lnL = -435.796027
316 lfun, 3476 eigenQcodon, 18960 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.073959 0.090362 0.102904 0.065296 0.052098 0.100221 0.000236 0.900000 0.999432 1.980493 1.432248
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.061059
np = 11
lnL0 = -486.995148
Iterating by ming2
Initial: fx= 486.995148
x= 0.07396 0.09036 0.10290 0.06530 0.05210 0.10022 0.00024 0.90000 0.99943 1.98049 1.43225
1 h-m-p 0.0000 0.0002 244.1214 +++ 477.084936 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0009 194.0796 ++ 454.741557 m 0.0009 31 | 2/11
3 h-m-p 0.0000 0.0000 1186.1209 ++ 447.495284 m 0.0000 45 | 3/11
4 h-m-p 0.0013 0.0065 22.7233 ++ 445.859650 m 0.0065 59 | 4/11
5 h-m-p 0.0001 0.0007 48.9912 ++ 439.732627 m 0.0007 73 | 5/11
6 h-m-p 0.0018 0.1368 15.2875 ------------.. | 5/11
7 h-m-p 0.0000 0.0001 155.1195 ++ 436.273620 m 0.0001 111 | 6/11
8 h-m-p 0.0030 0.1531 5.2549 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 111.3097 ++ 435.795971 m 0.0000 149 | 7/11
10 h-m-p 0.1802 8.0000 0.0000 +++ 435.795971 m 8.0000 164 | 7/11
11 h-m-p 0.0414 8.0000 0.0005 --------Y 435.795971 0 0.0000 190
Out..
lnL = -435.795971
191 lfun, 2292 eigenQcodon, 12606 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -435.801466 S = -435.794437 -0.003081
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 43 patterns 0:12
did 20 / 43 patterns 0:12
did 30 / 43 patterns 0:12
did 40 / 43 patterns 0:13
did 43 / 43 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
NC_011896_1_WP_010907479_1_29_MLBR_RS00155 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
NC_002677_1_NP_301154_1_26_ML0030 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
**************************************************
NC_011896_1_WP_010907479_1_29_MLBR_RS00155 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
NC_002677_1_NP_301154_1_26_ML0030 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160 AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
**************************************************
NC_011896_1_WP_010907479_1_29_MLBR_RS00155 CGKNCAGCILSCR
NC_002677_1_NP_301154_1_26_ML0030 CGKNCAGCILSCR
NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115 CGKNCAGCILSCR
NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785 CGKNCAGCILSCR
NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160 CGKNCAGCILSCR
NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160 CGKNCAGCILSCR
*************
>NC_011896_1_WP_010907479_1_29_MLBR_RS00155 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT >NC_002677_1_NP_301154_1_26_ML0030 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT >NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT >NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT >NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT >NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160 ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>NC_011896_1_WP_010907479_1_29_MLBR_RS00155 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR >NC_002677_1_NP_301154_1_26_ML0030 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR >NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR >NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR >NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR >NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160 MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS CGKNCAGCILSCR
#NEXUS
[ID: 0719794944]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907479_1_29_MLBR_RS00155
NC_002677_1_NP_301154_1_26_ML0030
NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115
NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785
NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160
NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907479_1_29_MLBR_RS00155,
2 NC_002677_1_NP_301154_1_26_ML0030,
3 NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115,
4 NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785,
5 NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160,
6 NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06500618,2:0.0693921,3:0.06882838,4:0.0678552,5:0.06831976,6:0.06972998);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06500618,2:0.0693921,3:0.06882838,4:0.0678552,5:0.06831976,6:0.06972998);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -455.18 -458.20
2 -455.21 -458.01
--------------------------------------
TOTAL -455.19 -458.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891295 0.086746 0.360395 1.489011 0.858673 1298.80 1399.90 1.000
r(A<->C){all} 0.146994 0.015633 0.000007 0.397125 0.114391 303.39 368.09 1.003
r(A<->G){all} 0.180975 0.022181 0.000004 0.481592 0.140219 315.20 328.89 1.002
r(A<->T){all} 0.166927 0.019510 0.000023 0.447712 0.129732 242.34 341.75 1.000
r(C<->G){all} 0.173894 0.020874 0.000011 0.456480 0.133775 222.58 315.78 1.001
r(C<->T){all} 0.167110 0.020083 0.000003 0.456569 0.130174 236.90 240.09 1.005
r(G<->T){all} 0.164100 0.019498 0.000032 0.449187 0.130180 148.74 217.23 1.001
pi(A){all} 0.157147 0.000373 0.122006 0.197343 0.156750 1148.46 1321.79 1.000
pi(C){all} 0.320911 0.000646 0.268352 0.366097 0.321096 1386.95 1423.87 1.000
pi(G){all} 0.329247 0.000640 0.277605 0.375904 0.328808 1101.07 1111.23 1.000
pi(T){all} 0.192694 0.000471 0.147862 0.232807 0.192147 1183.79 1310.52 1.000
alpha{1,2} 0.409715 0.231721 0.000134 1.375773 0.237075 1218.75 1267.06 1.000
alpha{3} 0.442637 0.217859 0.000188 1.373491 0.293996 1180.59 1214.51 1.000
pinvar{all} 0.995086 0.000038 0.984359 0.999999 0.997053 1222.10 1305.14 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0030/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 113
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 2 2 2 2 2 2
TTC 1 1 1 1 1 1 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 5 5 5 5 5 5
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 3 3 3 3 3 3 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 3 3 3 3 3 3 | ACA 4 4 4 4 4 4 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 4 4 4 4 4 4 | GCC 12 12 12 12 12 12 | GAC 1 1 1 1 1 1 | GGC 5 5 5 5 5 5
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 7 7 7 7 7 7 | GCG 9 9 9 9 9 9 | GAG 0 0 0 0 0 0 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907479_1_29_MLBR_RS00155
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
#2: NC_002677_1_NP_301154_1_26_ML0030
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
#3: NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
#4: NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
#5: NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
#6: NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 12
TTC 6 | TCC 12 | TAC 0 | TGC 30
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 6 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 6 | CCC 6 | CAC 12 | CGC 6
CTA 18 | CCA 0 | Gln Q CAA 6 | CGA 6
CTG 24 | CCG 12 | CAG 18 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 0 | Ser S AGT 6
ATC 12 | ACC 30 | AAC 12 | AGC 6
ATA 18 | ACA 24 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 24 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 0 | Gly G GGT 18
GTC 24 | GCC 72 | GAC 6 | GGC 30
GTA 0 | GCA 18 | Glu E GAA 0 | GGA 6
GTG 42 | GCG 54 | GAG 0 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15044 C:0.20354 A:0.22124 G:0.42478
position 2: T:0.30973 C:0.36283 A:0.09735 G:0.23009
position 3: T:0.11504 C:0.39823 A:0.15044 G:0.33628
Average T:0.19174 C:0.32153 A:0.15634 G:0.33038
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -435.795946 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.432248
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907479_1_29_MLBR_RS00155: 0.000004, NC_002677_1_NP_301154_1_26_ML0030: 0.000004, NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115: 0.000004, NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785: 0.000004, NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160: 0.000004, NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.43225
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
7..2 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
7..3 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
7..4 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
7..5 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
7..6 0.000 235.5 103.5 1.4322 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -435.795959 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907479_1_29_MLBR_RS00155: 0.000004, NC_002677_1_NP_301154_1_26_ML0030: 0.000004, NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115: 0.000004, NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785: 0.000004, NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160: 0.000004, NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 235.5 103.5 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -435.795904 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000075 0.000001 139.585282
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907479_1_29_MLBR_RS00155: 0.000004, NC_002677_1_NP_301154_1_26_ML0030: 0.000004, NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115: 0.000004, NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785: 0.000004, NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160: 0.000004, NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00007 0.99993
w: 0.00000 1.00000 139.58528
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
7..2 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
7..3 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
7..4 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
7..5 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
7..6 0.000 235.5 103.5 139.5749 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907479_1_29_MLBR_RS00155)
Pr(w>1) post mean +- SE for w
1 M 1.000** 139.575
2 L 1.000** 139.575
3 I 1.000** 139.575
4 A 1.000** 139.575
5 G 1.000** 139.575
6 T 1.000** 139.575
7 L 1.000** 139.575
8 C 1.000** 139.575
9 V 1.000** 139.575
10 C 1.000** 139.575
11 A 1.000** 139.575
12 A 1.000** 139.575
13 V 1.000** 139.575
14 I 1.000** 139.575
15 S 1.000** 139.575
16 A 1.000** 139.575
17 V 1.000** 139.575
18 F 1.000** 139.575
19 G 1.000** 139.575
20 T 1.000** 139.575
21 W 1.000** 139.575
22 A 1.000** 139.575
23 L 1.000** 139.575
24 I 1.000** 139.575
25 H 1.000** 139.575
26 N 1.000** 139.575
27 Q 1.000** 139.575
28 T 1.000** 139.575
29 V 1.000** 139.575
30 D 1.000** 139.575
31 P 1.000** 139.575
32 T 1.000** 139.575
33 Q 1.000** 139.575
34 L 1.000** 139.575
35 A 1.000** 139.575
36 M 1.000** 139.575
37 R 1.000** 139.575
38 A 1.000** 139.575
39 M 1.000** 139.575
40 A 1.000** 139.575
41 P 1.000** 139.575
42 P 1.000** 139.575
43 Q 1.000** 139.575
44 L 1.000** 139.575
45 A 1.000** 139.575
46 A 1.000** 139.575
47 A 1.000** 139.575
48 I 1.000** 139.575
49 M 1.000** 139.575
50 L 1.000** 139.575
51 A 1.000** 139.575
52 A 1.000** 139.575
53 G 1.000** 139.575
54 G 1.000** 139.575
55 V 1.000** 139.575
56 V 1.000** 139.575
57 A 1.000** 139.575
58 L 1.000** 139.575
59 V 1.000** 139.575
60 A 1.000** 139.575
61 V 1.000** 139.575
62 A 1.000** 139.575
63 H 1.000** 139.575
64 T 1.000** 139.575
65 A 1.000** 139.575
66 L 1.000** 139.575
67 I 1.000** 139.575
68 V 1.000** 139.575
69 V 1.000** 139.575
70 A 1.000** 139.575
71 V 1.000** 139.575
72 C 1.000** 139.575
73 V 1.000** 139.575
74 T 1.000** 139.575
75 G 1.000** 139.575
76 A 1.000** 139.575
77 V 1.000** 139.575
78 G 1.000** 139.575
79 T 1.000** 139.575
80 L 1.000** 139.575
81 A 1.000** 139.575
82 A 1.000** 139.575
83 G 1.000** 139.575
84 S 1.000** 139.575
85 W 1.000** 139.575
86 Q 1.000** 139.575
87 S 1.000** 139.575
88 A 1.000** 139.575
89 R 1.000** 139.575
90 Y 1.000** 139.575
91 T 1.000** 139.575
92 L 1.000** 139.575
93 R 1.000** 139.575
94 R 1.000** 139.575
95 R 1.000** 139.575
96 A 1.000** 139.575
97 T 1.000** 139.575
98 A 1.000** 139.575
99 T 1.000** 139.575
100 S 1.000** 139.575
101 C 1.000** 139.575
102 G 1.000** 139.575
103 K 1.000** 139.575
104 N 1.000** 139.575
105 C 1.000** 139.575
106 A 1.000** 139.575
107 G 1.000** 139.575
108 C 1.000** 139.575
109 I 1.000** 139.575
110 L 1.000** 139.575
111 S 1.000** 139.575
112 C 1.000** 139.575
113 R 1.000** 139.575
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907479_1_29_MLBR_RS00155)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -435.796027 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000236 0.459522 1.725198
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907479_1_29_MLBR_RS00155: 0.000004, NC_002677_1_NP_301154_1_26_ML0030: 0.000004, NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115: 0.000004, NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785: 0.000004, NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160: 0.000004, NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00024
Parameters in M7 (beta):
p = 0.45952 q = 1.72520
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00077 0.00841 0.02579 0.05441 0.09604 0.15314 0.22951 0.33185 0.47424 0.70217
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
7..2 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
7..3 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
7..4 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
7..5 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
7..6 0.000 235.5 103.5 0.2076 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -435.795971 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.656837 0.918072 2.007480 1.580303
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907479_1_29_MLBR_RS00155: 0.000004, NC_002677_1_NP_301154_1_26_ML0030: 0.000004, NZ_LVXE01000010_1_WP_010907479_1_294_A3216_RS05115: 0.000004, NZ_LYPH01000099_1_WP_010907479_1_2857_A8144_RS13785: 0.000004, NZ_CP029543_1_WP_010907479_1_29_DIJ64_RS00160: 0.000004, NZ_AP014567_1_WP_010907479_1_29_JK2ML_RS00160: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.65684 p = 0.91807 q = 2.00748
(p1 = 0.34316) w = 1.58030
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06568 0.06568 0.06568 0.06568 0.06568 0.06568 0.06568 0.06568 0.06568 0.06568 0.34316
w: 0.01894 0.06422 0.11521 0.17158 0.23393 0.30356 0.38270 0.47554 0.59134 0.76210 1.58030
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
7..2 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
7..3 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
7..4 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
7..5 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
7..6 0.000 235.5 103.5 0.7472 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907479_1_29_MLBR_RS00155)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907479_1_29_MLBR_RS00155)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -435.795959 Model 2: PositiveSelection -435.795904 Model 0: one-ratio -435.795946 Model 7: beta -435.796027 Model 8: beta&w>1 -435.795971 Model 0 vs 1 2.599999993435631E-5 Model 2 vs 1 1.0999999994965037E-4 Model 8 vs 7 1.1199999994460086E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
