--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:19:30 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0030/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -455.18          -458.20
2       -455.21          -458.01
--------------------------------------
TOTAL     -455.19          -458.11
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.891295    0.086746    0.360395    1.489011    0.858673   1298.80   1399.90    1.000
r(A<->C){all}   0.146994    0.015633    0.000007    0.397125    0.114391    303.39    368.09    1.003
r(A<->G){all}   0.180975    0.022181    0.000004    0.481592    0.140219    315.20    328.89    1.002
r(A<->T){all}   0.166927    0.019510    0.000023    0.447712    0.129732    242.34    341.75    1.000
r(C<->G){all}   0.173894    0.020874    0.000011    0.456480    0.133775    222.58    315.78    1.001
r(C<->T){all}   0.167110    0.020083    0.000003    0.456569    0.130174    236.90    240.09    1.005
r(G<->T){all}   0.164100    0.019498    0.000032    0.449187    0.130180    148.74    217.23    1.001
pi(A){all}      0.157147    0.000373    0.122006    0.197343    0.156750   1148.46   1321.79    1.000
pi(C){all}      0.320911    0.000646    0.268352    0.366097    0.321096   1386.95   1423.87    1.000
pi(G){all}      0.329247    0.000640    0.277605    0.375904    0.328808   1101.07   1111.23    1.000
pi(T){all}      0.192694    0.000471    0.147862    0.232807    0.192147   1183.79   1310.52    1.000
alpha{1,2}      0.409715    0.231721    0.000134    1.375773    0.237075   1218.75   1267.06    1.000
alpha{3}        0.442637    0.217859    0.000188    1.373491    0.293996   1180.59   1214.51    1.000
pinvar{all}     0.995086    0.000038    0.984359    0.999999    0.997053   1222.10   1305.14    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-435.795959
Model 2: PositiveSelection	-435.795904
Model 0: one-ratio	-435.795946
Model 7: beta	-435.796027
Model 8: beta&w>1	-435.795971


Model 0 vs 1	2.599999993435631E-5

Model 2 vs 1	1.0999999994965037E-4

Model 8 vs 7	1.1199999994460086E-4
>C1
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C2
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C3
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C4
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C5
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C6
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113 

C1              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C2              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C3              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C4              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C5              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C6              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
                **************************************************

C1              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C2              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C3              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C4              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C5              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C6              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
                **************************************************

C1              CGKNCAGCILSCR
C2              CGKNCAGCILSCR
C3              CGKNCAGCILSCR
C4              CGKNCAGCILSCR
C5              CGKNCAGCILSCR
C6              CGKNCAGCILSCR
                *************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  113 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  113 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3390]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3390]--->[3390]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C2              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C3              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C4              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C5              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
C6              MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
                **************************************************

C1              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C2              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C3              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C4              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C5              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
C6              AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
                **************************************************

C1              CGKNCAGCILSCR
C2              CGKNCAGCILSCR
C3              CGKNCAGCILSCR
C4              CGKNCAGCILSCR
C5              CGKNCAGCILSCR
C6              CGKNCAGCILSCR
                *************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C2              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C3              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C4              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C5              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
C6              ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
                **************************************************

C1              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C2              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C3              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C4              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C5              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
C6              GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
                **************************************************

C1              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C2              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C3              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C4              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C5              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
C6              TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
                **************************************************

C1              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C2              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C3              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C4              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C5              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
C6              GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
                **************************************************

C1              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C2              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C3              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C4              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C5              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
C6              AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
                **************************************************

C1              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C2              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C3              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C4              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C5              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
C6              CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
                **************************************************

C1              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C2              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C3              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C4              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C5              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
C6              TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
                ***************************************



>C1
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C2
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C3
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C4
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C5
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C6
ATGTTGATCGCGGGCACACTGTGCGTGTGTGCGGCGGTGATATCCGCCGT
GTTCGGAACCTGGGCACTCATCCACAACCAGACCGTCGACCCCACGCAGC
TAGCGATGCGTGCCATGGCGCCGCCGCAGTTGGCCGCCGCGATAATGCTA
GCCGCCGGTGGTGTGGTGGCCCTGGTCGCGGTTGCACACACCGCCCTGAT
AGTGGTGGCCGTTTGTGTCACAGGTGCCGTCGGCACCCTGGCTGCCGGCT
CGTGGCAAAGCGCGCGATATACATTACGCCGGCGGGCAACAGCGACCAGT
TGCGGCAAGAACTGCGCCGGCTGCATTCTATCCTGCCGT
>C1
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C2
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C3
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C4
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C5
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR
>C6
MLIAGTLCVCAAVISAVFGTWALIHNQTVDPTQLAMRAMAPPQLAAAIML
AAGGVVALVAVAHTALIVVAVCVTGAVGTLAAGSWQSARYTLRRRATATS
CGKNCAGCILSCR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 339 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789091
      Setting output file names to "/data/3res/ML0030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 513876959
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0719794944
      Seed = 1823441473
      Swapseed = 1579789091
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -758.698208 -- -24.965149
         Chain 2 -- -758.698208 -- -24.965149
         Chain 3 -- -758.698208 -- -24.965149
         Chain 4 -- -758.698251 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -758.698208 -- -24.965149
         Chain 2 -- -758.698136 -- -24.965149
         Chain 3 -- -758.698251 -- -24.965149
         Chain 4 -- -758.698251 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-758.698] (-758.698) (-758.698) (-758.698) * [-758.698] (-758.698) (-758.698) (-758.698) 
        500 -- (-471.193) (-470.029) [-466.211] (-469.756) * (-473.551) (-473.365) (-479.523) [-472.987] -- 0:00:00
       1000 -- [-464.876] (-463.489) (-468.214) (-470.777) * (-468.583) (-471.385) (-477.602) [-459.230] -- 0:00:00
       1500 -- (-471.679) [-462.237] (-465.980) (-465.208) * (-462.540) [-462.316] (-464.768) (-467.610) -- 0:00:00
       2000 -- (-462.352) (-469.058) [-467.474] (-471.318) * (-464.563) (-465.253) (-465.905) [-463.457] -- 0:00:00
       2500 -- [-462.173] (-467.982) (-468.942) (-462.055) * (-466.400) (-467.499) [-464.285] (-460.220) -- 0:00:00
       3000 -- [-463.388] (-460.929) (-472.054) (-462.285) * (-465.463) [-465.798] (-463.281) (-468.079) -- 0:00:00
       3500 -- (-461.173) (-465.832) [-463.410] (-470.327) * (-481.804) (-461.899) (-461.723) [-457.856] -- 0:00:00
       4000 -- (-470.813) (-466.313) [-466.310] (-469.898) * (-464.244) [-460.065] (-465.217) (-464.487) -- 0:00:00
       4500 -- (-465.934) (-464.299) (-465.293) [-460.667] * (-465.870) (-464.692) (-465.721) [-466.643] -- 0:00:00
       5000 -- (-467.952) [-461.358] (-468.097) (-469.778) * (-462.322) [-461.303] (-471.345) (-466.945) -- 0:00:00

      Average standard deviation of split frequencies: 0.102479

       5500 -- (-462.321) (-464.793) [-475.845] (-468.410) * (-469.305) [-464.551] (-469.757) (-464.868) -- 0:03:00
       6000 -- (-466.361) (-468.793) [-464.716] (-461.216) * [-458.861] (-470.211) (-469.859) (-461.033) -- 0:02:45
       6500 -- (-468.683) (-465.579) (-473.824) [-460.402] * (-466.244) [-463.200] (-465.757) (-458.800) -- 0:02:32
       7000 -- (-466.043) [-464.358] (-466.191) (-469.807) * (-461.236) (-467.847) (-466.387) [-459.648] -- 0:02:21
       7500 -- (-465.119) (-484.953) (-466.934) [-461.720] * (-472.055) (-467.900) (-461.453) [-462.181] -- 0:02:12
       8000 -- (-468.186) (-467.702) (-472.510) [-459.191] * (-463.632) (-469.492) [-462.088] (-470.525) -- 0:02:04
       8500 -- (-476.117) (-454.723) (-480.269) [-465.468] * (-462.568) [-465.493] (-467.276) (-463.081) -- 0:01:56
       9000 -- (-455.215) [-457.403] (-470.519) (-464.355) * (-463.293) (-466.236) (-469.442) [-467.126] -- 0:01:50
       9500 -- [-454.383] (-455.457) (-462.577) (-465.589) * [-460.323] (-464.071) (-464.176) (-470.704) -- 0:01:44
      10000 -- (-454.451) (-457.062) (-478.556) [-462.524] * [-473.436] (-463.579) (-459.190) (-476.097) -- 0:01:39

      Average standard deviation of split frequencies: 0.056821

      10500 -- [-455.390] (-456.464) (-473.338) (-460.357) * [-468.304] (-462.925) (-466.759) (-458.936) -- 0:01:34
      11000 -- (-453.667) (-456.998) (-476.070) [-459.742] * (-470.758) (-474.170) (-470.512) [-464.730] -- 0:01:29
      11500 -- (-459.770) (-456.160) (-460.528) [-463.218] * [-462.942] (-468.445) (-466.183) (-462.710) -- 0:01:25
      12000 -- [-456.144] (-455.350) (-460.564) (-465.944) * [-469.395] (-464.207) (-472.745) (-463.782) -- 0:01:22
      12500 -- (-460.975) [-461.140] (-456.786) (-469.298) * (-469.125) (-469.835) (-467.793) [-462.140] -- 0:01:19
      13000 -- [-454.792] (-455.683) (-457.095) (-460.568) * (-464.627) [-466.449] (-465.313) (-474.069) -- 0:01:15
      13500 -- [-458.279] (-455.371) (-459.949) (-470.895) * (-470.462) (-470.841) [-465.634] (-462.728) -- 0:01:13
      14000 -- (-455.995) (-455.875) (-457.494) [-465.824] * [-461.567] (-466.494) (-464.474) (-464.989) -- 0:01:10
      14500 -- [-457.158] (-455.223) (-459.220) (-464.516) * (-463.271) (-469.637) (-463.760) [-464.075] -- 0:01:07
      15000 -- (-454.756) (-459.325) [-457.395] (-464.323) * (-466.731) (-463.356) [-462.533] (-466.109) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- [-455.923] (-455.522) (-456.410) (-462.497) * (-466.133) (-462.030) [-466.253] (-474.315) -- 0:01:03
      16000 -- (-454.992) [-455.119] (-455.871) (-472.312) * (-469.344) [-459.120] (-472.512) (-476.836) -- 0:01:01
      16500 -- [-457.725] (-456.121) (-455.966) (-463.029) * (-468.103) (-464.675) [-461.707] (-460.997) -- 0:00:59
      17000 -- (-454.793) (-455.160) (-456.626) [-465.151] * [-468.478] (-465.141) (-463.231) (-460.744) -- 0:00:57
      17500 -- (-454.165) (-455.161) [-455.822] (-463.934) * (-467.708) (-460.236) [-470.137] (-454.530) -- 0:00:56
      18000 -- [-455.423] (-454.110) (-454.662) (-463.355) * (-467.438) (-465.168) (-463.697) [-456.477] -- 0:00:54
      18500 -- (-455.501) [-454.715] (-456.200) (-464.251) * (-470.047) (-470.723) (-469.626) [-454.590] -- 0:00:53
      19000 -- (-455.045) (-456.195) [-453.855] (-472.589) * [-469.001] (-465.401) (-475.767) (-459.566) -- 0:00:51
      19500 -- [-456.668] (-455.853) (-453.743) (-464.809) * (-465.263) (-463.841) [-467.841] (-455.645) -- 0:00:50
      20000 -- (-456.821) [-455.772] (-454.448) (-463.803) * [-461.839] (-472.528) (-462.926) (-455.243) -- 0:00:49

      Average standard deviation of split frequencies: 0.042198

      20500 -- [-457.132] (-454.803) (-455.761) (-467.500) * (-485.918) (-463.806) [-464.860] (-455.303) -- 0:00:47
      21000 -- (-456.059) (-455.637) [-455.657] (-465.986) * (-475.420) (-466.062) (-463.886) [-454.350] -- 0:01:33
      21500 -- [-459.582] (-454.264) (-453.796) (-467.288) * [-454.463] (-466.996) (-464.906) (-454.965) -- 0:01:31
      22000 -- (-459.743) (-454.844) [-456.489] (-464.627) * [-462.499] (-466.316) (-465.852) (-455.759) -- 0:01:28
      22500 -- [-461.375] (-454.420) (-456.692) (-465.320) * (-454.662) (-460.920) [-465.152] (-454.980) -- 0:01:26
      23000 -- (-459.086) (-455.815) [-456.031] (-464.403) * (-455.900) [-467.446] (-469.797) (-454.675) -- 0:01:24
      23500 -- (-458.675) (-455.517) (-455.179) [-461.061] * (-456.417) (-468.729) (-459.259) [-454.393] -- 0:01:23
      24000 -- (-456.112) (-456.467) [-457.755] (-470.255) * (-457.706) (-465.014) (-463.002) [-454.306] -- 0:01:21
      24500 -- (-456.067) (-454.259) [-457.738] (-466.526) * (-453.694) (-463.358) [-465.838] (-454.744) -- 0:01:19
      25000 -- (-457.282) (-455.148) (-456.287) [-463.010] * (-455.518) (-464.720) (-467.504) [-455.488] -- 0:01:18

      Average standard deviation of split frequencies: 0.047298

      25500 -- [-456.186] (-455.193) (-454.767) (-463.706) * (-456.698) [-463.811] (-466.916) (-457.639) -- 0:01:16
      26000 -- (-454.084) (-456.144) (-455.138) [-466.949] * [-456.507] (-463.849) (-462.419) (-456.290) -- 0:01:14
      26500 -- (-455.219) [-456.605] (-456.977) (-469.420) * (-454.656) (-463.646) (-475.514) [-456.413] -- 0:01:13
      27000 -- (-459.535) (-454.670) (-457.196) [-460.161] * (-456.954) (-469.077) (-472.445) [-454.557] -- 0:01:12
      27500 -- (-455.789) [-456.379] (-455.294) (-460.045) * (-458.749) (-462.291) [-467.346] (-455.689) -- 0:01:10
      28000 -- [-454.929] (-453.989) (-454.954) (-467.961) * (-455.114) (-470.402) (-461.851) [-457.228] -- 0:01:09
      28500 -- (-455.977) [-456.340] (-456.990) (-470.245) * (-459.980) (-467.871) (-464.214) [-455.539] -- 0:01:08
      29000 -- [-455.123] (-457.637) (-454.979) (-458.377) * (-456.710) (-465.238) (-457.581) [-454.754] -- 0:01:06
      29500 -- (-455.619) [-458.657] (-455.885) (-469.389) * (-458.593) (-471.503) (-455.995) [-455.448] -- 0:01:05
      30000 -- (-454.757) (-456.941) (-456.992) [-468.224] * [-457.989] (-475.031) (-456.909) (-455.169) -- 0:01:04

      Average standard deviation of split frequencies: 0.054900

      30500 -- (-454.227) (-456.189) (-455.052) [-466.183] * (-456.572) (-467.273) [-454.281] (-456.335) -- 0:01:03
      31000 -- [-453.742] (-455.056) (-454.578) (-468.922) * (-456.228) (-456.474) (-455.348) [-455.040] -- 0:01:02
      31500 -- [-455.693] (-456.061) (-454.226) (-459.758) * (-456.087) (-459.441) (-458.619) [-457.524] -- 0:01:01
      32000 -- [-454.772] (-456.390) (-455.582) (-470.164) * (-455.375) (-458.255) (-456.034) [-454.273] -- 0:01:00
      32500 -- (-459.462) [-456.277] (-454.277) (-464.419) * (-456.799) (-457.609) (-455.689) [-453.979] -- 0:00:59
      33000 -- (-454.536) (-456.030) (-455.589) [-465.489] * (-456.195) (-456.142) (-456.875) [-457.129] -- 0:00:58
      33500 -- (-454.825) (-456.457) [-458.843] (-469.282) * [-454.853] (-455.985) (-458.393) (-456.731) -- 0:00:57
      34000 -- [-455.956] (-458.644) (-457.952) (-460.188) * [-456.596] (-455.674) (-455.002) (-455.058) -- 0:00:56
      34500 -- (-454.719) [-454.883] (-457.035) (-474.415) * (-457.075) [-454.345] (-454.716) (-455.092) -- 0:00:55
      35000 -- (-456.157) (-454.193) [-456.779] (-469.423) * (-455.658) [-454.914] (-456.838) (-454.820) -- 0:00:55

      Average standard deviation of split frequencies: 0.049261

      35500 -- (-460.342) [-455.982] (-457.174) (-465.162) * (-458.479) (-456.510) [-460.095] (-454.381) -- 0:00:54
      36000 -- (-455.709) (-458.503) (-455.600) [-463.223] * (-455.101) [-459.410] (-455.023) (-454.457) -- 0:00:53
      36500 -- (-457.283) (-457.176) (-461.277) [-459.586] * [-457.943] (-459.911) (-455.957) (-455.711) -- 0:00:52
      37000 -- (-458.247) (-455.894) [-454.891] (-464.725) * (-457.821) [-456.758] (-454.715) (-454.026) -- 0:01:18
      37500 -- (-455.521) (-454.646) [-456.816] (-469.591) * (-453.825) [-455.728] (-454.655) (-457.408) -- 0:01:17
      38000 -- (-455.581) (-456.444) (-455.903) [-459.851] * (-455.281) (-458.167) [-456.067] (-458.845) -- 0:01:15
      38500 -- (-454.914) [-456.799] (-457.854) (-469.604) * (-454.621) (-460.655) [-456.190] (-455.885) -- 0:01:14
      39000 -- (-457.857) [-459.406] (-455.815) (-464.067) * (-453.634) (-461.909) (-455.951) [-458.213] -- 0:01:13
      39500 -- (-456.123) (-456.181) (-456.059) [-466.644] * (-458.333) (-454.731) (-458.078) [-453.832] -- 0:01:12
      40000 -- [-460.900] (-457.984) (-454.655) (-464.703) * (-458.844) (-455.681) (-459.183) [-454.647] -- 0:01:12

      Average standard deviation of split frequencies: 0.052743

      40500 -- (-459.575) [-456.715] (-456.220) (-466.982) * (-455.194) (-456.027) (-454.229) [-455.009] -- 0:01:11
      41000 -- (-457.043) (-457.034) [-454.179] (-458.559) * (-455.071) (-454.633) (-454.866) [-454.144] -- 0:01:10
      41500 -- (-454.174) [-456.092] (-456.125) (-458.466) * (-455.143) (-458.101) (-457.720) [-455.337] -- 0:01:09
      42000 -- (-456.286) (-454.804) [-459.197] (-456.774) * [-455.118] (-458.392) (-455.216) (-454.195) -- 0:01:08
      42500 -- (-462.138) [-455.694] (-455.472) (-456.286) * [-456.421] (-456.806) (-456.970) (-458.771) -- 0:01:07
      43000 -- [-457.740] (-454.811) (-455.199) (-454.916) * (-455.643) (-457.853) [-458.658] (-463.667) -- 0:01:06
      43500 -- (-456.804) (-455.563) [-460.440] (-457.212) * (-454.997) (-456.380) [-454.612] (-457.049) -- 0:01:05
      44000 -- [-457.279] (-456.639) (-454.431) (-454.957) * (-457.260) (-456.744) [-454.649] (-455.276) -- 0:01:05
      44500 -- (-458.814) (-456.012) [-454.448] (-456.099) * (-457.112) [-455.778] (-454.587) (-456.159) -- 0:01:04
      45000 -- [-456.727] (-455.488) (-454.139) (-456.201) * [-463.809] (-455.841) (-454.266) (-454.908) -- 0:01:03

      Average standard deviation of split frequencies: 0.047824

      45500 -- (-454.414) (-455.478) [-460.493] (-457.654) * (-455.157) (-456.038) (-455.987) [-455.560] -- 0:01:02
      46000 -- (-454.707) (-454.614) [-455.271] (-456.186) * [-455.717] (-455.393) (-455.183) (-454.972) -- 0:01:02
      46500 -- (-457.128) [-456.702] (-454.467) (-454.053) * [-455.295] (-456.960) (-455.546) (-454.768) -- 0:01:01
      47000 -- [-454.608] (-456.231) (-454.118) (-455.767) * (-458.092) (-455.172) (-455.233) [-458.572] -- 0:01:00
      47500 -- (-454.078) (-456.817) [-454.180] (-454.832) * (-457.050) (-455.338) (-456.048) [-456.376] -- 0:01:00
      48000 -- (-454.648) [-453.579] (-454.963) (-455.928) * (-456.227) [-454.141] (-457.807) (-453.976) -- 0:00:59
      48500 -- (-459.688) [-454.506] (-457.411) (-459.686) * [-456.278] (-459.123) (-457.310) (-455.767) -- 0:00:58
      49000 -- (-459.284) (-455.353) (-456.759) [-457.153] * (-456.502) (-456.120) (-456.278) [-458.646] -- 0:00:58
      49500 -- (-456.198) (-458.263) [-457.751] (-456.730) * (-457.602) (-456.037) (-455.315) [-455.258] -- 0:00:57
      50000 -- (-467.136) (-458.968) [-457.240] (-455.752) * (-455.482) [-457.336] (-455.480) (-455.044) -- 0:00:57

      Average standard deviation of split frequencies: 0.049458

      50500 -- (-456.779) (-457.205) [-456.122] (-455.102) * (-457.715) [-455.151] (-454.996) (-455.820) -- 0:00:56
      51000 -- (-456.404) (-459.263) (-456.382) [-456.185] * (-457.543) (-456.419) (-453.881) [-459.033] -- 0:00:55
      51500 -- (-456.945) [-459.301] (-454.417) (-455.942) * (-456.405) (-455.299) (-455.135) [-458.395] -- 0:00:55
      52000 -- (-455.216) (-457.496) [-455.493] (-457.253) * (-453.539) (-455.035) [-455.402] (-454.275) -- 0:00:54
      52500 -- (-456.503) [-454.613] (-454.898) (-458.294) * (-455.552) (-455.777) (-458.240) [-455.329] -- 0:01:12
      53000 -- (-457.103) (-455.530) [-455.687] (-455.867) * (-454.639) (-456.943) (-457.548) [-456.024] -- 0:01:11
      53500 -- (-454.104) (-456.553) (-455.201) [-459.503] * (-458.497) (-455.534) (-455.575) [-454.502] -- 0:01:10
      54000 -- (-455.700) (-454.016) [-457.891] (-455.458) * [-456.173] (-455.936) (-457.466) (-456.789) -- 0:01:10
      54500 -- (-455.801) [-455.831] (-456.066) (-457.059) * (-455.452) [-454.540] (-454.904) (-457.377) -- 0:01:09
      55000 -- (-456.092) (-455.903) [-456.293] (-455.372) * (-457.519) (-456.414) [-455.157] (-455.224) -- 0:01:08

      Average standard deviation of split frequencies: 0.041689

      55500 -- (-455.008) (-459.063) (-457.584) [-454.928] * (-457.289) (-456.109) [-457.586] (-459.321) -- 0:01:08
      56000 -- (-454.196) (-457.137) (-455.301) [-457.329] * (-454.069) (-454.275) [-455.550] (-455.472) -- 0:01:07
      56500 -- (-454.211) (-454.100) [-459.752] (-456.324) * [-455.464] (-455.530) (-455.135) (-456.170) -- 0:01:06
      57000 -- [-454.186] (-454.382) (-455.248) (-456.302) * (-455.629) (-456.050) [-455.815] (-455.095) -- 0:01:06
      57500 -- [-454.050] (-454.020) (-455.977) (-455.182) * [-454.959] (-454.921) (-457.816) (-455.109) -- 0:01:05
      58000 -- [-453.996] (-457.003) (-456.868) (-456.826) * [-455.719] (-456.766) (-456.013) (-459.083) -- 0:01:04
      58500 -- [-454.725] (-456.141) (-455.048) (-455.588) * (-455.564) (-455.797) (-455.357) [-461.202] -- 0:01:04
      59000 -- (-454.590) (-455.285) (-453.809) [-454.940] * [-454.577] (-455.846) (-455.333) (-455.867) -- 0:01:03
      59500 -- (-456.393) [-454.834] (-457.449) (-455.283) * [-454.708] (-456.105) (-455.901) (-459.473) -- 0:01:03
      60000 -- (-456.214) (-455.133) (-460.225) [-453.853] * (-455.282) [-459.587] (-455.086) (-457.037) -- 0:01:02

      Average standard deviation of split frequencies: 0.038852

      60500 -- (-455.318) (-459.403) (-455.665) [-455.632] * (-454.835) (-458.181) (-455.662) [-454.866] -- 0:01:02
      61000 -- [-455.477] (-455.750) (-455.757) (-454.917) * (-455.240) (-458.493) (-456.941) [-454.801] -- 0:01:01
      61500 -- (-454.962) (-455.852) (-455.969) [-457.144] * (-455.210) (-456.784) (-458.618) [-456.739] -- 0:01:01
      62000 -- [-458.864] (-457.223) (-456.743) (-461.769) * (-455.971) [-457.539] (-456.927) (-458.047) -- 0:01:00
      62500 -- (-463.087) (-458.493) [-456.452] (-454.018) * (-456.444) (-462.058) (-457.834) [-454.869] -- 0:01:00
      63000 -- (-454.434) (-455.868) [-454.607] (-454.741) * (-457.478) (-454.979) [-459.317] (-456.477) -- 0:00:59
      63500 -- (-455.633) (-453.717) [-454.276] (-458.189) * (-455.675) (-453.691) [-455.023] (-458.599) -- 0:00:58
      64000 -- (-454.904) (-456.600) [-454.891] (-456.405) * (-460.623) [-454.647] (-456.161) (-454.485) -- 0:00:58
      64500 -- (-456.793) (-457.467) [-457.468] (-456.689) * [-456.835] (-458.192) (-454.245) (-457.801) -- 0:00:58
      65000 -- [-456.140] (-457.592) (-454.719) (-455.643) * [-457.496] (-460.589) (-454.812) (-459.346) -- 0:00:57

      Average standard deviation of split frequencies: 0.033440

      65500 -- (-455.136) (-457.606) (-460.974) [-457.907] * (-459.152) (-455.117) (-457.299) [-457.908] -- 0:00:57
      66000 -- (-455.567) (-455.610) [-454.168] (-457.921) * (-456.180) [-454.853] (-454.263) (-456.066) -- 0:00:56
      66500 -- (-457.634) (-461.617) (-458.290) [-458.367] * (-457.667) (-454.158) [-458.421] (-456.663) -- 0:00:56
      67000 -- (-454.642) (-456.364) (-455.243) [-454.592] * (-454.613) (-456.295) [-454.532] (-455.879) -- 0:00:55
      67500 -- [-454.941] (-454.241) (-456.416) (-458.415) * [-459.117] (-456.127) (-455.691) (-456.425) -- 0:00:55
      68000 -- (-454.420) (-456.598) [-454.928] (-455.587) * (-457.371) (-455.555) [-455.624] (-456.011) -- 0:01:08
      68500 -- (-454.821) [-456.922] (-455.868) (-457.981) * (-454.114) (-458.527) (-455.723) [-457.619] -- 0:01:07
      69000 -- (-457.188) (-457.279) [-453.694] (-458.175) * [-455.753] (-455.103) (-455.848) (-455.473) -- 0:01:07
      69500 -- [-455.198] (-455.144) (-456.437) (-456.576) * [-454.018] (-456.324) (-456.481) (-457.132) -- 0:01:06
      70000 -- [-456.185] (-454.644) (-457.551) (-455.934) * (-453.983) (-459.990) (-455.222) [-454.415] -- 0:01:06

      Average standard deviation of split frequencies: 0.033021

      70500 -- (-456.468) (-457.228) [-454.542] (-455.390) * (-456.569) [-454.488] (-453.980) (-458.809) -- 0:01:05
      71000 -- [-457.829] (-455.737) (-457.024) (-454.954) * (-454.403) (-456.538) (-457.796) [-454.511] -- 0:01:05
      71500 -- (-460.844) (-454.504) [-457.199] (-456.985) * (-456.674) [-455.580] (-459.049) (-458.976) -- 0:01:04
      72000 -- (-455.788) [-455.396] (-461.137) (-454.432) * (-458.521) [-454.849] (-456.915) (-457.160) -- 0:01:04
      72500 -- (-455.484) (-457.670) (-455.850) [-455.745] * (-457.815) [-456.012] (-455.209) (-455.496) -- 0:01:03
      73000 -- (-455.663) (-459.027) [-454.066] (-457.421) * [-457.613] (-455.914) (-455.804) (-456.036) -- 0:01:03
      73500 -- (-457.965) (-455.145) [-454.025] (-455.226) * [-457.083] (-456.135) (-454.184) (-459.264) -- 0:01:03
      74000 -- [-459.142] (-454.018) (-458.583) (-454.423) * (-457.419) [-456.029] (-462.395) (-457.809) -- 0:01:02
      74500 -- (-457.772) (-454.498) (-454.289) [-455.308] * (-456.820) (-456.627) (-456.988) [-457.387] -- 0:01:02
      75000 -- (-456.261) (-455.789) (-454.156) [-455.474] * (-454.391) [-454.493] (-460.502) (-454.740) -- 0:01:01

      Average standard deviation of split frequencies: 0.031993

      75500 -- (-455.791) [-453.816] (-455.638) (-454.250) * (-453.732) (-455.030) [-457.483] (-459.787) -- 0:01:01
      76000 -- [-457.412] (-459.051) (-456.352) (-457.035) * (-455.863) (-455.780) [-455.812] (-456.633) -- 0:01:00
      76500 -- (-455.574) (-457.180) [-454.168] (-455.393) * (-453.954) (-456.285) (-455.745) [-458.186] -- 0:01:00
      77000 -- (-457.935) (-454.346) [-454.939] (-455.636) * (-454.644) (-454.243) (-457.051) [-455.659] -- 0:00:59
      77500 -- (-462.010) (-454.449) (-457.220) [-456.891] * (-453.957) [-454.000] (-454.539) (-460.222) -- 0:00:59
      78000 -- [-455.352] (-458.382) (-455.115) (-454.039) * (-455.214) [-454.051] (-456.513) (-458.067) -- 0:00:59
      78500 -- [-453.930] (-461.981) (-454.803) (-456.761) * (-455.817) [-455.990] (-454.592) (-455.293) -- 0:00:58
      79000 -- (-455.910) (-457.108) (-456.091) [-457.233] * (-454.380) (-457.304) [-455.255] (-456.586) -- 0:00:58
      79500 -- (-458.535) (-456.930) [-457.591] (-459.728) * (-454.557) (-454.944) (-462.708) [-455.882] -- 0:00:57
      80000 -- (-460.106) [-454.919] (-459.021) (-461.122) * (-455.650) [-455.589] (-454.749) (-456.678) -- 0:00:57

      Average standard deviation of split frequencies: 0.030388

      80500 -- (-454.102) (-455.744) [-456.866] (-461.369) * (-456.131) (-456.357) (-456.595) [-454.774] -- 0:00:57
      81000 -- (-454.139) (-455.700) (-457.062) [-456.245] * (-457.142) [-453.747] (-457.002) (-455.007) -- 0:00:56
      81500 -- (-460.803) (-454.775) [-457.008] (-458.798) * (-455.920) [-453.557] (-455.830) (-456.227) -- 0:00:56
      82000 -- [-457.024] (-454.199) (-455.942) (-455.718) * (-456.760) (-455.485) [-457.134] (-455.335) -- 0:00:55
      82500 -- (-456.454) [-456.859] (-456.128) (-455.955) * (-454.420) [-455.036] (-456.278) (-456.275) -- 0:00:55
      83000 -- (-454.969) (-455.602) [-456.506] (-455.078) * (-454.692) (-454.136) (-458.390) [-454.925] -- 0:00:55
      83500 -- (-454.563) (-453.752) (-455.299) [-454.219] * (-455.779) (-454.753) (-453.615) [-455.510] -- 0:00:54
      84000 -- (-453.978) (-458.623) (-455.382) [-456.036] * (-455.212) (-454.588) [-454.790] (-456.484) -- 0:01:05
      84500 -- (-456.449) (-455.346) [-454.370] (-456.073) * (-454.774) (-454.760) (-454.023) [-453.893] -- 0:01:05
      85000 -- (-456.565) [-453.936] (-454.218) (-454.200) * (-458.147) (-457.703) (-454.859) [-458.780] -- 0:01:04

      Average standard deviation of split frequencies: 0.030801

      85500 -- (-456.497) [-456.712] (-456.519) (-454.729) * [-456.204] (-459.920) (-458.970) (-454.922) -- 0:01:04
      86000 -- (-454.454) (-454.969) (-455.301) [-456.204] * (-455.759) (-456.258) [-455.530] (-454.872) -- 0:01:03
      86500 -- (-455.366) (-455.113) (-454.134) [-455.829] * (-453.896) [-456.769] (-455.426) (-454.955) -- 0:01:03
      87000 -- [-459.667] (-455.426) (-458.146) (-456.300) * (-457.697) [-459.362] (-456.198) (-460.241) -- 0:01:02
      87500 -- [-456.526] (-455.375) (-456.382) (-454.569) * (-457.230) (-455.147) (-460.124) [-455.422] -- 0:01:02
      88000 -- (-454.047) (-456.373) [-456.692] (-453.901) * (-454.898) (-459.096) [-454.829] (-457.517) -- 0:01:02
      88500 -- (-455.770) (-454.957) [-455.200] (-455.363) * [-454.853] (-454.605) (-454.911) (-459.901) -- 0:01:01
      89000 -- (-457.465) (-458.319) [-456.259] (-457.554) * (-458.161) (-454.632) [-455.097] (-461.061) -- 0:01:01
      89500 -- (-456.889) (-457.853) (-463.376) [-456.012] * (-455.242) [-454.324] (-454.915) (-457.385) -- 0:01:01
      90000 -- (-457.724) [-454.573] (-453.823) (-454.121) * (-456.290) (-455.149) (-456.543) [-455.653] -- 0:01:00

      Average standard deviation of split frequencies: 0.030206

      90500 -- [-454.977] (-456.065) (-457.815) (-461.299) * [-456.533] (-454.047) (-456.198) (-455.362) -- 0:01:00
      91000 -- [-456.113] (-454.923) (-455.425) (-456.140) * (-453.584) (-454.495) [-453.941] (-457.696) -- 0:00:59
      91500 -- (-456.111) (-459.442) (-458.699) [-458.441] * (-455.699) [-455.074] (-455.031) (-454.196) -- 0:00:59
      92000 -- (-455.858) (-455.171) [-454.195] (-456.178) * (-457.360) (-456.292) (-455.239) [-460.191] -- 0:00:59
      92500 -- [-457.496] (-456.162) (-457.179) (-455.664) * (-456.698) (-454.746) [-454.156] (-455.873) -- 0:00:58
      93000 -- [-456.204] (-458.658) (-458.466) (-454.996) * [-455.201] (-455.146) (-459.329) (-455.822) -- 0:00:58
      93500 -- (-460.867) (-458.660) [-454.638] (-456.307) * (-458.110) [-454.882] (-455.228) (-454.310) -- 0:00:58
      94000 -- (-456.494) (-455.480) [-456.483] (-456.005) * (-456.541) (-456.274) (-457.050) [-455.032] -- 0:00:57
      94500 -- (-454.568) [-454.231] (-458.581) (-458.444) * (-457.590) (-455.351) (-457.347) [-454.991] -- 0:00:57
      95000 -- (-456.242) (-455.455) (-457.379) [-455.133] * (-457.952) (-454.449) (-459.092) [-454.468] -- 0:00:57

      Average standard deviation of split frequencies: 0.028294

      95500 -- (-465.110) (-457.353) (-454.268) [-456.018] * (-457.613) (-454.868) (-455.200) [-458.376] -- 0:00:56
      96000 -- (-456.303) [-455.410] (-457.908) (-457.261) * (-454.133) [-454.416] (-457.106) (-458.827) -- 0:00:56
      96500 -- (-456.419) [-455.117] (-455.196) (-456.335) * (-453.870) (-458.676) (-456.526) [-457.016] -- 0:00:56
      97000 -- (-456.184) (-458.560) (-455.663) [-457.203] * (-455.286) [-455.871] (-457.796) (-459.649) -- 0:00:55
      97500 -- [-457.401] (-455.975) (-458.365) (-454.443) * (-459.654) (-457.281) [-455.243] (-457.255) -- 0:00:55
      98000 -- (-455.349) [-454.833] (-460.516) (-456.754) * (-455.557) (-457.274) (-459.322) [-454.300] -- 0:00:55
      98500 -- (-457.406) [-455.225] (-456.994) (-458.381) * (-456.151) (-457.084) (-455.024) [-456.531] -- 0:00:54
      99000 -- [-459.458] (-455.695) (-457.134) (-455.751) * [-458.998] (-456.239) (-457.531) (-456.420) -- 0:00:54
      99500 -- [-455.037] (-455.841) (-455.609) (-456.692) * (-454.241) [-455.542] (-455.831) (-457.625) -- 0:01:03
      100000 -- (-460.880) (-458.127) [-455.464] (-455.723) * (-453.560) (-454.741) (-455.863) [-458.053] -- 0:01:02

      Average standard deviation of split frequencies: 0.024646

      100500 -- (-456.927) (-455.728) (-459.259) [-454.799] * (-458.183) [-455.304] (-455.717) (-456.016) -- 0:01:02
      101000 -- (-457.889) (-454.013) [-456.106] (-456.666) * (-454.759) [-455.798] (-455.265) (-461.096) -- 0:01:02
      101500 -- [-455.340] (-454.929) (-455.936) (-457.358) * (-456.518) [-456.716] (-454.940) (-455.884) -- 0:01:01
      102000 -- (-454.216) [-456.163] (-456.886) (-460.106) * [-455.880] (-454.945) (-455.239) (-457.420) -- 0:01:01
      102500 -- (-454.215) [-456.740] (-458.381) (-457.098) * (-455.447) (-456.668) (-454.485) [-454.022] -- 0:01:01
      103000 -- (-454.937) (-455.578) [-456.842] (-454.072) * [-456.373] (-455.321) (-454.257) (-454.964) -- 0:01:00
      103500 -- (-453.948) (-455.891) [-456.046] (-454.915) * (-457.037) (-455.774) (-456.379) [-453.964] -- 0:01:00
      104000 -- (-454.335) [-459.965] (-455.713) (-454.921) * [-454.513] (-454.703) (-455.253) (-456.297) -- 0:01:00
      104500 -- [-456.114] (-458.844) (-455.929) (-459.999) * [-455.357] (-455.565) (-455.117) (-458.232) -- 0:00:59
      105000 -- (-458.126) (-455.466) [-455.518] (-455.427) * (-455.383) (-454.996) [-454.244] (-459.177) -- 0:00:59

      Average standard deviation of split frequencies: 0.023295

      105500 -- [-455.384] (-455.719) (-455.378) (-456.170) * (-456.912) (-457.385) [-455.101] (-456.264) -- 0:00:59
      106000 -- (-457.286) (-457.125) (-453.592) [-455.249] * (-454.339) (-458.558) [-457.302] (-455.450) -- 0:00:59
      106500 -- (-460.980) (-456.896) (-455.117) [-453.974] * (-456.758) (-457.291) [-454.746] (-456.842) -- 0:00:58
      107000 -- (-460.087) [-454.947] (-453.691) (-457.546) * (-454.631) (-458.003) [-455.013] (-454.932) -- 0:00:58
      107500 -- (-455.349) (-458.779) (-453.991) [-457.883] * (-454.582) [-457.324] (-456.029) (-457.344) -- 0:00:58
      108000 -- [-457.481] (-459.041) (-455.311) (-457.313) * [-456.509] (-457.155) (-456.116) (-457.781) -- 0:00:57
      108500 -- [-458.457] (-455.949) (-455.979) (-458.382) * (-454.409) [-454.219] (-455.263) (-454.138) -- 0:00:57
      109000 -- (-456.280) (-456.059) (-458.031) [-456.562] * (-455.417) [-454.366] (-456.355) (-456.676) -- 0:00:57
      109500 -- [-456.705] (-455.898) (-458.512) (-455.961) * [-459.720] (-455.359) (-455.441) (-453.968) -- 0:00:56
      110000 -- (-455.681) (-456.470) (-454.442) [-457.273] * [-456.170] (-454.645) (-457.633) (-456.400) -- 0:00:56

      Average standard deviation of split frequencies: 0.024493

      110500 -- (-456.156) (-453.815) (-454.515) [-453.971] * (-460.378) [-454.521] (-454.972) (-456.063) -- 0:00:56
      111000 -- (-456.222) [-456.068] (-454.650) (-456.714) * (-460.353) [-455.737] (-455.542) (-454.292) -- 0:00:56
      111500 -- (-454.329) [-455.884] (-454.871) (-457.802) * (-456.850) (-455.240) (-458.153) [-455.159] -- 0:00:55
      112000 -- (-460.640) (-457.379) [-455.746] (-455.795) * (-457.973) (-456.057) [-455.076] (-456.939) -- 0:00:55
      112500 -- [-453.784] (-456.566) (-456.145) (-458.431) * (-457.279) (-454.084) [-461.273] (-455.577) -- 0:00:55
      113000 -- (-457.818) [-458.090] (-456.543) (-455.761) * (-456.245) (-454.727) [-457.688] (-460.215) -- 0:00:54
      113500 -- [-456.418] (-454.957) (-455.374) (-454.923) * (-457.061) [-456.197] (-457.427) (-455.271) -- 0:00:54
      114000 -- [-455.766] (-463.177) (-455.425) (-454.562) * (-455.940) (-454.525) (-455.625) [-463.913] -- 0:00:54
      114500 -- (-455.332) (-457.523) (-456.052) [-458.098] * (-455.834) [-458.326] (-457.315) (-458.445) -- 0:01:01
      115000 -- (-455.350) [-456.260] (-458.104) (-454.778) * (-456.422) [-455.462] (-459.717) (-457.289) -- 0:01:01

      Average standard deviation of split frequencies: 0.022148

      115500 -- (-457.021) [-457.528] (-458.951) (-457.997) * (-456.126) (-454.474) (-457.325) [-456.586] -- 0:01:01
      116000 -- (-459.007) (-456.314) (-457.969) [-454.070] * (-457.535) (-454.432) [-456.309] (-457.746) -- 0:01:00
      116500 -- [-459.721] (-455.728) (-458.750) (-455.152) * [-455.777] (-457.392) (-457.117) (-454.528) -- 0:01:00
      117000 -- (-456.062) (-455.597) (-456.892) [-455.990] * (-455.822) (-459.688) (-456.632) [-454.315] -- 0:01:00
      117500 -- [-454.038] (-454.989) (-454.401) (-454.815) * (-455.451) (-460.377) (-455.524) [-455.690] -- 0:01:00
      118000 -- (-453.755) (-456.656) [-454.657] (-454.752) * (-455.289) (-461.301) [-456.084] (-453.949) -- 0:00:59
      118500 -- (-455.053) (-456.733) [-455.983] (-454.656) * (-455.597) [-461.480] (-455.594) (-458.467) -- 0:00:59
      119000 -- [-455.923] (-454.131) (-454.999) (-454.740) * (-454.247) [-456.316] (-456.435) (-457.900) -- 0:00:59
      119500 -- [-455.686] (-458.690) (-457.291) (-456.660) * [-455.329] (-461.446) (-458.908) (-458.032) -- 0:00:58
      120000 -- (-455.237) [-455.207] (-455.762) (-455.114) * (-457.630) (-455.969) (-463.631) [-454.367] -- 0:00:58

      Average standard deviation of split frequencies: 0.025176

      120500 -- (-456.512) (-456.945) [-455.243] (-455.303) * [-456.791] (-455.379) (-466.923) (-457.081) -- 0:00:58
      121000 -- [-454.289] (-456.775) (-455.435) (-460.688) * [-454.222] (-461.234) (-465.724) (-456.515) -- 0:00:58
      121500 -- (-453.981) (-455.283) (-458.262) [-454.243] * (-454.913) (-458.544) [-459.498] (-454.536) -- 0:00:57
      122000 -- (-455.370) (-455.859) [-456.941] (-454.781) * (-456.534) (-455.095) (-458.626) [-456.977] -- 0:00:57
      122500 -- (-455.696) (-458.647) (-456.907) [-455.076] * (-458.212) [-453.945] (-458.086) (-457.852) -- 0:00:57
      123000 -- (-458.205) (-460.825) (-455.776) [-455.520] * (-456.403) (-455.492) (-459.497) [-455.008] -- 0:00:57
      123500 -- (-456.473) (-454.920) (-455.688) [-454.003] * (-454.791) (-454.755) (-454.839) [-458.081] -- 0:00:56
      124000 -- (-455.743) [-455.550] (-455.611) (-458.606) * [-459.336] (-455.039) (-457.796) (-454.514) -- 0:00:56
      124500 -- [-457.182] (-454.125) (-455.544) (-456.915) * [-455.058] (-455.463) (-457.335) (-456.648) -- 0:00:56
      125000 -- (-458.186) [-454.457] (-455.332) (-458.686) * (-454.469) [-454.038] (-455.867) (-457.813) -- 0:00:56

      Average standard deviation of split frequencies: 0.023629

      125500 -- (-455.872) (-454.553) [-458.428] (-457.465) * (-456.108) (-455.477) [-457.713] (-453.902) -- 0:00:55
      126000 -- [-455.099] (-457.629) (-456.224) (-455.360) * (-455.914) (-456.125) [-454.112] (-455.393) -- 0:00:55
      126500 -- [-454.278] (-454.917) (-455.399) (-455.595) * (-459.563) (-455.270) [-454.696] (-456.343) -- 0:00:55
      127000 -- [-459.586] (-455.179) (-454.585) (-456.524) * (-456.533) (-456.691) [-458.564] (-454.457) -- 0:00:54
      127500 -- [-457.277] (-456.496) (-457.707) (-459.282) * (-464.446) (-455.466) (-463.072) [-455.161] -- 0:00:54
      128000 -- (-455.618) [-454.916] (-460.030) (-454.111) * [-455.435] (-457.076) (-456.127) (-454.778) -- 0:00:54
      128500 -- (-454.247) [-457.234] (-459.924) (-455.322) * (-456.366) [-457.425] (-457.092) (-460.891) -- 0:01:01
      129000 -- (-454.586) [-456.767] (-456.834) (-455.725) * (-454.286) (-461.680) (-457.792) [-460.464] -- 0:01:00
      129500 -- [-455.489] (-454.743) (-461.574) (-455.097) * (-457.654) [-453.712] (-456.765) (-457.802) -- 0:01:00
      130000 -- (-456.241) (-457.052) (-455.323) [-455.029] * (-457.083) [-457.177] (-454.339) (-458.000) -- 0:01:00

      Average standard deviation of split frequencies: 0.025064

      130500 -- (-453.885) (-461.632) (-454.619) [-454.327] * (-457.703) [-457.831] (-454.791) (-454.237) -- 0:00:59
      131000 -- (-454.931) (-459.868) (-454.526) [-461.145] * (-454.740) (-456.247) (-455.184) [-454.347] -- 0:00:59
      131500 -- (-454.095) (-453.821) [-454.619] (-457.564) * (-456.901) [-456.516] (-454.459) (-456.516) -- 0:00:59
      132000 -- (-455.834) [-453.782] (-455.335) (-457.306) * (-455.962) [-456.841] (-454.652) (-454.546) -- 0:00:59
      132500 -- [-454.201] (-456.948) (-455.074) (-460.362) * (-457.249) [-454.508] (-455.196) (-458.884) -- 0:00:58
      133000 -- [-455.518] (-455.372) (-454.990) (-462.362) * (-458.577) (-456.671) (-456.003) [-456.257] -- 0:00:58
      133500 -- (-456.079) (-455.881) (-456.728) [-455.455] * (-455.882) [-459.243] (-455.525) (-456.454) -- 0:00:58
      134000 -- (-455.864) (-459.531) (-457.429) [-456.574] * (-458.698) [-458.062] (-457.851) (-455.640) -- 0:00:58
      134500 -- [-454.751] (-458.093) (-455.437) (-459.065) * (-459.049) (-459.839) [-456.917] (-454.800) -- 0:00:57
      135000 -- [-454.025] (-459.322) (-455.134) (-457.500) * (-456.181) [-459.138] (-456.177) (-455.966) -- 0:00:57

      Average standard deviation of split frequencies: 0.025034

      135500 -- (-462.007) (-460.812) (-454.410) [-454.139] * [-454.682] (-457.229) (-453.840) (-457.948) -- 0:00:57
      136000 -- (-463.832) [-455.177] (-458.516) (-460.757) * (-457.834) (-457.176) [-455.650] (-455.307) -- 0:00:57
      136500 -- (-460.596) (-454.447) (-461.432) [-461.281] * [-456.449] (-455.614) (-454.367) (-455.553) -- 0:00:56
      137000 -- (-456.021) (-456.847) [-460.711] (-457.683) * (-456.670) [-456.138] (-454.169) (-454.526) -- 0:00:56
      137500 -- (-453.990) [-455.187] (-457.799) (-456.566) * (-456.023) (-454.957) [-454.499] (-455.158) -- 0:00:56
      138000 -- (-454.360) [-453.863] (-458.694) (-457.407) * (-454.619) (-455.672) (-454.179) [-454.749] -- 0:00:56
      138500 -- (-456.460) (-453.649) (-462.211) [-456.465] * (-456.716) [-456.309] (-455.990) (-455.560) -- 0:00:55
      139000 -- [-456.403] (-454.769) (-459.294) (-457.286) * (-457.229) (-455.855) [-455.928] (-456.959) -- 0:00:55
      139500 -- [-456.178] (-455.067) (-455.038) (-454.596) * (-460.958) (-458.431) [-456.585] (-456.672) -- 0:00:55
      140000 -- (-456.159) (-454.788) (-460.340) [-455.088] * (-456.688) (-454.270) (-457.973) [-455.071] -- 0:00:55

      Average standard deviation of split frequencies: 0.022276

      140500 -- (-454.864) [-455.204] (-457.985) (-455.905) * [-455.866] (-453.962) (-455.422) (-454.146) -- 0:00:55
      141000 -- (-455.334) (-454.724) [-456.946] (-459.387) * (-454.809) (-453.900) [-456.790] (-453.853) -- 0:00:54
      141500 -- [-455.225] (-457.792) (-457.590) (-457.050) * (-453.738) (-455.800) (-456.058) [-457.345] -- 0:00:54
      142000 -- (-456.270) (-455.221) [-456.030] (-462.587) * (-454.252) (-457.378) [-454.765] (-456.331) -- 0:00:54
      142500 -- (-459.217) (-454.390) (-454.685) [-456.424] * (-455.999) (-454.966) [-456.531] (-456.109) -- 0:00:54
      143000 -- [-456.670] (-453.860) (-454.565) (-460.285) * (-456.246) [-456.319] (-457.894) (-454.022) -- 0:00:53
      143500 -- (-460.793) (-454.195) (-454.074) [-455.367] * (-457.934) (-457.930) (-459.767) [-454.318] -- 0:00:53
      144000 -- (-455.390) [-456.116] (-460.228) (-454.059) * (-460.959) (-454.542) [-458.143] (-457.740) -- 0:00:53
      144500 -- [-459.610] (-456.070) (-455.802) (-456.742) * (-467.174) [-455.055] (-455.411) (-454.694) -- 0:00:59
      145000 -- (-457.075) (-455.326) [-455.163] (-458.119) * (-461.569) [-454.017] (-455.352) (-453.623) -- 0:00:58

      Average standard deviation of split frequencies: 0.020341

      145500 -- (-454.511) (-454.642) [-454.165] (-457.566) * [-455.874] (-453.954) (-457.202) (-457.027) -- 0:00:58
      146000 -- (-455.504) [-454.891] (-455.566) (-457.865) * (-461.311) [-456.064] (-457.874) (-457.650) -- 0:00:58
      146500 -- (-457.531) [-454.582] (-455.431) (-457.296) * (-455.944) (-454.960) (-456.383) [-454.355] -- 0:00:58
      147000 -- (-455.033) (-457.580) (-454.863) [-457.008] * (-455.757) [-457.160] (-455.097) (-455.062) -- 0:00:58
      147500 -- (-456.756) (-456.048) [-455.112] (-455.466) * [-454.707] (-456.371) (-456.620) (-459.619) -- 0:00:57
      148000 -- (-456.969) (-455.543) [-455.496] (-454.696) * (-455.038) [-454.967] (-456.268) (-456.959) -- 0:00:57
      148500 -- [-454.786] (-454.915) (-458.132) (-454.912) * (-454.036) (-456.449) (-454.923) [-456.056] -- 0:00:57
      149000 -- (-453.938) (-457.785) (-457.104) [-454.410] * (-455.685) (-458.706) [-454.533] (-457.803) -- 0:00:57
      149500 -- [-454.388] (-458.233) (-458.250) (-455.399) * (-455.187) (-456.469) [-459.830] (-457.560) -- 0:00:56
      150000 -- [-456.389] (-454.781) (-457.099) (-455.478) * (-459.138) [-454.269] (-455.910) (-460.520) -- 0:00:56

      Average standard deviation of split frequencies: 0.024335

      150500 -- (-456.369) [-454.042] (-455.869) (-454.347) * (-460.695) (-455.677) (-455.471) [-455.092] -- 0:00:56
      151000 -- (-459.315) (-454.346) [-454.502] (-456.248) * [-455.913] (-455.671) (-458.100) (-456.338) -- 0:00:56
      151500 -- (-457.322) (-455.893) [-455.118] (-457.174) * (-457.481) [-456.333] (-455.587) (-460.131) -- 0:00:56
      152000 -- (-460.654) (-457.338) [-454.664] (-457.705) * (-460.276) (-454.461) [-455.609] (-454.620) -- 0:00:55
      152500 -- (-460.252) (-454.457) [-457.190] (-455.520) * (-460.414) (-457.885) [-454.647] (-458.122) -- 0:00:55
      153000 -- (-461.754) [-455.105] (-457.961) (-455.349) * [-456.421] (-455.948) (-456.518) (-457.124) -- 0:00:55
      153500 -- [-454.744] (-456.545) (-455.123) (-454.645) * [-454.851] (-460.608) (-458.300) (-459.856) -- 0:00:55
      154000 -- [-454.279] (-456.096) (-458.508) (-454.494) * (-454.734) [-459.863] (-455.098) (-455.419) -- 0:00:54
      154500 -- [-454.030] (-457.792) (-459.739) (-453.805) * (-455.356) [-454.328] (-456.409) (-455.761) -- 0:00:54
      155000 -- (-454.108) [-459.733] (-454.508) (-455.277) * (-455.561) (-456.779) [-455.568] (-455.826) -- 0:00:54

      Average standard deviation of split frequencies: 0.024708

      155500 -- [-453.774] (-456.119) (-457.569) (-458.665) * (-457.777) (-456.376) (-458.025) [-455.555] -- 0:00:54
      156000 -- (-461.922) [-455.134] (-458.980) (-455.768) * [-455.263] (-455.000) (-460.053) (-455.615) -- 0:00:54
      156500 -- (-458.433) [-454.406] (-455.363) (-455.963) * (-459.066) (-457.322) (-455.137) [-455.698] -- 0:00:53
      157000 -- (-455.944) (-454.909) (-455.557) [-460.150] * (-461.077) (-455.834) [-456.678] (-454.744) -- 0:00:53
      157500 -- (-454.220) (-454.483) (-455.670) [-455.066] * [-455.733] (-454.655) (-461.204) (-457.232) -- 0:00:53
      158000 -- (-457.197) (-454.902) [-455.191] (-454.361) * [-456.811] (-457.879) (-454.169) (-456.514) -- 0:00:53
      158500 -- (-456.413) (-456.544) (-454.892) [-456.710] * (-455.937) (-454.232) [-455.164] (-456.927) -- 0:00:53
      159000 -- (-455.828) (-455.460) [-455.317] (-456.348) * [-457.404] (-454.529) (-455.642) (-461.265) -- 0:00:52
      159500 -- (-454.206) (-456.157) (-457.165) [-456.132] * (-455.861) (-458.567) (-456.588) [-458.119] -- 0:00:52
      160000 -- [-456.189] (-456.111) (-457.593) (-456.930) * [-453.799] (-455.788) (-455.539) (-456.157) -- 0:00:52

      Average standard deviation of split frequencies: 0.025198

      160500 -- (-453.592) (-460.342) (-456.561) [-454.738] * (-457.726) [-456.486] (-453.960) (-455.398) -- 0:00:57
      161000 -- [-454.420] (-455.646) (-458.520) (-455.973) * [-464.845] (-455.734) (-453.921) (-456.770) -- 0:00:57
      161500 -- (-460.104) [-455.116] (-459.367) (-454.581) * [-457.951] (-458.161) (-455.920) (-456.316) -- 0:00:57
      162000 -- (-454.857) (-455.246) (-455.609) [-455.305] * [-456.438] (-458.150) (-455.006) (-454.878) -- 0:00:56
      162500 -- (-459.844) (-455.829) (-455.762) [-455.572] * (-454.977) (-454.849) (-455.458) [-455.946] -- 0:00:56
      163000 -- (-457.280) [-456.514] (-455.425) (-455.056) * (-457.363) (-453.946) (-455.659) [-455.159] -- 0:00:56
      163500 -- (-456.173) [-455.007] (-458.312) (-457.586) * (-454.435) (-455.072) (-456.385) [-456.306] -- 0:00:56
      164000 -- (-456.859) [-454.874] (-456.597) (-456.643) * [-454.852] (-458.667) (-456.948) (-456.579) -- 0:00:56
      164500 -- (-454.454) [-454.693] (-454.097) (-455.518) * [-453.935] (-456.649) (-454.575) (-456.848) -- 0:00:55
      165000 -- (-455.622) (-456.543) [-453.858] (-454.314) * [-458.367] (-457.079) (-455.976) (-455.635) -- 0:00:55

      Average standard deviation of split frequencies: 0.023002

      165500 -- [-454.945] (-456.778) (-458.993) (-454.997) * (-455.729) [-455.916] (-457.156) (-456.581) -- 0:00:55
      166000 -- (-458.034) [-454.159] (-460.041) (-455.599) * (-459.746) (-455.031) (-454.750) [-456.881] -- 0:00:55
      166500 -- (-457.947) [-455.164] (-455.981) (-456.418) * [-454.306] (-453.686) (-457.912) (-456.492) -- 0:00:55
      167000 -- (-456.029) (-454.580) [-461.670] (-457.552) * [-456.299] (-456.510) (-455.923) (-457.831) -- 0:00:54
      167500 -- (-457.130) (-453.796) (-456.196) [-456.185] * (-454.563) (-457.186) (-457.863) [-458.144] -- 0:00:54
      168000 -- (-455.845) [-454.024] (-457.392) (-455.249) * (-455.291) (-455.855) (-458.361) [-458.457] -- 0:00:54
      168500 -- [-454.818] (-458.335) (-457.099) (-456.282) * [-454.454] (-457.876) (-454.053) (-457.134) -- 0:00:54
      169000 -- (-453.692) (-454.800) [-458.567] (-458.010) * (-454.300) (-457.125) (-454.798) [-457.514] -- 0:00:54
      169500 -- (-455.749) [-454.600] (-457.425) (-455.226) * (-454.824) [-454.186] (-455.474) (-455.212) -- 0:00:53
      170000 -- (-458.186) (-456.477) [-455.402] (-453.979) * (-455.733) (-456.907) (-457.155) [-456.678] -- 0:00:53

      Average standard deviation of split frequencies: 0.023115

      170500 -- (-453.994) (-454.240) [-455.007] (-454.162) * (-456.012) (-455.691) (-457.846) [-456.486] -- 0:00:53
      171000 -- [-456.202] (-458.905) (-454.244) (-454.003) * (-454.987) (-455.351) [-455.774] (-454.985) -- 0:00:53
      171500 -- (-456.884) (-457.232) (-454.661) [-454.830] * (-455.526) [-454.878] (-457.202) (-455.961) -- 0:00:53
      172000 -- (-456.105) (-455.145) (-455.073) [-459.463] * (-461.286) (-454.920) [-458.506] (-455.385) -- 0:00:52
      172500 -- (-456.056) (-455.873) [-454.974] (-455.906) * (-454.663) (-456.043) (-454.582) [-455.098] -- 0:00:52
      173000 -- (-456.636) (-455.878) (-456.327) [-456.879] * [-457.883] (-455.252) (-454.274) (-454.881) -- 0:00:52
      173500 -- [-455.991] (-454.815) (-455.624) (-455.717) * [-455.511] (-455.199) (-454.425) (-455.327) -- 0:00:52
      174000 -- [-454.719] (-456.767) (-455.610) (-455.088) * (-461.115) (-456.005) [-454.648] (-457.563) -- 0:00:52
      174500 -- (-455.121) (-456.373) (-455.017) [-456.969] * (-454.550) (-456.976) [-455.644] (-458.241) -- 0:00:52
      175000 -- [-454.807] (-458.637) (-455.293) (-454.927) * (-457.663) (-456.412) (-454.950) [-456.291] -- 0:00:51

      Average standard deviation of split frequencies: 0.021900

      175500 -- (-458.321) (-454.249) [-456.376] (-453.947) * (-454.388) (-458.186) (-455.244) [-455.574] -- 0:00:51
      176000 -- (-456.135) (-454.688) [-454.747] (-454.541) * (-455.791) [-456.540] (-454.976) (-455.356) -- 0:00:56
      176500 -- (-455.777) (-456.348) (-458.107) [-453.957] * [-455.129] (-457.434) (-454.800) (-456.831) -- 0:00:55
      177000 -- (-459.641) (-455.348) [-454.611] (-456.377) * (-458.481) [-453.977] (-456.033) (-458.063) -- 0:00:55
      177500 -- (-457.159) [-454.149] (-458.211) (-456.344) * (-455.286) [-455.949] (-456.434) (-457.789) -- 0:00:55
      178000 -- [-453.829] (-455.420) (-456.320) (-458.591) * (-455.441) (-455.183) [-457.214] (-454.375) -- 0:00:55
      178500 -- (-456.114) (-456.100) (-456.373) [-455.168] * (-454.973) [-457.776] (-455.070) (-455.194) -- 0:00:55
      179000 -- [-456.140] (-457.111) (-454.593) (-454.665) * (-453.782) [-454.424] (-456.050) (-455.471) -- 0:00:55
      179500 -- (-455.394) (-455.275) (-455.182) [-455.147] * (-454.850) (-455.234) [-454.355] (-456.671) -- 0:00:54
      180000 -- (-455.058) [-456.648] (-456.292) (-455.888) * (-458.510) [-454.611] (-456.087) (-457.849) -- 0:00:54

      Average standard deviation of split frequencies: 0.018990

      180500 -- [-455.495] (-454.695) (-456.279) (-457.318) * (-461.581) (-454.809) (-455.931) [-454.258] -- 0:00:54
      181000 -- (-457.144) [-457.958] (-458.763) (-454.580) * (-458.251) (-458.903) (-455.444) [-456.948] -- 0:00:54
      181500 -- [-454.789] (-456.051) (-455.057) (-455.048) * (-457.347) (-455.165) (-455.686) [-454.444] -- 0:00:54
      182000 -- (-455.099) (-455.174) (-456.381) [-456.163] * [-459.855] (-457.783) (-453.910) (-458.131) -- 0:00:53
      182500 -- (-455.219) (-457.290) [-454.189] (-456.445) * [-457.761] (-459.607) (-458.398) (-454.431) -- 0:00:53
      183000 -- [-455.317] (-460.428) (-457.969) (-457.032) * [-459.365] (-458.177) (-454.439) (-454.491) -- 0:00:53
      183500 -- [-455.918] (-455.074) (-458.480) (-455.066) * (-455.803) (-454.641) [-457.591] (-459.002) -- 0:00:53
      184000 -- (-454.439) (-463.889) (-456.281) [-454.593] * (-458.829) [-456.531] (-455.604) (-456.403) -- 0:00:53
      184500 -- [-455.765] (-455.021) (-457.749) (-455.742) * (-454.111) (-456.111) (-459.493) [-457.837] -- 0:00:53
      185000 -- (-457.549) (-455.479) [-456.910] (-457.790) * (-457.275) (-455.331) [-455.653] (-456.177) -- 0:00:52

      Average standard deviation of split frequencies: 0.015460

      185500 -- (-456.661) (-455.390) (-455.930) [-461.590] * [-457.928] (-455.919) (-454.761) (-454.964) -- 0:00:52
      186000 -- (-458.658) [-456.032] (-459.712) (-457.967) * (-457.161) [-454.938] (-456.336) (-454.411) -- 0:00:52
      186500 -- (-455.085) [-455.155] (-460.165) (-456.185) * (-454.454) (-455.738) (-455.364) [-454.416] -- 0:00:52
      187000 -- [-454.312] (-456.537) (-458.449) (-456.733) * (-455.188) [-455.588] (-458.838) (-453.891) -- 0:00:52
      187500 -- (-454.582) (-457.559) (-456.936) [-459.711] * [-456.393] (-455.472) (-458.642) (-456.850) -- 0:00:52
      188000 -- (-456.290) (-454.418) [-454.854] (-457.487) * [-454.170] (-455.479) (-456.168) (-454.311) -- 0:00:51
      188500 -- (-456.354) (-455.369) [-456.857] (-458.805) * (-460.545) (-456.568) [-457.380] (-457.687) -- 0:00:51
      189000 -- (-461.946) (-455.762) [-455.829] (-455.071) * (-454.857) (-456.797) [-456.312] (-457.074) -- 0:00:51
      189500 -- (-457.222) (-456.333) (-458.915) [-454.712] * [-454.372] (-454.032) (-455.838) (-456.991) -- 0:00:51
      190000 -- (-455.343) (-457.329) (-457.787) [-456.498] * [-456.055] (-456.622) (-458.506) (-455.298) -- 0:00:51

      Average standard deviation of split frequencies: 0.013671

      190500 -- [-458.091] (-456.302) (-454.010) (-457.318) * (-456.669) [-454.567] (-454.327) (-457.693) -- 0:00:50
      191000 -- [-455.246] (-455.059) (-454.320) (-458.113) * [-458.281] (-454.971) (-455.026) (-457.666) -- 0:00:55
      191500 -- (-454.969) (-456.470) (-456.326) [-457.872] * (-458.287) (-455.613) [-456.098] (-454.087) -- 0:00:54
      192000 -- (-458.127) (-458.398) [-455.166] (-456.844) * (-455.134) [-453.918] (-456.705) (-455.705) -- 0:00:54
      192500 -- [-456.614] (-456.630) (-455.155) (-455.203) * (-456.012) (-458.421) (-458.274) [-457.035] -- 0:00:54
      193000 -- (-458.423) (-454.253) (-455.628) [-455.016] * (-456.131) [-456.922] (-455.553) (-455.496) -- 0:00:54
      193500 -- (-457.876) [-457.702] (-455.751) (-455.076) * (-456.092) (-455.456) (-455.076) [-455.494] -- 0:00:54
      194000 -- [-454.096] (-458.178) (-456.781) (-454.081) * (-461.099) (-454.691) [-455.489] (-455.130) -- 0:00:54
      194500 -- (-454.767) (-455.431) (-455.136) [-455.148] * (-459.895) (-456.344) (-454.871) [-455.758] -- 0:00:53
      195000 -- (-456.121) (-457.840) [-455.567] (-455.184) * (-455.013) (-457.354) [-454.921] (-454.718) -- 0:00:53

      Average standard deviation of split frequencies: 0.016694

      195500 -- (-454.509) (-454.132) [-454.618] (-454.275) * (-454.047) (-456.857) (-454.446) [-456.274] -- 0:00:53
      196000 -- (-455.753) (-456.178) (-455.099) [-455.551] * (-457.666) [-456.152] (-469.009) (-456.445) -- 0:00:53
      196500 -- [-454.853] (-458.176) (-457.827) (-458.528) * (-458.428) [-457.568] (-458.110) (-454.246) -- 0:00:53
      197000 -- [-455.523] (-456.446) (-455.505) (-456.046) * (-455.239) [-456.191] (-456.056) (-456.429) -- 0:00:52
      197500 -- [-455.256] (-457.575) (-456.428) (-455.383) * (-456.947) (-454.624) [-456.871] (-457.292) -- 0:00:52
      198000 -- (-455.722) [-455.066] (-460.247) (-456.814) * (-456.305) (-454.325) [-457.826] (-455.725) -- 0:00:52
      198500 -- (-454.555) (-455.974) (-455.268) [-455.043] * (-454.467) (-456.210) [-455.729] (-460.411) -- 0:00:52
      199000 -- (-455.544) [-454.797] (-454.201) (-454.981) * (-453.923) [-456.419] (-454.948) (-456.423) -- 0:00:52
      199500 -- (-456.688) [-454.954] (-457.361) (-456.225) * (-454.168) (-456.621) [-456.258] (-454.941) -- 0:00:52
      200000 -- (-461.723) (-455.239) [-455.918] (-457.253) * (-457.186) (-461.750) (-460.901) [-454.267] -- 0:00:51

      Average standard deviation of split frequencies: 0.014878

      200500 -- (-456.228) (-457.979) [-453.562] (-454.368) * [-455.465] (-456.714) (-454.320) (-456.208) -- 0:00:51
      201000 -- (-455.292) [-459.487] (-456.122) (-454.687) * [-454.840] (-458.011) (-454.437) (-456.120) -- 0:00:51
      201500 -- [-455.299] (-459.197) (-457.055) (-456.502) * [-457.318] (-455.106) (-456.556) (-457.283) -- 0:00:51
      202000 -- (-461.629) (-455.980) (-455.698) [-461.486] * (-456.684) (-455.173) [-459.374] (-458.165) -- 0:00:51
      202500 -- (-454.466) [-455.252] (-459.366) (-454.411) * (-456.503) [-455.663] (-457.795) (-458.068) -- 0:00:51
      203000 -- [-453.831] (-455.205) (-455.421) (-456.210) * (-457.526) (-456.611) [-455.566] (-457.523) -- 0:00:51
      203500 -- (-453.882) (-457.501) [-455.441] (-458.883) * (-458.305) (-457.254) [-455.731] (-459.789) -- 0:00:50
      204000 -- (-454.233) (-455.018) (-456.988) [-457.821] * (-457.725) (-457.096) [-455.903] (-454.823) -- 0:00:50
      204500 -- [-456.360] (-455.028) (-459.300) (-457.313) * (-453.558) [-456.253] (-454.106) (-454.747) -- 0:00:50
      205000 -- (-459.177) (-454.233) (-456.819) [-453.927] * (-456.667) (-457.063) (-458.491) [-453.841] -- 0:00:50

      Average standard deviation of split frequencies: 0.013008

      205500 -- (-461.780) (-457.155) (-454.282) [-455.661] * (-454.597) (-456.560) (-457.931) [-455.179] -- 0:00:50
      206000 -- (-457.701) (-453.943) [-458.081] (-454.724) * (-455.142) [-457.190] (-454.565) (-455.679) -- 0:00:50
      206500 -- (-458.366) [-455.427] (-454.669) (-454.739) * (-456.406) (-461.703) [-454.929] (-457.090) -- 0:00:49
      207000 -- (-456.061) [-454.257] (-454.517) (-453.807) * [-461.537] (-455.371) (-458.061) (-459.248) -- 0:00:53
      207500 -- (-455.639) (-455.246) (-453.991) [-456.704] * (-457.917) (-455.824) (-463.634) [-454.123] -- 0:00:53
      208000 -- (-455.714) (-456.741) [-457.235] (-455.694) * (-461.652) [-453.645] (-456.875) (-454.749) -- 0:00:53
      208500 -- (-455.326) (-455.331) [-454.990] (-455.677) * (-455.902) (-453.980) (-454.166) [-455.653] -- 0:00:53
      209000 -- (-454.685) (-456.155) [-455.907] (-456.164) * (-455.812) (-454.871) [-454.845] (-455.487) -- 0:00:52
      209500 -- (-454.361) (-454.215) [-458.763] (-455.503) * (-457.575) [-458.232] (-454.973) (-456.943) -- 0:00:52
      210000 -- (-457.387) (-454.405) [-454.490] (-458.847) * (-455.133) (-455.717) (-454.824) [-454.145] -- 0:00:52

      Average standard deviation of split frequencies: 0.013675

      210500 -- (-456.425) [-453.948] (-454.262) (-455.278) * (-454.769) (-456.113) (-454.540) [-455.995] -- 0:00:52
      211000 -- [-454.852] (-456.078) (-456.795) (-457.506) * (-458.925) [-456.144] (-456.343) (-459.726) -- 0:00:52
      211500 -- (-460.964) (-454.747) [-457.348] (-456.782) * (-455.932) (-456.772) [-457.491] (-457.589) -- 0:00:52
      212000 -- (-458.542) (-457.262) [-454.522] (-459.391) * (-455.197) [-454.302] (-454.993) (-460.010) -- 0:00:52
      212500 -- [-454.586] (-456.357) (-456.430) (-454.470) * [-464.870] (-455.762) (-454.221) (-456.823) -- 0:00:51
      213000 -- [-457.145] (-455.100) (-456.398) (-456.489) * (-459.083) [-454.912] (-460.338) (-458.869) -- 0:00:51
      213500 -- (-456.694) [-454.648] (-454.880) (-464.844) * (-457.055) (-454.462) [-455.988] (-458.990) -- 0:00:51
      214000 -- (-457.718) (-456.773) [-456.798] (-459.646) * (-455.716) (-456.610) [-455.579] (-454.701) -- 0:00:51
      214500 -- (-460.274) (-453.832) (-457.430) [-454.287] * (-457.219) [-456.432] (-455.713) (-457.965) -- 0:00:51
      215000 -- (-455.768) (-454.485) [-455.776] (-458.084) * (-456.125) (-455.065) [-458.787] (-455.060) -- 0:00:51

      Average standard deviation of split frequencies: 0.013337

      215500 -- (-454.460) [-455.783] (-458.185) (-456.387) * [-457.703] (-457.001) (-454.665) (-454.858) -- 0:00:50
      216000 -- [-453.820] (-456.171) (-457.096) (-456.841) * (-458.213) [-454.315] (-453.672) (-455.272) -- 0:00:50
      216500 -- (-455.494) (-455.178) [-458.109] (-455.928) * (-457.050) (-455.549) [-454.047] (-457.588) -- 0:00:50
      217000 -- (-456.746) (-454.458) [-456.051] (-463.378) * [-455.433] (-455.088) (-454.297) (-457.300) -- 0:00:50
      217500 -- (-459.668) [-455.154] (-455.388) (-457.741) * (-454.193) (-455.217) [-454.378] (-457.509) -- 0:00:50
      218000 -- (-455.989) (-454.668) (-456.532) [-456.296] * (-455.640) [-458.771] (-454.346) (-457.080) -- 0:00:50
      218500 -- (-455.462) (-456.154) [-456.623] (-456.999) * [-457.595] (-458.528) (-455.439) (-456.438) -- 0:00:50
      219000 -- (-458.754) (-457.553) (-454.622) [-454.160] * (-453.926) (-454.791) [-454.682] (-458.187) -- 0:00:49
      219500 -- (-461.826) [-454.700] (-454.955) (-454.247) * (-454.886) (-455.105) [-453.940] (-459.415) -- 0:00:49
      220000 -- (-455.446) (-455.549) (-456.783) [-455.696] * [-455.063] (-455.766) (-455.472) (-455.933) -- 0:00:49

      Average standard deviation of split frequencies: 0.012818

      220500 -- (-454.570) [-455.080] (-453.938) (-455.150) * (-458.683) [-454.096] (-456.690) (-458.748) -- 0:00:49
      221000 -- (-454.269) [-455.088] (-454.578) (-453.669) * [-456.890] (-453.816) (-455.502) (-457.431) -- 0:00:49
      221500 -- (-455.429) [-454.472] (-454.746) (-455.890) * [-456.301] (-456.808) (-454.423) (-456.396) -- 0:00:49
      222000 -- [-454.452] (-456.809) (-455.696) (-456.142) * (-457.877) (-456.249) [-455.392] (-459.117) -- 0:00:52
      222500 -- [-453.967] (-455.876) (-455.491) (-454.604) * (-454.789) (-456.260) (-454.542) [-461.122] -- 0:00:52
      223000 -- (-454.974) [-456.028] (-454.974) (-455.271) * (-456.294) (-456.310) (-455.711) [-455.192] -- 0:00:52
      223500 -- (-455.737) (-454.546) [-454.047] (-459.003) * (-455.088) (-457.615) (-455.880) [-454.946] -- 0:00:52
      224000 -- (-455.977) [-454.775] (-456.454) (-459.485) * [-455.928] (-457.286) (-461.170) (-458.874) -- 0:00:51
      224500 -- (-454.303) (-458.598) (-453.834) [-456.475] * (-455.294) (-457.922) [-458.109] (-458.587) -- 0:00:51
      225000 -- [-454.732] (-454.569) (-456.133) (-454.247) * (-454.718) (-457.627) (-460.692) [-455.283] -- 0:00:51

      Average standard deviation of split frequencies: 0.011588

      225500 -- (-456.268) [-454.263] (-454.465) (-456.476) * (-456.051) (-456.955) [-456.203] (-456.583) -- 0:00:51
      226000 -- (-454.769) [-457.852] (-455.898) (-455.045) * (-456.421) (-458.690) [-455.973] (-459.540) -- 0:00:51
      226500 -- [-456.215] (-454.173) (-455.140) (-455.515) * (-454.543) [-456.079] (-458.376) (-455.607) -- 0:00:51
      227000 -- [-458.098] (-457.943) (-456.089) (-453.886) * [-454.679] (-454.395) (-456.875) (-454.740) -- 0:00:51
      227500 -- (-455.251) (-455.440) (-457.285) [-455.848] * [-453.992] (-454.086) (-454.961) (-455.596) -- 0:00:50
      228000 -- [-454.971] (-456.961) (-459.801) (-457.187) * [-463.863] (-456.460) (-461.412) (-454.569) -- 0:00:50
      228500 -- (-454.535) (-455.528) [-458.769] (-456.828) * [-455.384] (-455.347) (-457.485) (-456.942) -- 0:00:50
      229000 -- (-456.637) [-456.825] (-454.678) (-457.696) * (-457.951) [-454.581] (-457.014) (-456.763) -- 0:00:50
      229500 -- [-454.784] (-456.380) (-457.836) (-455.967) * (-455.721) (-457.002) (-455.480) [-454.050] -- 0:00:50
      230000 -- (-458.678) (-457.202) [-454.884] (-457.285) * (-454.802) [-455.020] (-456.888) (-455.744) -- 0:00:50

      Average standard deviation of split frequencies: 0.011901

      230500 -- (-457.900) (-456.999) (-456.592) [-456.143] * (-457.774) (-456.573) (-454.682) [-454.631] -- 0:00:50
      231000 -- (-456.112) [-456.325] (-456.211) (-455.473) * (-456.917) [-454.330] (-456.853) (-454.535) -- 0:00:49
      231500 -- (-459.126) [-455.747] (-460.340) (-459.094) * (-461.589) (-455.769) [-456.433] (-455.088) -- 0:00:49
      232000 -- (-457.037) (-453.578) [-455.867] (-458.943) * [-458.790] (-454.950) (-458.600) (-462.143) -- 0:00:49
      232500 -- (-455.333) (-458.519) (-458.921) [-455.898] * (-458.102) (-456.589) [-454.451] (-457.317) -- 0:00:49
      233000 -- (-456.529) [-453.706] (-456.418) (-458.531) * [-458.226] (-454.565) (-455.178) (-455.314) -- 0:00:49
      233500 -- [-455.583] (-455.663) (-457.250) (-456.933) * (-454.474) [-457.044] (-457.994) (-454.674) -- 0:00:49
      234000 -- [-454.821] (-455.727) (-455.580) (-455.268) * (-455.891) (-455.702) [-455.577] (-454.715) -- 0:00:49
      234500 -- (-457.219) [-454.526] (-459.254) (-457.314) * (-456.634) [-456.045] (-456.008) (-455.852) -- 0:00:48
      235000 -- [-456.481] (-454.977) (-456.661) (-460.673) * (-453.862) (-454.597) (-456.008) [-456.496] -- 0:00:48

      Average standard deviation of split frequencies: 0.011632

      235500 -- (-456.485) [-456.761] (-454.454) (-454.977) * [-454.541] (-457.416) (-455.028) (-455.449) -- 0:00:51
      236000 -- (-454.925) [-456.677] (-454.960) (-456.420) * [-454.823] (-456.685) (-454.556) (-458.558) -- 0:00:51
      236500 -- (-457.978) (-456.564) [-455.108] (-454.221) * (-454.755) (-457.438) [-455.895] (-459.052) -- 0:00:51
      237000 -- (-456.946) (-458.957) [-454.073] (-454.461) * (-455.470) [-454.916] (-454.687) (-454.781) -- 0:00:51
      237500 -- (-458.282) (-458.010) [-455.792] (-456.924) * (-455.444) (-454.767) [-455.890] (-456.500) -- 0:00:51
      238000 -- [-454.488] (-455.121) (-454.589) (-456.085) * (-459.060) (-455.593) (-458.940) [-455.147] -- 0:00:51
      238500 -- [-455.080] (-454.792) (-454.636) (-456.011) * (-455.362) (-457.688) [-456.779] (-454.211) -- 0:00:51
      239000 -- (-456.258) (-454.568) [-457.361] (-454.522) * (-455.463) (-456.943) (-457.200) [-454.912] -- 0:00:50
      239500 -- [-453.720] (-454.111) (-455.829) (-456.126) * (-455.310) [-454.874] (-457.461) (-454.706) -- 0:00:50
      240000 -- [-453.618] (-453.978) (-456.652) (-457.469) * (-455.792) (-455.139) (-454.774) [-456.654] -- 0:00:50

      Average standard deviation of split frequencies: 0.011407

      240500 -- (-454.162) (-454.410) (-455.109) [-456.611] * [-456.125] (-456.045) (-457.428) (-457.657) -- 0:00:50
      241000 -- (-454.263) (-456.409) [-454.687] (-456.836) * [-457.175] (-455.811) (-459.916) (-455.451) -- 0:00:50
      241500 -- (-456.514) (-454.705) [-454.952] (-458.887) * [-457.250] (-456.071) (-459.170) (-454.447) -- 0:00:50
      242000 -- (-455.547) [-454.477] (-457.393) (-455.330) * [-455.639] (-456.489) (-456.324) (-454.476) -- 0:00:50
      242500 -- [-458.297] (-460.489) (-456.778) (-454.899) * (-457.204) (-457.600) (-455.545) [-454.948] -- 0:00:49
      243000 -- (-459.253) [-455.516] (-456.517) (-455.925) * [-454.738] (-458.286) (-455.863) (-455.208) -- 0:00:49
      243500 -- (-454.365) (-455.731) (-455.961) [-455.743] * (-456.052) (-457.658) [-455.763] (-455.758) -- 0:00:49
      244000 -- (-459.927) [-455.098] (-455.932) (-457.282) * (-455.676) (-455.076) [-455.611] (-455.644) -- 0:00:49
      244500 -- (-458.418) (-456.318) [-454.008] (-458.615) * (-456.920) (-456.636) [-456.540] (-454.408) -- 0:00:49
      245000 -- (-456.854) (-454.779) (-457.474) [-456.478] * (-457.921) (-456.639) [-455.006] (-454.344) -- 0:00:49

      Average standard deviation of split frequencies: 0.009222

      245500 -- (-460.086) [-454.796] (-456.888) (-455.941) * (-461.778) [-456.473] (-454.729) (-459.311) -- 0:00:49
      246000 -- (-456.053) [-458.021] (-462.628) (-454.143) * (-459.821) [-454.449] (-455.731) (-460.694) -- 0:00:49
      246500 -- (-456.656) [-458.209] (-457.302) (-454.146) * [-454.752] (-455.317) (-455.455) (-454.114) -- 0:00:48
      247000 -- (-455.888) (-455.907) (-458.256) [-456.792] * [-454.722] (-455.058) (-457.451) (-456.237) -- 0:00:48
      247500 -- [-456.166] (-454.350) (-459.252) (-456.730) * [-454.469] (-456.720) (-455.440) (-458.918) -- 0:00:48
      248000 -- (-456.758) (-460.593) [-457.472] (-456.135) * [-457.392] (-455.836) (-454.554) (-454.819) -- 0:00:48
      248500 -- (-455.748) (-457.542) (-454.799) [-454.923] * (-455.658) [-454.380] (-457.127) (-454.894) -- 0:00:48
      249000 -- (-456.645) (-455.826) [-454.848] (-459.914) * (-456.788) [-456.599] (-454.195) (-455.481) -- 0:00:48
      249500 -- (-455.804) [-455.888] (-455.653) (-457.723) * (-454.082) (-456.736) [-457.752] (-454.348) -- 0:00:48
      250000 -- [-456.112] (-456.634) (-457.509) (-455.259) * [-454.394] (-459.314) (-456.955) (-455.229) -- 0:00:48

      Average standard deviation of split frequencies: 0.007640

      250500 -- (-454.585) (-458.792) (-454.020) [-456.190] * (-453.789) (-456.325) [-457.248] (-455.614) -- 0:00:47
      251000 -- (-455.821) (-454.418) (-454.197) [-459.036] * [-460.290] (-456.928) (-454.647) (-455.013) -- 0:00:47
      251500 -- (-455.035) [-462.302] (-454.921) (-456.433) * (-456.527) (-457.831) (-464.407) [-455.135] -- 0:00:50
      252000 -- [-454.879] (-459.444) (-455.011) (-456.552) * [-455.308] (-453.828) (-465.493) (-456.687) -- 0:00:50
      252500 -- [-454.705] (-455.187) (-455.308) (-454.662) * [-454.502] (-455.515) (-458.256) (-456.521) -- 0:00:50
      253000 -- (-460.840) (-457.625) (-456.614) [-457.383] * (-454.450) [-454.354] (-456.279) (-455.443) -- 0:00:50
      253500 -- (-458.660) [-454.797] (-455.840) (-458.092) * (-457.045) (-455.238) (-455.419) [-455.942] -- 0:00:50
      254000 -- (-455.766) [-454.387] (-455.592) (-455.488) * (-454.042) (-454.330) (-455.025) [-455.526] -- 0:00:49
      254500 -- (-457.279) [-455.922] (-455.025) (-455.134) * (-454.626) [-454.760] (-454.141) (-456.331) -- 0:00:49
      255000 -- (-462.516) (-458.548) (-456.152) [-455.924] * (-455.056) (-455.149) [-453.993] (-456.440) -- 0:00:49

      Average standard deviation of split frequencies: 0.006875

      255500 -- (-455.782) [-455.601] (-462.430) (-456.882) * [-454.742] (-455.588) (-454.380) (-455.634) -- 0:00:49
      256000 -- [-454.214] (-458.541) (-457.836) (-458.235) * (-457.024) (-455.771) [-454.479] (-456.430) -- 0:00:49
      256500 -- (-456.717) (-455.329) [-454.591] (-457.381) * (-455.404) (-457.547) [-455.307] (-455.873) -- 0:00:49
      257000 -- [-454.746] (-459.936) (-455.345) (-456.805) * (-454.976) (-454.800) (-455.243) [-455.931] -- 0:00:49
      257500 -- [-456.188] (-455.055) (-458.708) (-457.018) * (-455.658) [-455.184] (-457.211) (-457.040) -- 0:00:49
      258000 -- (-456.574) (-455.396) [-454.484] (-455.694) * (-457.615) [-455.021] (-454.392) (-455.099) -- 0:00:48
      258500 -- (-457.157) (-456.194) [-454.328] (-454.796) * (-456.703) (-456.172) (-453.998) [-456.436] -- 0:00:48
      259000 -- [-455.373] (-454.190) (-455.075) (-454.605) * [-455.730] (-456.170) (-455.148) (-456.808) -- 0:00:48
      259500 -- (-457.910) (-455.834) (-455.531) [-455.946] * (-459.154) (-456.696) [-455.033] (-455.528) -- 0:00:48
      260000 -- [-454.551] (-456.137) (-454.849) (-455.119) * (-454.725) (-454.584) (-455.604) [-457.972] -- 0:00:48

      Average standard deviation of split frequencies: 0.006993

      260500 -- [-454.985] (-456.314) (-455.168) (-457.268) * [-456.060] (-454.110) (-458.111) (-457.409) -- 0:00:48
      261000 -- (-456.601) (-455.818) [-457.391] (-457.835) * (-461.681) (-458.619) (-456.316) [-454.165] -- 0:00:48
      261500 -- (-455.802) [-453.800] (-454.023) (-455.142) * (-456.583) [-455.749] (-459.708) (-455.495) -- 0:00:48
      262000 -- (-456.686) [-454.724] (-454.770) (-458.851) * (-454.884) (-458.390) (-457.561) [-455.785] -- 0:00:47
      262500 -- (-456.500) (-455.772) [-453.896] (-454.605) * (-456.175) (-455.034) (-456.249) [-456.649] -- 0:00:47
      263000 -- (-459.390) [-454.729] (-454.932) (-456.524) * (-454.040) (-459.735) [-454.922] (-455.881) -- 0:00:47
      263500 -- (-459.721) [-454.242] (-454.931) (-459.277) * (-454.669) (-461.103) [-454.436] (-456.645) -- 0:00:47
      264000 -- [-454.612] (-454.578) (-458.376) (-455.458) * (-457.086) (-454.342) [-454.117] (-455.731) -- 0:00:47
      264500 -- (-454.482) (-457.989) [-457.034] (-454.260) * (-455.611) (-457.900) [-454.307] (-458.551) -- 0:00:47
      265000 -- (-455.949) (-457.839) (-455.288) [-454.469] * (-458.928) [-456.838] (-456.223) (-460.694) -- 0:00:47

      Average standard deviation of split frequencies: 0.007193

      265500 -- [-455.573] (-455.428) (-454.945) (-457.852) * (-457.392) (-456.572) (-460.085) [-454.341] -- 0:00:47
      266000 -- (-455.952) [-455.025] (-454.089) (-453.942) * [-455.831] (-459.020) (-458.343) (-456.796) -- 0:00:46
      266500 -- (-458.393) [-456.328] (-457.160) (-454.793) * [-455.545] (-459.390) (-456.937) (-455.336) -- 0:00:46
      267000 -- (-456.230) (-456.327) (-456.629) [-455.716] * (-458.205) (-456.129) [-459.709] (-455.731) -- 0:00:46
      267500 -- [-456.278] (-455.160) (-455.921) (-454.682) * (-459.807) (-456.072) [-454.895] (-455.381) -- 0:00:49
      268000 -- (-455.382) (-455.306) [-455.310] (-456.570) * (-461.141) (-454.512) (-454.490) [-458.187] -- 0:00:49
      268500 -- (-455.968) (-455.739) [-455.816] (-455.690) * [-456.209] (-455.694) (-454.708) (-458.831) -- 0:00:49
      269000 -- (-456.277) (-457.572) (-455.070) [-456.069] * [-455.382] (-456.674) (-458.443) (-458.592) -- 0:00:48
      269500 -- (-456.438) (-460.042) [-456.673] (-462.601) * [-458.631] (-456.338) (-457.607) (-458.160) -- 0:00:48
      270000 -- [-456.834] (-457.265) (-461.335) (-458.561) * (-456.689) (-456.762) [-456.142] (-454.921) -- 0:00:48

      Average standard deviation of split frequencies: 0.007069

      270500 -- (-455.039) (-458.548) (-454.104) [-455.170] * (-454.812) [-457.147] (-454.222) (-455.907) -- 0:00:48
      271000 -- [-454.801] (-454.642) (-458.346) (-455.880) * (-455.506) [-456.578] (-458.534) (-457.753) -- 0:00:48
      271500 -- (-454.507) (-456.437) (-456.170) [-458.204] * (-457.091) (-455.084) [-454.604] (-456.834) -- 0:00:48
      272000 -- (-455.869) [-454.158] (-454.213) (-458.906) * (-459.061) (-456.206) (-457.525) [-454.188] -- 0:00:48
      272500 -- (-457.496) (-453.848) (-454.281) [-453.955] * (-458.270) [-456.584] (-455.567) (-454.117) -- 0:00:48
      273000 -- (-456.420) (-455.901) (-456.449) [-454.188] * (-454.976) (-459.656) (-456.029) [-454.117] -- 0:00:47
      273500 -- (-458.689) (-459.608) [-458.163] (-454.600) * [-456.127] (-456.623) (-457.232) (-455.916) -- 0:00:47
      274000 -- [-456.603] (-455.156) (-455.214) (-455.253) * [-457.565] (-457.874) (-459.414) (-456.360) -- 0:00:47
      274500 -- (-457.076) (-454.798) (-460.167) [-457.099] * (-456.709) (-457.771) [-457.887] (-456.408) -- 0:00:47
      275000 -- [-459.782] (-456.559) (-454.752) (-454.426) * (-455.771) (-458.059) [-456.580] (-459.288) -- 0:00:47

      Average standard deviation of split frequencies: 0.007033

      275500 -- (-457.529) [-454.746] (-455.484) (-457.236) * (-458.831) [-453.856] (-454.566) (-457.796) -- 0:00:47
      276000 -- (-455.326) (-454.671) (-456.056) [-456.623] * (-455.724) [-457.046] (-455.680) (-457.517) -- 0:00:47
      276500 -- (-455.590) (-457.692) [-454.590] (-456.292) * (-455.393) (-456.355) (-455.964) [-455.822] -- 0:00:47
      277000 -- (-459.006) (-459.692) (-457.164) [-455.209] * (-457.382) (-454.541) (-455.070) [-457.726] -- 0:00:46
      277500 -- (-456.073) (-460.671) [-456.696] (-457.225) * (-460.208) [-453.977] (-457.099) (-461.467) -- 0:00:46
      278000 -- (-454.342) (-454.924) [-455.555] (-456.298) * (-455.507) (-455.437) [-456.308] (-463.454) -- 0:00:46
      278500 -- (-454.514) (-455.785) [-454.226] (-454.414) * (-456.466) (-456.078) (-458.266) [-458.084] -- 0:00:46
      279000 -- [-454.531] (-455.136) (-455.218) (-456.569) * (-454.750) [-455.882] (-457.604) (-454.396) -- 0:00:46
      279500 -- (-456.317) [-456.119] (-458.078) (-454.752) * (-455.911) (-454.105) [-456.383] (-457.735) -- 0:00:46
      280000 -- [-454.673] (-456.850) (-455.761) (-456.271) * (-457.148) [-454.774] (-457.904) (-457.447) -- 0:00:46

      Average standard deviation of split frequencies: 0.006323

      280500 -- (-457.190) (-454.987) [-457.337] (-456.675) * (-454.623) (-455.265) (-456.404) [-456.045] -- 0:00:46
      281000 -- (-458.595) (-453.919) [-455.687] (-454.601) * (-457.697) [-454.668] (-458.362) (-454.596) -- 0:00:46
      281500 -- [-453.905] (-454.675) (-454.422) (-454.519) * (-457.410) [-455.502] (-456.963) (-453.992) -- 0:00:48
      282000 -- (-455.653) [-454.658] (-459.362) (-456.820) * [-457.033] (-457.870) (-455.500) (-454.615) -- 0:00:48
      282500 -- (-454.861) (-457.283) [-456.776] (-459.516) * (-457.130) (-457.569) (-458.142) [-457.658] -- 0:00:48
      283000 -- (-456.484) (-454.319) (-455.854) [-455.493] * (-455.671) (-453.995) (-455.773) [-455.190] -- 0:00:48
      283500 -- (-454.700) (-455.758) (-462.984) [-457.434] * (-454.557) (-456.493) [-455.408] (-457.438) -- 0:00:48
      284000 -- (-455.095) (-456.743) (-458.958) [-459.896] * (-455.779) [-455.557] (-454.091) (-457.692) -- 0:00:47
      284500 -- (-456.522) (-456.273) (-458.073) [-455.639] * (-456.441) [-456.449] (-458.932) (-454.626) -- 0:00:47
      285000 -- (-454.680) (-454.571) (-457.487) [-457.318] * [-456.432] (-458.948) (-455.288) (-455.079) -- 0:00:47

      Average standard deviation of split frequencies: 0.006302

      285500 -- (-455.017) (-454.287) (-458.561) [-457.425] * (-454.155) (-456.063) (-456.078) [-456.670] -- 0:00:47
      286000 -- (-455.475) (-454.513) [-455.130] (-455.738) * (-454.714) [-454.333] (-455.771) (-454.423) -- 0:00:47
      286500 -- (-456.476) (-455.255) (-454.843) [-455.298] * (-456.424) (-454.679) (-453.812) [-454.144] -- 0:00:47
      287000 -- [-456.758] (-454.413) (-456.147) (-454.982) * (-458.187) (-454.622) (-457.625) [-455.174] -- 0:00:47
      287500 -- (-454.721) (-456.819) (-459.715) [-457.265] * (-454.948) (-457.369) [-455.084] (-455.876) -- 0:00:47
      288000 -- [-456.933] (-455.696) (-465.760) (-454.114) * [-453.639] (-456.914) (-454.699) (-455.203) -- 0:00:46
      288500 -- (-458.960) (-456.387) (-457.587) [-454.680] * (-455.903) (-456.283) (-458.062) [-455.087] -- 0:00:46
      289000 -- [-455.181] (-455.587) (-454.788) (-454.295) * (-457.708) (-456.285) [-457.689] (-456.311) -- 0:00:46
      289500 -- (-458.000) (-454.207) (-455.272) [-456.814] * (-457.640) (-454.430) (-457.435) [-455.356] -- 0:00:46
      290000 -- (-455.364) [-455.527] (-457.347) (-454.620) * [-457.014] (-454.038) (-458.030) (-454.663) -- 0:00:46

      Average standard deviation of split frequencies: 0.006296

      290500 -- (-456.905) (-455.784) [-455.328] (-455.153) * (-454.430) (-457.268) [-455.437] (-453.993) -- 0:00:46
      291000 -- [-454.959] (-454.694) (-454.382) (-454.700) * (-455.429) (-455.269) (-456.407) [-454.107] -- 0:00:46
      291500 -- [-455.769] (-455.590) (-455.091) (-454.947) * (-454.915) (-455.134) [-455.497] (-454.055) -- 0:00:46
      292000 -- [-456.344] (-454.542) (-454.784) (-454.212) * (-454.737) (-454.258) [-456.184] (-455.601) -- 0:00:46
      292500 -- (-454.038) (-460.379) (-456.652) [-457.700] * (-454.912) (-458.018) [-458.735] (-457.325) -- 0:00:45
      293000 -- (-458.176) [-454.161] (-454.846) (-453.995) * (-454.973) (-457.520) [-455.918] (-456.172) -- 0:00:45
      293500 -- [-455.865] (-456.069) (-456.195) (-456.807) * [-454.600] (-455.612) (-456.602) (-454.585) -- 0:00:45
      294000 -- [-457.448] (-454.244) (-454.762) (-454.088) * (-456.847) (-457.092) [-457.882] (-458.801) -- 0:00:45
      294500 -- (-463.402) (-455.412) (-454.795) [-454.636] * (-456.658) (-455.268) [-455.241] (-457.338) -- 0:00:45
      295000 -- [-456.293] (-456.635) (-454.863) (-455.653) * [-456.480] (-454.984) (-454.485) (-459.545) -- 0:00:45

      Average standard deviation of split frequencies: 0.006464

      295500 -- [-456.985] (-456.893) (-455.070) (-454.966) * [-456.959] (-456.338) (-456.067) (-457.847) -- 0:00:45
      296000 -- (-457.436) [-454.806] (-456.299) (-459.547) * (-455.712) (-457.505) [-455.350] (-455.231) -- 0:00:45
      296500 -- (-454.731) [-455.545] (-455.827) (-460.978) * (-454.919) [-455.339] (-456.083) (-460.182) -- 0:00:47
      297000 -- [-456.278] (-455.873) (-457.467) (-456.208) * [-458.786] (-458.343) (-464.389) (-456.517) -- 0:00:47
      297500 -- (-458.642) (-454.273) (-457.258) [-457.960] * (-454.615) (-455.787) (-463.901) [-456.122] -- 0:00:47
      298000 -- [-457.623] (-456.646) (-456.499) (-457.166) * [-458.566] (-454.009) (-458.767) (-454.842) -- 0:00:47
      298500 -- [-456.110] (-454.421) (-456.071) (-461.196) * (-457.349) [-455.602] (-453.745) (-456.854) -- 0:00:47
      299000 -- (-454.034) [-456.351] (-456.176) (-453.554) * [-456.077] (-454.331) (-460.443) (-454.312) -- 0:00:46
      299500 -- (-456.173) (-454.757) [-456.348] (-453.859) * (-454.433) (-456.721) (-461.167) [-458.016] -- 0:00:46
      300000 -- (-453.934) (-455.929) [-454.845] (-454.848) * (-455.179) (-464.993) [-456.401] (-457.196) -- 0:00:46

      Average standard deviation of split frequencies: 0.007563

      300500 -- (-454.842) (-455.935) (-455.368) [-455.190] * (-458.366) [-460.261] (-454.716) (-461.899) -- 0:00:46
      301000 -- (-458.810) (-455.940) (-454.847) [-456.419] * (-454.526) (-458.768) [-455.092] (-455.806) -- 0:00:46
      301500 -- (-455.428) (-456.029) (-454.687) [-454.845] * (-455.629) (-458.869) (-458.288) [-455.123] -- 0:00:46
      302000 -- [-456.085] (-455.459) (-456.313) (-455.456) * (-453.823) (-462.499) [-454.387] (-454.833) -- 0:00:46
      302500 -- (-454.289) (-454.822) [-457.682] (-455.904) * [-454.937] (-460.276) (-455.797) (-458.906) -- 0:00:46
      303000 -- [-455.864] (-457.621) (-454.644) (-456.828) * (-455.613) (-454.251) [-456.603] (-457.814) -- 0:00:46
      303500 -- (-456.493) [-455.155] (-454.116) (-456.407) * (-455.581) [-454.871] (-455.634) (-454.878) -- 0:00:45
      304000 -- [-454.703] (-453.851) (-454.899) (-455.978) * (-457.663) [-457.006] (-456.046) (-455.034) -- 0:00:45
      304500 -- [-456.067] (-454.537) (-454.770) (-461.385) * (-457.151) [-453.763] (-455.158) (-454.649) -- 0:00:45
      305000 -- (-453.957) (-455.339) [-455.719] (-459.115) * (-459.262) (-455.737) [-457.051] (-453.883) -- 0:00:45

      Average standard deviation of split frequencies: 0.008609

      305500 -- (-455.374) [-456.491] (-459.236) (-455.958) * [-456.513] (-457.177) (-454.326) (-456.105) -- 0:00:45
      306000 -- (-457.621) (-455.073) [-455.529] (-459.410) * (-457.076) [-454.925] (-454.852) (-457.164) -- 0:00:45
      306500 -- (-455.163) (-454.182) [-457.526] (-455.517) * (-454.253) (-459.218) (-454.035) [-454.900] -- 0:00:45
      307000 -- (-453.647) (-455.894) (-456.494) [-455.771] * (-455.663) [-455.164] (-453.579) (-458.392) -- 0:00:45
      307500 -- (-463.359) [-457.003] (-455.942) (-459.424) * [-454.954] (-456.150) (-455.224) (-463.002) -- 0:00:45
      308000 -- [-454.228] (-454.360) (-455.936) (-454.739) * (-458.604) (-454.718) [-455.849] (-454.274) -- 0:00:44
      308500 -- (-456.403) (-453.609) (-454.737) [-455.628] * (-454.177) (-457.770) [-453.979] (-458.884) -- 0:00:44
      309000 -- (-455.305) (-453.900) (-457.343) [-456.867] * (-454.476) (-456.261) [-456.028] (-455.761) -- 0:00:44
      309500 -- (-456.134) (-453.953) [-455.219] (-455.083) * [-456.863] (-454.134) (-456.135) (-454.434) -- 0:00:44
      310000 -- (-455.041) (-454.436) [-456.017] (-456.589) * (-458.842) (-454.462) (-455.309) [-453.765] -- 0:00:44

      Average standard deviation of split frequencies: 0.009372

      310500 -- [-456.824] (-456.258) (-457.309) (-459.501) * (-462.002) [-454.704] (-456.096) (-453.888) -- 0:00:44
      311000 -- (-453.968) [-456.726] (-457.813) (-454.163) * [-457.542] (-454.588) (-456.914) (-455.464) -- 0:00:44
      311500 -- (-454.481) [-454.740] (-454.551) (-454.389) * (-456.596) (-454.987) (-457.142) [-456.817] -- 0:00:44
      312000 -- (-455.636) (-457.598) [-454.342] (-456.498) * (-453.704) [-455.012] (-457.457) (-456.931) -- 0:00:46
      312500 -- (-454.850) [-458.124] (-455.664) (-458.529) * (-453.754) (-455.662) (-457.827) [-454.399] -- 0:00:46
      313000 -- (-454.646) (-457.214) [-454.793] (-458.708) * (-457.632) [-454.549] (-455.463) (-455.683) -- 0:00:46
      313500 -- (-455.628) (-457.231) (-457.986) [-455.486] * (-456.548) [-455.725] (-455.381) (-454.124) -- 0:00:45
      314000 -- (-459.042) (-455.510) (-454.898) [-455.217] * (-457.579) [-456.329] (-458.265) (-455.239) -- 0:00:45
      314500 -- (-457.592) (-454.849) [-455.378] (-457.053) * (-457.817) [-453.885] (-458.310) (-453.677) -- 0:00:45
      315000 -- (-455.613) (-455.196) [-455.433] (-455.019) * (-455.492) (-456.679) (-455.906) [-456.523] -- 0:00:45

      Average standard deviation of split frequencies: 0.009389

      315500 -- [-454.518] (-454.936) (-454.776) (-455.754) * (-455.841) (-455.630) [-454.499] (-455.699) -- 0:00:45
      316000 -- [-453.958] (-454.048) (-454.459) (-455.792) * (-454.873) (-456.034) (-454.202) [-454.011] -- 0:00:45
      316500 -- (-455.526) [-456.266] (-454.104) (-455.998) * (-455.550) (-455.577) [-454.779] (-455.172) -- 0:00:45
      317000 -- (-454.751) (-460.399) [-456.134] (-457.338) * (-458.404) (-454.438) [-458.001] (-460.021) -- 0:00:45
      317500 -- [-458.020] (-457.566) (-460.874) (-456.596) * [-454.452] (-454.243) (-456.511) (-459.989) -- 0:00:45
      318000 -- (-455.674) (-460.520) [-453.668] (-455.854) * (-458.875) (-454.019) (-457.026) [-455.523] -- 0:00:45
      318500 -- (-456.776) (-456.465) [-455.405] (-457.981) * (-454.638) (-455.477) [-457.452] (-455.274) -- 0:00:44
      319000 -- (-453.699) (-455.435) (-455.282) [-454.432] * (-457.842) (-455.416) (-454.805) [-455.271] -- 0:00:44
      319500 -- (-455.405) (-454.341) [-454.918] (-454.834) * (-455.994) (-456.300) [-454.047] (-455.875) -- 0:00:44
      320000 -- (-454.959) (-455.430) [-455.022] (-455.568) * [-455.011] (-455.870) (-455.599) (-455.717) -- 0:00:44

      Average standard deviation of split frequencies: 0.009555

      320500 -- (-459.930) [-457.109] (-455.838) (-454.374) * [-455.084] (-455.532) (-455.466) (-454.182) -- 0:00:44
      321000 -- (-457.832) [-455.778] (-454.366) (-454.953) * (-454.464) (-455.544) [-455.700] (-456.102) -- 0:00:44
      321500 -- (-458.127) (-455.354) (-454.668) [-454.251] * [-456.284] (-457.499) (-455.644) (-454.505) -- 0:00:44
      322000 -- (-457.270) (-454.929) (-455.611) [-455.359] * (-459.297) (-456.035) [-455.753] (-459.887) -- 0:00:44
      322500 -- [-454.918] (-455.009) (-454.358) (-454.314) * (-453.755) (-460.134) (-455.942) [-456.351] -- 0:00:44
      323000 -- (-453.847) (-457.364) (-453.728) [-459.518] * (-454.613) (-457.044) (-463.599) [-459.249] -- 0:00:44
      323500 -- (-454.033) (-456.974) [-455.257] (-454.990) * (-453.881) (-455.149) [-455.013] (-462.888) -- 0:00:43
      324000 -- (-457.937) [-457.316] (-455.288) (-456.634) * (-456.711) (-456.408) [-456.502] (-454.546) -- 0:00:43
      324500 -- [-455.788] (-454.390) (-457.348) (-455.557) * (-455.375) [-457.414] (-457.581) (-455.015) -- 0:00:43
      325000 -- (-456.545) (-454.509) [-459.172] (-456.494) * (-454.167) (-454.832) [-455.059] (-454.066) -- 0:00:43

      Average standard deviation of split frequencies: 0.010936

      325500 -- (-460.376) (-458.288) (-456.866) [-456.379] * (-458.164) (-458.875) [-455.819] (-455.419) -- 0:00:43
      326000 -- (-460.571) (-460.256) [-454.293] (-456.863) * (-455.012) (-456.903) [-456.885] (-454.471) -- 0:00:43
      326500 -- (-460.058) [-457.803] (-454.768) (-458.130) * [-454.795] (-456.202) (-454.641) (-454.978) -- 0:00:43
      327000 -- (-463.077) (-455.281) (-455.167) [-456.526] * [-458.906] (-454.747) (-454.953) (-455.409) -- 0:00:43
      327500 -- (-454.900) [-456.981] (-457.925) (-459.186) * (-456.198) (-454.009) [-455.848] (-454.985) -- 0:00:45
      328000 -- [-454.709] (-455.385) (-456.181) (-457.982) * (-455.709) (-454.309) (-456.864) [-455.715] -- 0:00:45
      328500 -- (-457.979) (-456.554) (-455.573) [-455.588] * [-455.937] (-455.512) (-457.800) (-456.941) -- 0:00:44
      329000 -- (-458.088) [-453.622] (-453.936) (-455.544) * (-456.440) (-458.230) (-457.562) [-455.035] -- 0:00:44
      329500 -- (-457.677) (-458.935) [-457.156] (-455.627) * (-455.584) [-454.438] (-454.607) (-454.218) -- 0:00:44
      330000 -- [-453.881] (-456.504) (-455.407) (-453.855) * [-454.939] (-454.792) (-459.513) (-456.202) -- 0:00:44

      Average standard deviation of split frequencies: 0.010158

      330500 -- [-453.787] (-454.768) (-457.774) (-459.477) * (-456.541) (-457.488) [-458.473] (-456.327) -- 0:00:44
      331000 -- (-456.274) (-459.153) (-461.265) [-459.511] * (-457.191) (-457.781) [-458.121] (-455.741) -- 0:00:44
      331500 -- (-455.229) (-455.932) [-454.646] (-456.662) * (-455.733) (-459.397) [-457.811] (-462.007) -- 0:00:44
      332000 -- (-457.897) (-457.047) [-456.048] (-455.745) * (-455.923) (-459.013) [-454.888] (-456.043) -- 0:00:44
      332500 -- (-454.212) (-454.834) (-455.331) [-456.420] * [-455.795] (-459.132) (-455.360) (-456.515) -- 0:00:44
      333000 -- (-455.340) (-462.075) (-453.964) [-454.395] * (-461.999) (-459.825) (-454.989) [-455.157] -- 0:00:44
      333500 -- (-455.914) (-454.866) [-455.333] (-458.880) * (-456.903) (-455.749) (-458.377) [-457.271] -- 0:00:43
      334000 -- (-455.859) (-455.127) [-455.546] (-459.084) * (-455.804) (-456.454) (-459.001) [-455.747] -- 0:00:43
      334500 -- [-459.526] (-455.269) (-455.867) (-455.932) * (-455.303) (-457.155) [-454.338] (-456.517) -- 0:00:43
      335000 -- [-454.225] (-456.164) (-461.636) (-455.605) * (-456.257) (-458.858) (-454.643) [-456.296] -- 0:00:43

      Average standard deviation of split frequencies: 0.010564

      335500 -- (-455.307) [-455.409] (-454.736) (-455.325) * (-459.182) (-456.145) (-457.096) [-455.594] -- 0:00:43
      336000 -- [-455.651] (-454.946) (-459.884) (-455.421) * (-455.304) [-456.924] (-455.181) (-454.964) -- 0:00:43
      336500 -- (-459.738) (-455.420) [-454.529] (-453.692) * (-454.717) [-455.168] (-460.225) (-457.164) -- 0:00:43
      337000 -- (-458.160) (-456.224) [-453.816] (-459.000) * [-453.533] (-460.423) (-456.822) (-455.813) -- 0:00:43
      337500 -- [-456.162] (-457.802) (-454.955) (-456.864) * (-455.921) [-459.131] (-460.756) (-454.715) -- 0:00:43
      338000 -- (-456.917) [-456.545] (-458.270) (-454.067) * (-458.071) [-454.423] (-454.579) (-454.167) -- 0:00:43
      338500 -- [-457.469] (-456.123) (-458.340) (-458.167) * (-456.998) (-456.903) (-456.002) [-455.948] -- 0:00:42
      339000 -- (-455.425) (-456.015) (-458.762) [-458.038] * (-453.964) (-455.338) [-455.354] (-456.684) -- 0:00:42
      339500 -- (-457.628) [-456.884] (-456.723) (-460.613) * (-456.039) [-455.913] (-454.705) (-455.132) -- 0:00:42
      340000 -- [-456.084] (-454.555) (-454.827) (-458.459) * [-456.853] (-455.731) (-453.797) (-454.552) -- 0:00:42

      Average standard deviation of split frequencies: 0.010984

      340500 -- [-455.760] (-456.869) (-456.488) (-456.261) * (-455.005) (-454.230) [-458.531] (-457.517) -- 0:00:42
      341000 -- (-454.063) (-454.494) (-456.596) [-454.637] * (-453.665) [-459.555] (-459.247) (-457.432) -- 0:00:42
      341500 -- (-459.916) [-453.912] (-455.391) (-456.518) * [-454.724] (-456.589) (-455.619) (-458.770) -- 0:00:42
      342000 -- (-461.409) (-456.104) (-454.380) [-459.995] * [-455.494] (-455.494) (-454.645) (-457.240) -- 0:00:42
      342500 -- (-460.549) (-455.092) [-456.156] (-461.841) * (-455.621) (-453.635) [-457.033] (-456.142) -- 0:00:42
      343000 -- [-454.690] (-459.339) (-455.340) (-462.381) * (-458.156) [-454.239] (-463.939) (-454.767) -- 0:00:44
      343500 -- (-458.581) (-457.960) [-455.270] (-460.262) * [-454.165] (-455.768) (-455.941) (-456.785) -- 0:00:43
      344000 -- (-456.655) (-454.867) [-456.233] (-456.184) * [-457.656] (-455.644) (-456.529) (-455.721) -- 0:00:43
      344500 -- (-454.465) (-457.025) (-455.043) [-456.516] * [-456.804] (-457.064) (-457.892) (-459.303) -- 0:00:43
      345000 -- (-457.146) (-457.032) [-453.944] (-455.737) * (-458.616) [-454.491] (-457.924) (-455.854) -- 0:00:43

      Average standard deviation of split frequencies: 0.010980

      345500 -- (-460.650) [-454.352] (-454.250) (-455.895) * (-455.262) [-456.086] (-462.350) (-456.732) -- 0:00:43
      346000 -- (-461.402) (-456.552) [-454.523] (-458.442) * [-454.132] (-458.841) (-454.828) (-455.336) -- 0:00:43
      346500 -- (-465.098) [-455.943] (-455.374) (-457.978) * (-456.166) (-457.842) [-455.545] (-454.111) -- 0:00:43
      347000 -- (-455.944) (-457.291) [-457.063] (-456.197) * (-454.685) (-456.236) [-454.715] (-455.627) -- 0:00:43
      347500 -- (-458.029) (-457.174) [-454.526] (-455.846) * (-456.441) (-457.297) (-454.335) [-457.416] -- 0:00:43
      348000 -- [-456.101] (-455.277) (-457.439) (-456.971) * (-455.364) (-456.626) [-455.185] (-455.188) -- 0:00:43
      348500 -- (-456.667) (-454.965) [-455.512] (-454.145) * [-458.291] (-455.146) (-458.726) (-454.559) -- 0:00:42
      349000 -- (-457.057) [-455.715] (-457.683) (-457.899) * (-458.770) [-454.613] (-456.542) (-457.192) -- 0:00:42
      349500 -- (-456.434) (-455.205) (-454.804) [-454.899] * (-458.495) (-454.235) [-457.008] (-456.843) -- 0:00:42
      350000 -- (-460.264) (-455.575) [-456.826] (-455.583) * (-454.429) (-457.272) (-457.068) [-455.615] -- 0:00:42

      Average standard deviation of split frequencies: 0.011007

      350500 -- (-460.700) (-457.208) (-454.686) [-455.116] * (-455.394) (-454.457) (-456.653) [-455.112] -- 0:00:42
      351000 -- (-455.367) (-456.150) [-455.327] (-454.345) * (-455.840) (-456.303) (-455.959) [-456.876] -- 0:00:42
      351500 -- (-460.762) (-457.867) [-455.666] (-455.911) * (-455.404) [-456.860] (-455.183) (-455.774) -- 0:00:42
      352000 -- (-460.702) (-458.717) (-454.369) [-454.799] * [-456.350] (-455.219) (-457.747) (-456.841) -- 0:00:42
      352500 -- (-453.898) [-457.444] (-457.829) (-454.031) * (-458.638) (-458.186) [-457.882] (-457.355) -- 0:00:42
      353000 -- (-456.792) (-456.076) [-454.057] (-455.230) * (-455.069) (-455.102) [-456.436] (-459.321) -- 0:00:42
      353500 -- [-454.715] (-456.027) (-455.057) (-454.391) * (-456.031) (-455.072) [-457.444] (-459.408) -- 0:00:42
      354000 -- (-461.528) (-456.342) [-456.479] (-455.763) * (-455.319) (-454.278) [-460.204] (-457.563) -- 0:00:41
      354500 -- (-458.166) (-456.894) (-457.917) [-454.224] * (-454.889) [-455.385] (-454.153) (-456.221) -- 0:00:41
      355000 -- (-455.083) (-453.826) (-454.662) [-455.581] * (-454.963) (-457.827) [-456.161] (-459.121) -- 0:00:41

      Average standard deviation of split frequencies: 0.010180

      355500 -- (-456.326) (-456.449) [-454.836] (-459.454) * (-458.545) [-459.381] (-454.878) (-455.256) -- 0:00:41
      356000 -- [-454.209] (-457.499) (-455.650) (-456.316) * (-454.275) (-458.156) [-455.237] (-453.946) -- 0:00:41
      356500 -- (-456.259) (-456.978) [-455.738] (-455.032) * (-457.896) [-454.214] (-457.700) (-455.100) -- 0:00:41
      357000 -- [-455.391] (-457.446) (-456.266) (-456.424) * [-458.183] (-456.188) (-455.709) (-456.670) -- 0:00:43
      357500 -- [-454.613] (-456.128) (-456.782) (-454.638) * (-454.765) (-453.768) [-456.676] (-454.679) -- 0:00:43
      358000 -- (-454.581) (-454.742) (-457.361) [-454.502] * (-455.397) (-457.257) [-459.481] (-454.909) -- 0:00:43
      358500 -- (-459.526) (-455.180) (-460.979) [-455.378] * (-456.831) (-458.692) [-457.644] (-453.852) -- 0:00:42
      359000 -- (-455.922) (-455.074) [-454.331] (-458.140) * (-455.799) (-455.765) [-457.657] (-454.155) -- 0:00:42
      359500 -- (-458.806) (-454.955) (-459.062) [-454.419] * (-454.453) (-456.625) [-456.534] (-453.950) -- 0:00:42
      360000 -- (-455.737) (-459.076) (-462.858) [-457.276] * (-454.576) (-457.468) (-458.672) [-455.065] -- 0:00:42

      Average standard deviation of split frequencies: 0.009498

      360500 -- (-462.509) (-456.930) [-455.806] (-456.078) * [-456.231] (-453.587) (-456.238) (-458.749) -- 0:00:42
      361000 -- [-457.314] (-457.988) (-455.644) (-456.751) * [-454.709] (-456.898) (-456.119) (-454.883) -- 0:00:42
      361500 -- [-457.599] (-456.827) (-454.317) (-456.565) * [-454.096] (-456.763) (-457.922) (-454.685) -- 0:00:42
      362000 -- (-457.048) (-454.333) [-456.648] (-454.687) * [-455.039] (-454.170) (-455.777) (-455.855) -- 0:00:42
      362500 -- (-455.327) [-454.859] (-456.109) (-457.702) * (-456.735) [-455.136] (-454.697) (-457.223) -- 0:00:42
      363000 -- (-456.194) (-455.780) (-459.562) [-454.429] * (-456.178) [-454.823] (-455.258) (-455.309) -- 0:00:42
      363500 -- (-456.325) (-458.590) [-453.926] (-453.748) * (-455.218) [-456.571] (-455.152) (-456.390) -- 0:00:42
      364000 -- (-457.296) (-457.229) [-454.792] (-454.450) * (-455.102) (-457.164) [-455.605] (-458.952) -- 0:00:41
      364500 -- (-455.713) [-457.597] (-454.654) (-454.365) * (-454.028) (-455.541) [-455.178] (-459.569) -- 0:00:41
      365000 -- (-456.607) [-458.209] (-455.105) (-454.386) * (-454.733) (-454.729) [-456.857] (-456.868) -- 0:00:41

      Average standard deviation of split frequencies: 0.009016

      365500 -- [-454.222] (-455.363) (-455.098) (-457.829) * (-454.204) (-456.175) (-455.771) [-454.764] -- 0:00:41
      366000 -- (-453.844) [-454.137] (-457.497) (-459.002) * (-454.172) (-455.647) (-454.365) [-456.504] -- 0:00:41
      366500 -- (-456.174) (-456.750) (-456.561) [-454.544] * (-456.249) [-455.306] (-455.426) (-457.504) -- 0:00:41
      367000 -- (-456.177) (-456.243) (-455.098) [-458.427] * [-455.926] (-456.451) (-456.820) (-456.960) -- 0:00:41
      367500 -- [-455.982] (-456.124) (-456.159) (-456.541) * (-456.277) [-455.957] (-455.509) (-454.490) -- 0:00:41
      368000 -- (-458.355) [-454.937] (-456.163) (-456.358) * (-456.178) (-455.404) [-457.790] (-460.764) -- 0:00:41
      368500 -- (-456.555) [-459.961] (-454.840) (-455.037) * (-461.204) (-455.331) [-456.184] (-457.593) -- 0:00:41
      369000 -- [-455.442] (-456.981) (-455.685) (-457.486) * (-457.303) (-455.019) (-457.875) [-455.271] -- 0:00:41
      369500 -- (-454.915) [-456.830] (-454.521) (-458.087) * [-457.200] (-454.489) (-455.171) (-454.440) -- 0:00:40
      370000 -- [-454.628] (-461.704) (-455.216) (-456.206) * (-454.466) (-455.810) (-456.073) [-456.910] -- 0:00:40

      Average standard deviation of split frequencies: 0.008478

      370500 -- (-454.793) (-454.324) (-454.748) [-456.302] * (-454.348) (-457.949) [-457.217] (-454.403) -- 0:00:40
      371000 -- (-457.243) (-455.629) [-456.771] (-461.684) * (-459.469) (-460.809) (-455.071) [-458.490] -- 0:00:40
      371500 -- (-458.718) [-454.239] (-461.600) (-455.427) * (-454.849) (-456.625) (-455.400) [-457.955] -- 0:00:40
      372000 -- [-456.617] (-454.128) (-460.577) (-456.225) * (-457.309) (-457.618) (-454.194) [-454.407] -- 0:00:42
      372500 -- (-455.208) [-454.914] (-455.104) (-456.695) * [-457.589] (-454.488) (-456.814) (-454.883) -- 0:00:42
      373000 -- (-454.231) (-460.479) (-455.617) [-456.041] * (-457.785) (-458.383) (-455.174) [-455.418] -- 0:00:42
      373500 -- (-456.234) [-456.623] (-455.018) (-455.167) * (-454.322) (-461.129) (-455.184) [-453.552] -- 0:00:41
      374000 -- [-455.547] (-456.028) (-454.483) (-454.672) * [-457.082] (-454.258) (-455.374) (-455.426) -- 0:00:41
      374500 -- (-457.204) (-455.736) (-455.985) [-454.326] * (-457.269) (-454.529) [-458.008] (-454.684) -- 0:00:41
      375000 -- (-456.365) (-457.000) [-455.176] (-454.992) * [-454.565] (-454.667) (-455.841) (-455.375) -- 0:00:41

      Average standard deviation of split frequencies: 0.009090

      375500 -- (-455.924) [-455.710] (-458.009) (-454.885) * (-456.411) (-461.837) [-455.038] (-454.149) -- 0:00:41
      376000 -- (-455.326) (-456.604) [-456.614] (-454.095) * (-455.368) (-460.034) [-454.280] (-454.335) -- 0:00:41
      376500 -- (-454.404) [-455.239] (-460.890) (-455.060) * [-455.527] (-459.289) (-453.987) (-457.342) -- 0:00:41
      377000 -- (-455.935) (-458.735) (-461.371) [-458.357] * (-455.059) [-455.181] (-454.009) (-456.754) -- 0:00:41
      377500 -- [-455.763] (-457.625) (-454.716) (-458.765) * (-459.354) (-455.174) (-454.689) [-454.550] -- 0:00:41
      378000 -- [-455.053] (-458.873) (-453.985) (-456.119) * (-459.459) (-457.149) [-455.675] (-453.908) -- 0:00:41
      378500 -- (-456.941) [-454.055] (-454.375) (-457.674) * (-454.693) (-457.348) (-453.916) [-455.978] -- 0:00:41
      379000 -- (-455.691) (-454.542) [-454.372] (-458.309) * (-454.370) (-458.196) (-455.572) [-458.582] -- 0:00:40
      379500 -- (-456.687) (-456.740) (-454.209) [-456.913] * [-455.228] (-454.463) (-454.285) (-454.114) -- 0:00:40
      380000 -- (-456.715) (-455.059) [-457.803] (-454.472) * (-454.535) [-455.483] (-456.649) (-457.205) -- 0:00:40

      Average standard deviation of split frequencies: 0.008091

      380500 -- (-458.401) (-457.464) (-457.336) [-458.509] * (-453.852) (-454.412) (-455.854) [-455.097] -- 0:00:40
      381000 -- [-454.145] (-458.499) (-459.842) (-454.282) * (-456.333) (-455.614) [-457.093] (-455.659) -- 0:00:40
      381500 -- (-457.575) (-456.749) (-457.308) [-454.905] * (-456.828) (-455.245) [-456.453] (-455.958) -- 0:00:40
      382000 -- (-454.266) (-456.408) [-454.757] (-457.486) * [-457.666] (-454.085) (-458.868) (-459.620) -- 0:00:40
      382500 -- (-454.635) (-456.526) [-455.846] (-455.595) * (-455.445) (-454.775) [-454.306] (-459.215) -- 0:00:40
      383000 -- (-454.742) (-454.822) (-458.355) [-461.514] * (-457.368) [-453.724] (-457.181) (-457.564) -- 0:00:40
      383500 -- [-454.899] (-454.043) (-458.946) (-455.087) * [-454.666] (-456.545) (-456.931) (-454.302) -- 0:00:40
      384000 -- (-456.251) [-460.456] (-454.930) (-454.619) * (-456.714) (-457.735) (-454.235) [-455.575] -- 0:00:40
      384500 -- (-458.304) (-463.463) [-454.077] (-454.734) * (-457.454) (-458.306) (-457.673) [-453.813] -- 0:00:40
      385000 -- (-459.347) (-460.605) (-454.995) [-457.360] * [-455.030] (-454.697) (-454.064) (-458.361) -- 0:00:39

      Average standard deviation of split frequencies: 0.008060

      385500 -- (-456.534) (-458.229) (-456.821) [-458.089] * (-455.583) (-454.455) [-457.193] (-457.116) -- 0:00:39
      386000 -- [-455.009] (-457.976) (-456.136) (-455.735) * [-454.141] (-454.321) (-456.265) (-455.246) -- 0:00:41
      386500 -- (-455.642) (-456.523) (-456.038) [-455.066] * [-454.600] (-458.090) (-457.309) (-455.927) -- 0:00:41
      387000 -- (-456.919) (-454.617) [-460.033] (-454.452) * (-453.895) (-455.339) [-457.370] (-458.617) -- 0:00:41
      387500 -- (-457.015) [-455.661] (-460.999) (-454.355) * (-454.120) (-454.249) [-463.613] (-456.245) -- 0:00:41
      388000 -- (-458.150) (-458.812) (-457.665) [-454.666] * (-455.114) (-454.617) [-460.019] (-456.700) -- 0:00:41
      388500 -- (-454.789) [-454.184] (-456.893) (-458.619) * (-457.841) [-458.550] (-455.810) (-455.400) -- 0:00:40
      389000 -- [-454.516] (-455.404) (-458.085) (-457.406) * (-454.077) (-454.909) [-457.199] (-454.397) -- 0:00:40
      389500 -- (-456.314) (-455.962) [-454.921] (-459.788) * (-455.249) (-456.089) (-460.852) [-457.703] -- 0:00:40
      390000 -- (-455.011) (-457.406) [-455.911] (-458.607) * [-457.543] (-454.678) (-457.259) (-456.987) -- 0:00:40

      Average standard deviation of split frequencies: 0.008366

      390500 -- [-455.111] (-457.356) (-456.815) (-457.064) * (-455.425) [-454.717] (-458.388) (-455.655) -- 0:00:40
      391000 -- (-456.199) (-457.037) (-455.660) [-457.213] * (-455.714) (-457.207) (-459.799) [-457.481] -- 0:00:40
      391500 -- (-457.503) (-454.815) (-455.088) [-455.783] * (-456.426) (-454.523) (-456.896) [-456.397] -- 0:00:40
      392000 -- (-457.213) (-457.287) [-454.702] (-456.014) * (-453.993) (-455.574) (-455.440) [-456.257] -- 0:00:40
      392500 -- (-456.124) (-456.739) [-456.679] (-456.206) * (-454.248) [-457.903] (-456.434) (-456.993) -- 0:00:40
      393000 -- (-456.012) (-454.555) (-458.634) [-456.796] * [-458.120] (-456.200) (-457.386) (-456.615) -- 0:00:40
      393500 -- (-461.613) (-454.023) (-462.506) [-458.582] * [-455.820] (-455.567) (-458.350) (-456.523) -- 0:00:40
      394000 -- (-456.407) (-453.929) [-457.032] (-455.084) * (-454.951) (-454.441) [-455.921] (-455.118) -- 0:00:39
      394500 -- (-455.160) (-458.996) (-454.757) [-455.586] * [-455.171] (-455.810) (-456.226) (-455.145) -- 0:00:39
      395000 -- (-454.830) [-458.073] (-462.719) (-456.400) * (-455.229) (-454.386) [-453.783] (-467.441) -- 0:00:39

      Average standard deviation of split frequencies: 0.007857

      395500 -- (-454.138) [-456.217] (-461.756) (-455.341) * (-455.595) [-455.542] (-456.017) (-460.355) -- 0:00:39
      396000 -- (-455.651) (-459.106) [-455.612] (-455.408) * [-456.362] (-459.088) (-459.342) (-461.163) -- 0:00:39
      396500 -- (-454.287) [-457.389] (-453.861) (-456.861) * [-454.532] (-459.300) (-457.673) (-458.060) -- 0:00:39
      397000 -- (-454.744) (-459.734) [-454.811] (-456.817) * (-461.954) (-455.223) [-456.887] (-459.147) -- 0:00:39
      397500 -- (-455.299) [-456.783] (-455.578) (-454.744) * (-457.933) (-455.033) [-454.843] (-460.536) -- 0:00:39
      398000 -- (-457.255) (-454.099) (-457.981) [-454.419] * (-458.140) (-454.066) (-454.584) [-455.627] -- 0:00:39
      398500 -- (-459.122) (-460.100) [-458.004] (-454.393) * (-456.092) (-454.184) [-454.182] (-457.913) -- 0:00:39
      399000 -- [-454.904] (-458.602) (-457.397) (-456.751) * (-456.221) (-459.897) (-456.533) [-457.251] -- 0:00:39
      399500 -- [-454.756] (-455.849) (-458.510) (-457.288) * (-454.403) (-460.186) [-455.200] (-454.614) -- 0:00:39
      400000 -- [-458.018] (-454.976) (-458.344) (-457.231) * [-454.968] (-454.997) (-455.894) (-456.771) -- 0:00:39

      Average standard deviation of split frequencies: 0.008157

      400500 -- (-455.058) (-455.905) (-456.065) [-456.855] * [-455.682] (-457.130) (-459.625) (-458.062) -- 0:00:40
      401000 -- [-454.367] (-455.290) (-458.416) (-457.231) * (-461.411) [-458.535] (-458.962) (-457.215) -- 0:00:40
      401500 -- (-457.700) (-454.197) [-455.981] (-456.132) * (-456.572) [-454.651] (-464.390) (-455.031) -- 0:00:40
      402000 -- [-455.484] (-456.756) (-457.310) (-457.434) * (-456.689) (-456.230) (-456.057) [-454.259] -- 0:00:40
      402500 -- (-455.562) [-454.441] (-460.838) (-458.012) * (-459.432) (-457.691) [-455.373] (-454.333) -- 0:00:40
      403000 -- [-456.355] (-459.423) (-461.183) (-459.119) * (-456.174) (-454.628) (-455.538) [-456.354] -- 0:00:39
      403500 -- (-455.781) (-457.506) [-454.871] (-459.862) * (-454.832) [-456.377] (-455.727) (-457.786) -- 0:00:39
      404000 -- (-455.472) (-457.919) (-454.385) [-454.818] * [-454.625] (-455.967) (-455.975) (-455.287) -- 0:00:39
      404500 -- (-453.953) (-460.977) [-456.919] (-459.170) * (-457.622) (-454.717) [-457.982] (-454.437) -- 0:00:39
      405000 -- (-453.996) (-455.980) (-454.505) [-454.413] * [-454.429] (-457.035) (-456.764) (-455.629) -- 0:00:39

      Average standard deviation of split frequencies: 0.007508

      405500 -- (-456.331) [-453.783] (-459.785) (-457.569) * (-457.959) [-455.596] (-456.802) (-457.648) -- 0:00:39
      406000 -- (-457.008) (-455.009) [-457.754] (-456.235) * (-455.260) (-458.608) [-455.521] (-456.451) -- 0:00:39
      406500 -- [-454.830] (-455.059) (-457.198) (-455.528) * (-455.254) (-458.717) (-454.561) [-457.980] -- 0:00:39
      407000 -- (-456.356) (-455.419) [-458.017] (-456.487) * [-454.966] (-457.098) (-453.820) (-454.937) -- 0:00:39
      407500 -- (-457.091) (-454.616) (-459.438) [-455.088] * (-459.657) (-455.009) [-455.390] (-456.820) -- 0:00:39
      408000 -- (-458.209) (-457.167) [-453.849] (-457.179) * (-456.468) [-456.919] (-455.710) (-462.324) -- 0:00:39
      408500 -- [-454.954] (-455.183) (-455.701) (-458.026) * (-455.809) (-456.602) (-455.613) [-456.034] -- 0:00:39
      409000 -- (-457.472) (-456.029) [-458.598] (-455.856) * (-459.978) (-453.736) [-454.572] (-454.439) -- 0:00:39
      409500 -- (-455.854) (-457.975) (-455.946) [-457.872] * (-461.864) (-453.530) (-456.881) [-454.715] -- 0:00:38
      410000 -- (-454.845) (-454.530) (-457.980) [-454.433] * (-460.606) (-454.045) (-455.703) [-459.462] -- 0:00:38

      Average standard deviation of split frequencies: 0.007040

      410500 -- (-456.428) (-456.210) (-456.711) [-456.251] * (-457.979) (-453.585) [-455.502] (-454.726) -- 0:00:38
      411000 -- [-453.974] (-455.950) (-460.594) (-455.685) * [-457.160] (-454.436) (-453.709) (-461.846) -- 0:00:38
      411500 -- (-455.295) (-454.327) (-456.044) [-456.827] * (-456.970) (-459.646) [-454.544] (-457.909) -- 0:00:38
      412000 -- [-454.112] (-456.182) (-459.634) (-456.345) * [-454.533] (-464.466) (-455.111) (-456.399) -- 0:00:38
      412500 -- (-455.093) [-454.096] (-461.287) (-456.798) * (-456.263) (-456.600) [-454.770] (-455.981) -- 0:00:38
      413000 -- (-455.544) (-455.216) [-454.909] (-454.892) * (-456.847) (-456.977) (-455.038) [-455.821] -- 0:00:38
      413500 -- (-454.518) (-456.087) (-454.677) [-454.806] * (-454.756) (-458.183) (-458.652) [-455.124] -- 0:00:38
      414000 -- (-455.923) (-456.441) (-455.345) [-454.187] * (-459.362) [-454.175] (-453.499) (-456.242) -- 0:00:38
      414500 -- (-458.201) (-457.663) [-461.708] (-455.182) * (-456.838) (-455.701) (-462.506) [-457.611] -- 0:00:39
      415000 -- (-457.434) (-455.722) [-461.538] (-461.979) * (-457.367) [-458.273] (-455.282) (-455.215) -- 0:00:39

      Average standard deviation of split frequencies: 0.007252

      415500 -- (-459.128) [-454.747] (-455.336) (-455.965) * (-454.676) [-454.983] (-454.264) (-454.984) -- 0:00:39
      416000 -- [-457.431] (-454.787) (-456.792) (-458.299) * (-463.263) (-455.507) (-454.701) [-454.212] -- 0:00:39
      416500 -- [-457.478] (-455.595) (-463.602) (-455.702) * (-459.721) (-459.552) [-456.326] (-454.650) -- 0:00:39
      417000 -- (-455.214) (-455.057) (-461.462) [-455.094] * [-457.453] (-455.693) (-455.810) (-456.115) -- 0:00:39
      417500 -- (-457.296) (-455.257) [-457.288] (-455.619) * [-460.140] (-456.321) (-455.128) (-455.970) -- 0:00:39
      418000 -- (-461.628) (-459.574) [-454.986] (-455.812) * (-456.855) (-456.502) (-456.209) [-454.062] -- 0:00:38
      418500 -- (-456.270) (-455.226) (-455.789) [-455.085] * (-458.106) [-457.278] (-455.134) (-454.667) -- 0:00:38
      419000 -- (-461.198) (-455.411) (-456.553) [-454.070] * (-456.825) (-457.361) (-461.153) [-459.247] -- 0:00:38
      419500 -- [-454.991] (-454.491) (-455.785) (-454.103) * (-454.063) [-455.681] (-456.460) (-457.497) -- 0:00:38
      420000 -- (-458.262) (-455.038) (-460.379) [-458.164] * (-468.637) (-453.896) (-455.625) [-454.140] -- 0:00:38

      Average standard deviation of split frequencies: 0.007545

      420500 -- (-455.311) [-454.754] (-455.975) (-454.984) * (-457.169) (-455.308) (-454.439) [-454.417] -- 0:00:38
      421000 -- (-454.975) [-455.568] (-455.321) (-454.992) * (-460.852) [-457.961] (-455.939) (-457.193) -- 0:00:38
      421500 -- (-461.500) [-455.522] (-456.905) (-460.684) * (-456.500) (-457.915) (-454.776) [-454.459] -- 0:00:38
      422000 -- (-456.174) [-455.881] (-457.713) (-455.383) * [-455.165] (-457.401) (-455.431) (-454.279) -- 0:00:38
      422500 -- (-456.601) [-454.607] (-455.725) (-455.432) * [-454.200] (-457.214) (-454.860) (-455.624) -- 0:00:38
      423000 -- (-455.193) [-457.729] (-455.733) (-454.879) * (-456.257) (-455.011) [-454.847] (-455.329) -- 0:00:38
      423500 -- [-456.544] (-456.329) (-456.712) (-455.514) * (-457.900) (-454.340) (-455.851) [-455.023] -- 0:00:38
      424000 -- (-458.692) [-455.252] (-456.208) (-455.414) * [-456.631] (-455.762) (-456.257) (-455.402) -- 0:00:38
      424500 -- (-460.446) (-457.380) (-455.670) [-454.734] * (-455.885) (-457.334) [-458.138] (-457.460) -- 0:00:37
      425000 -- (-456.124) [-456.569] (-455.973) (-455.239) * (-455.657) (-454.947) (-455.438) [-457.597] -- 0:00:37

      Average standard deviation of split frequencies: 0.008369

      425500 -- [-455.511] (-454.168) (-454.271) (-459.466) * [-458.480] (-456.400) (-458.751) (-454.746) -- 0:00:37
      426000 -- [-456.418] (-455.273) (-454.150) (-458.110) * [-460.698] (-456.555) (-455.685) (-456.153) -- 0:00:37
      426500 -- (-456.514) [-459.476] (-454.422) (-460.284) * (-457.813) (-456.207) (-454.502) [-454.821] -- 0:00:37
      427000 -- (-456.168) [-455.936] (-456.689) (-458.762) * (-454.375) [-455.379] (-459.035) (-455.278) -- 0:00:37
      427500 -- (-454.990) [-459.175] (-458.378) (-458.280) * (-455.697) (-454.866) (-456.987) [-457.806] -- 0:00:37
      428000 -- [-455.770] (-463.208) (-456.410) (-455.609) * (-455.411) [-456.182] (-459.302) (-460.970) -- 0:00:37
      428500 -- (-457.508) [-459.724] (-454.697) (-462.548) * [-454.896] (-455.053) (-456.996) (-455.568) -- 0:00:38
      429000 -- (-457.460) (-459.203) (-456.342) [-457.276] * (-455.177) [-456.199] (-455.925) (-454.631) -- 0:00:38
      429500 -- (-457.397) (-454.080) [-456.262] (-457.323) * [-456.547] (-454.473) (-456.968) (-453.566) -- 0:00:38
      430000 -- (-457.797) (-454.323) (-457.863) [-454.096] * (-455.426) [-453.644] (-456.210) (-455.394) -- 0:00:38

      Average standard deviation of split frequencies: 0.007589

      430500 -- (-454.469) (-454.158) [-458.520] (-454.955) * (-455.874) (-454.588) (-454.349) [-457.005] -- 0:00:38
      431000 -- (-458.781) (-455.082) [-454.913] (-459.231) * [-455.552] (-456.056) (-454.184) (-455.365) -- 0:00:38
      431500 -- (-458.829) (-454.141) [-455.505] (-459.234) * (-454.411) [-457.640] (-453.975) (-455.610) -- 0:00:38
      432000 -- (-457.651) [-455.115] (-457.455) (-455.677) * (-458.246) [-456.523] (-456.284) (-455.878) -- 0:00:38
      432500 -- [-456.007] (-458.178) (-459.967) (-456.192) * (-457.551) (-455.346) (-456.024) [-457.775] -- 0:00:38
      433000 -- (-455.709) (-459.275) (-456.816) [-454.678] * (-453.778) (-455.152) (-457.949) [-453.647] -- 0:00:37
      433500 -- (-455.854) [-456.481] (-458.817) (-461.032) * (-454.786) (-457.069) (-458.821) [-453.668] -- 0:00:37
      434000 -- (-461.211) (-455.627) (-461.214) [-458.858] * [-456.170] (-454.357) (-455.672) (-453.893) -- 0:00:37
      434500 -- [-454.701] (-458.836) (-457.415) (-455.027) * (-454.023) (-454.799) [-455.473] (-456.517) -- 0:00:37
      435000 -- (-456.937) (-456.534) (-454.616) [-456.652] * (-457.703) [-454.038] (-455.716) (-455.071) -- 0:00:37

      Average standard deviation of split frequencies: 0.007929

      435500 -- [-459.478] (-458.035) (-455.981) (-458.380) * (-455.776) [-455.773] (-456.197) (-456.938) -- 0:00:37
      436000 -- (-454.709) (-454.745) (-455.569) [-458.899] * (-458.454) (-456.043) [-454.443] (-457.591) -- 0:00:37
      436500 -- (-458.448) (-458.057) (-455.522) [-454.592] * (-457.713) [-456.178] (-457.632) (-455.034) -- 0:00:37
      437000 -- (-453.882) (-456.598) [-454.918] (-455.391) * (-456.263) [-457.412] (-457.626) (-456.311) -- 0:00:37
      437500 -- (-454.404) [-455.504] (-454.972) (-458.677) * (-458.680) [-455.159] (-457.423) (-455.962) -- 0:00:37
      438000 -- (-454.988) [-455.681] (-454.967) (-455.352) * (-457.366) (-454.229) [-456.161] (-457.306) -- 0:00:37
      438500 -- (-454.906) (-454.946) (-454.424) [-457.146] * (-457.322) (-454.197) [-454.995] (-455.401) -- 0:00:37
      439000 -- (-454.012) (-457.292) (-455.142) [-455.451] * (-456.131) [-458.435] (-455.619) (-456.385) -- 0:00:37
      439500 -- (-456.214) [-454.120] (-459.199) (-456.995) * (-460.871) [-458.141] (-455.817) (-454.246) -- 0:00:36
      440000 -- (-454.790) (-454.737) [-455.079] (-456.352) * [-453.669] (-454.856) (-456.713) (-459.006) -- 0:00:36

      Average standard deviation of split frequencies: 0.007560

      440500 -- [-455.387] (-456.388) (-455.272) (-456.594) * (-454.317) (-455.239) [-454.858] (-459.009) -- 0:00:36
      441000 -- (-456.358) (-457.010) (-455.047) [-454.091] * (-457.414) [-455.226] (-455.410) (-457.920) -- 0:00:36
      441500 -- (-454.758) (-454.989) (-455.460) [-455.004] * (-454.480) [-454.004] (-457.687) (-455.003) -- 0:00:36
      442000 -- (-454.055) (-457.757) [-456.202] (-454.842) * (-457.825) [-456.111] (-456.404) (-455.555) -- 0:00:36
      442500 -- [-454.789] (-457.881) (-461.181) (-458.626) * (-454.408) (-459.836) [-454.954] (-454.739) -- 0:00:36
      443000 -- (-454.290) (-456.198) [-454.558] (-454.994) * (-455.619) (-456.395) (-457.510) [-453.897] -- 0:00:36
      443500 -- (-454.322) (-455.996) [-456.869] (-455.273) * (-460.034) (-454.277) (-460.195) [-454.068] -- 0:00:36
      444000 -- (-455.338) [-457.411] (-454.977) (-465.024) * (-456.180) (-457.650) [-454.666] (-458.412) -- 0:00:37
      444500 -- (-453.738) (-459.048) [-455.025] (-460.725) * (-456.712) (-454.003) (-457.485) [-455.921] -- 0:00:37
      445000 -- (-455.435) (-454.156) [-455.862] (-457.632) * (-461.704) (-456.862) (-455.454) [-455.893] -- 0:00:37

      Average standard deviation of split frequencies: 0.007531

      445500 -- (-457.305) [-457.218] (-457.239) (-458.884) * (-455.389) [-456.625] (-456.969) (-455.535) -- 0:00:37
      446000 -- (-455.162) (-456.552) (-454.343) [-459.938] * [-455.318] (-456.554) (-455.680) (-454.856) -- 0:00:37
      446500 -- (-455.441) [-455.656] (-454.021) (-455.749) * [-454.586] (-454.743) (-457.475) (-456.728) -- 0:00:37
      447000 -- (-454.585) (-456.179) (-454.363) [-455.164] * [-455.150] (-455.411) (-463.958) (-455.595) -- 0:00:37
      447500 -- [-456.996] (-455.555) (-456.323) (-455.688) * (-462.214) [-455.868] (-455.289) (-455.979) -- 0:00:37
      448000 -- (-456.222) [-454.605] (-458.423) (-454.682) * [-456.118] (-454.563) (-454.663) (-458.038) -- 0:00:36
      448500 -- (-453.694) (-455.167) (-456.147) [-455.511] * [-456.577] (-454.224) (-457.040) (-455.159) -- 0:00:36
      449000 -- (-454.798) (-456.097) [-456.386] (-454.448) * [-454.993] (-454.958) (-456.504) (-455.952) -- 0:00:36
      449500 -- (-456.212) [-458.189] (-457.963) (-456.461) * (-456.159) (-457.170) [-454.062] (-455.277) -- 0:00:36
      450000 -- [-456.124] (-459.429) (-455.605) (-456.024) * [-454.308] (-458.062) (-454.772) (-455.306) -- 0:00:36

      Average standard deviation of split frequencies: 0.007910

      450500 -- (-456.927) (-458.019) (-457.984) [-453.558] * (-456.552) [-457.823] (-455.090) (-459.235) -- 0:00:36
      451000 -- (-459.571) [-455.134] (-456.045) (-453.608) * [-458.250] (-455.840) (-456.099) (-455.580) -- 0:00:36
      451500 -- (-456.469) (-455.181) [-454.361] (-454.709) * (-457.843) (-456.204) [-455.047] (-454.291) -- 0:00:36
      452000 -- (-456.569) (-455.871) [-457.086] (-459.219) * [-454.916] (-454.658) (-457.659) (-455.202) -- 0:00:36
      452500 -- (-454.808) [-455.739] (-456.856) (-455.622) * [-456.005] (-455.381) (-459.215) (-456.721) -- 0:00:36
      453000 -- (-455.959) [-457.731] (-454.585) (-455.038) * (-455.667) (-454.821) (-454.741) [-458.844] -- 0:00:36
      453500 -- (-457.254) (-455.893) (-455.057) [-454.157] * (-455.029) (-454.283) [-456.185] (-458.188) -- 0:00:36
      454000 -- (-457.882) [-454.531] (-455.787) (-456.824) * (-457.769) (-456.504) (-453.707) [-454.375] -- 0:00:36
      454500 -- (-457.269) (-454.030) [-454.332] (-459.243) * [-456.188] (-455.470) (-457.029) (-457.021) -- 0:00:36
      455000 -- (-454.666) (-454.399) [-455.045] (-455.698) * (-454.224) (-455.279) [-456.246] (-457.843) -- 0:00:35

      Average standard deviation of split frequencies: 0.008529

      455500 -- [-457.512] (-455.101) (-454.380) (-459.616) * (-457.811) [-456.087] (-455.027) (-457.459) -- 0:00:35
      456000 -- (-457.066) (-456.832) (-458.034) [-455.174] * [-455.612] (-458.157) (-456.892) (-460.096) -- 0:00:35
      456500 -- [-453.699] (-457.626) (-459.488) (-454.268) * [-456.353] (-456.607) (-460.042) (-456.828) -- 0:00:35
      457000 -- (-454.012) [-454.802] (-453.851) (-454.718) * (-458.047) [-457.441] (-456.829) (-454.629) -- 0:00:35
      457500 -- [-460.238] (-457.555) (-456.701) (-457.070) * [-462.616] (-458.652) (-459.524) (-455.650) -- 0:00:35
      458000 -- (-459.738) [-456.922] (-455.395) (-454.500) * (-458.536) (-458.104) (-457.159) [-457.434] -- 0:00:35
      458500 -- (-456.903) (-458.585) (-456.021) [-454.524] * (-455.076) (-457.010) [-453.910] (-455.774) -- 0:00:35
      459000 -- (-455.316) [-454.856] (-454.563) (-457.537) * (-458.856) (-458.219) [-455.347] (-455.390) -- 0:00:35
      459500 -- (-458.395) (-456.885) [-454.956] (-454.806) * (-456.990) (-457.050) (-455.851) [-455.703] -- 0:00:35
      460000 -- (-457.334) (-453.966) [-457.501] (-459.434) * (-461.399) (-458.096) [-454.408] (-454.919) -- 0:00:36

      Average standard deviation of split frequencies: 0.008800

      460500 -- (-456.188) [-454.648] (-456.616) (-455.505) * (-457.634) [-455.470] (-456.504) (-458.900) -- 0:00:36
      461000 -- (-456.885) (-455.109) [-457.038] (-454.789) * (-455.321) (-454.334) (-455.797) [-454.941] -- 0:00:36
      461500 -- (-456.486) (-457.637) (-454.935) [-458.038] * (-456.652) (-456.554) (-458.919) [-455.341] -- 0:00:36
      462000 -- [-454.641] (-456.674) (-456.572) (-458.323) * (-454.416) [-456.962] (-456.208) (-454.862) -- 0:00:36
      462500 -- (-454.567) (-455.231) (-456.893) [-456.621] * (-455.323) [-455.484] (-455.557) (-455.405) -- 0:00:36
      463000 -- (-456.917) (-454.696) [-454.580] (-456.445) * (-455.085) [-454.047] (-455.416) (-456.588) -- 0:00:35
      463500 -- (-459.216) [-457.198] (-457.245) (-454.157) * [-455.149] (-461.540) (-454.296) (-454.838) -- 0:00:35
      464000 -- (-457.008) [-454.456] (-457.247) (-455.153) * [-458.124] (-456.345) (-454.011) (-456.806) -- 0:00:35
      464500 -- (-454.216) (-454.500) (-456.489) [-455.222] * (-457.037) (-456.302) (-456.066) [-455.196] -- 0:00:35
      465000 -- (-458.186) [-456.232] (-456.037) (-454.454) * [-458.840] (-456.720) (-456.497) (-458.098) -- 0:00:35

      Average standard deviation of split frequencies: 0.008632

      465500 -- (-454.516) [-454.798] (-454.576) (-456.489) * [-458.005] (-455.637) (-454.949) (-458.564) -- 0:00:35
      466000 -- [-454.759] (-453.986) (-456.436) (-455.132) * (-457.425) [-456.557] (-458.073) (-458.029) -- 0:00:35
      466500 -- (-457.508) (-454.995) [-455.671] (-454.917) * (-457.971) (-457.648) [-455.061] (-457.376) -- 0:00:35
      467000 -- (-455.461) (-456.828) [-454.682] (-457.093) * (-457.255) (-454.126) (-456.522) [-455.532] -- 0:00:35
      467500 -- (-457.035) [-455.136] (-454.695) (-457.581) * [-455.532] (-456.381) (-458.286) (-456.575) -- 0:00:35
      468000 -- (-456.551) (-456.067) (-456.513) [-455.470] * (-455.476) (-454.804) [-456.305] (-454.458) -- 0:00:35
      468500 -- (-455.381) (-455.341) (-456.183) [-456.371] * (-455.628) (-455.194) (-456.059) [-454.949] -- 0:00:35
      469000 -- (-454.429) [-456.395] (-456.065) (-456.808) * (-456.833) [-456.827] (-457.934) (-454.752) -- 0:00:35
      469500 -- (-457.316) [-456.528] (-455.934) (-454.403) * (-454.339) [-454.704] (-455.211) (-457.250) -- 0:00:35
      470000 -- (-457.363) [-454.718] (-462.593) (-454.555) * (-454.764) (-459.841) [-454.593] (-456.372) -- 0:00:34

      Average standard deviation of split frequencies: 0.008814

      470500 -- [-454.157] (-455.304) (-455.645) (-454.642) * (-456.754) (-454.115) (-455.581) [-454.606] -- 0:00:34
      471000 -- (-455.271) (-454.972) [-454.022] (-455.134) * (-457.343) (-455.883) (-455.389) [-455.648] -- 0:00:34
      471500 -- (-460.295) (-457.847) [-455.029] (-455.278) * (-455.838) (-460.140) (-457.534) [-454.376] -- 0:00:34
      472000 -- (-456.091) [-455.094] (-459.710) (-456.571) * (-456.491) (-455.076) (-460.059) [-458.937] -- 0:00:34
      472500 -- (-457.863) [-454.422] (-456.421) (-455.638) * (-455.717) (-454.641) [-456.352] (-454.598) -- 0:00:34
      473000 -- (-458.267) (-454.222) [-457.727] (-455.977) * (-455.697) (-457.081) (-455.168) [-456.192] -- 0:00:34
      473500 -- (-455.141) (-457.063) (-457.258) [-456.378] * (-456.454) [-455.902] (-463.786) (-456.745) -- 0:00:34
      474000 -- (-454.343) (-456.616) [-454.921] (-454.420) * (-454.626) (-456.882) (-458.478) [-455.447] -- 0:00:34
      474500 -- (-455.884) (-457.962) [-455.619] (-457.432) * (-453.972) (-454.683) (-455.304) [-460.037] -- 0:00:35
      475000 -- (-455.095) (-458.779) [-455.162] (-455.378) * (-453.681) (-453.912) (-456.227) [-454.716] -- 0:00:35

      Average standard deviation of split frequencies: 0.008649

      475500 -- (-454.837) [-456.771] (-455.211) (-456.515) * (-457.225) (-456.022) [-458.238] (-455.815) -- 0:00:35
      476000 -- (-453.878) (-458.988) [-454.474] (-455.885) * [-457.726] (-456.028) (-454.122) (-458.623) -- 0:00:35
      476500 -- (-454.060) (-454.525) [-456.131] (-459.472) * [-456.060] (-455.425) (-459.207) (-455.442) -- 0:00:35
      477000 -- (-455.913) [-453.883] (-453.842) (-456.585) * (-458.310) [-454.393] (-455.496) (-456.919) -- 0:00:35
      477500 -- (-455.922) (-454.716) [-454.436] (-454.261) * (-454.482) (-454.272) [-456.769] (-454.372) -- 0:00:35
      478000 -- (-454.941) (-455.970) [-456.004] (-454.859) * (-454.519) (-458.935) [-459.783] (-457.171) -- 0:00:34
      478500 -- [-456.063] (-459.559) (-461.924) (-459.090) * (-456.811) [-455.092] (-454.259) (-456.479) -- 0:00:34
      479000 -- (-454.531) (-455.395) (-454.326) [-456.338] * [-454.227] (-456.085) (-454.036) (-454.213) -- 0:00:34
      479500 -- (-455.892) (-457.553) [-456.624] (-454.343) * [-455.374] (-458.930) (-454.438) (-453.937) -- 0:00:34
      480000 -- [-455.836] (-457.389) (-454.704) (-456.944) * (-457.975) (-455.644) (-456.327) [-454.010] -- 0:00:34

      Average standard deviation of split frequencies: 0.009153

      480500 -- [-455.484] (-457.796) (-455.687) (-456.515) * (-456.367) [-454.199] (-454.510) (-458.586) -- 0:00:34
      481000 -- [-458.550] (-453.948) (-456.980) (-460.222) * (-457.580) (-459.135) (-458.777) [-457.870] -- 0:00:34
      481500 -- (-456.322) (-455.931) [-454.862] (-457.337) * (-455.477) (-456.026) (-456.667) [-456.779] -- 0:00:34
      482000 -- (-455.803) (-457.051) [-456.965] (-454.577) * (-455.019) (-457.520) (-460.872) [-457.154] -- 0:00:34
      482500 -- (-457.261) (-455.545) [-455.567] (-460.458) * (-454.153) (-454.623) (-455.933) [-458.243] -- 0:00:34
      483000 -- [-459.411] (-456.847) (-455.606) (-456.935) * (-453.788) (-457.509) [-457.424] (-457.367) -- 0:00:34
      483500 -- [-456.048] (-454.844) (-454.021) (-454.895) * (-454.966) (-458.308) [-458.040] (-457.361) -- 0:00:34
      484000 -- (-457.574) (-454.606) [-454.663] (-454.458) * (-455.507) (-461.152) [-453.600] (-454.723) -- 0:00:34
      484500 -- (-455.735) (-455.212) (-458.952) [-454.296] * [-456.556] (-456.722) (-454.904) (-453.967) -- 0:00:34
      485000 -- (-454.386) (-455.081) (-457.230) [-455.372] * (-454.941) [-456.590] (-457.330) (-455.547) -- 0:00:33

      Average standard deviation of split frequencies: 0.008988

      485500 -- [-456.212] (-456.915) (-456.247) (-456.618) * (-458.688) [-454.869] (-456.502) (-455.179) -- 0:00:33
      486000 -- (-456.271) (-464.202) (-455.193) [-454.970] * (-462.759) [-454.488] (-455.598) (-456.864) -- 0:00:33
      486500 -- (-454.880) (-457.470) (-455.546) [-454.655] * (-457.614) [-460.102] (-455.554) (-455.608) -- 0:00:33
      487000 -- (-455.224) [-454.597] (-457.027) (-455.954) * (-458.129) [-454.578] (-455.347) (-458.403) -- 0:00:33
      487500 -- (-454.778) [-454.690] (-456.473) (-455.775) * (-454.747) [-455.076] (-456.361) (-454.502) -- 0:00:33
      488000 -- [-454.682] (-456.866) (-455.370) (-458.085) * [-457.242] (-457.246) (-454.838) (-454.437) -- 0:00:33
      488500 -- (-454.799) (-457.320) [-454.907] (-454.121) * (-457.515) [-458.759] (-455.198) (-455.054) -- 0:00:33
      489000 -- (-455.100) [-456.401] (-455.133) (-456.202) * (-456.862) (-455.427) (-454.582) [-454.705] -- 0:00:33
      489500 -- [-455.420] (-456.945) (-456.713) (-455.325) * (-454.220) (-453.774) [-453.993] (-454.808) -- 0:00:34
      490000 -- (-458.762) (-455.113) [-457.427] (-456.161) * (-455.612) (-457.666) (-456.255) [-454.643] -- 0:00:34

      Average standard deviation of split frequencies: 0.009607

      490500 -- (-454.667) [-456.232] (-454.894) (-454.660) * (-456.774) (-457.824) [-456.404] (-459.919) -- 0:00:34
      491000 -- (-458.379) (-455.168) [-455.485] (-455.598) * (-456.077) [-455.971] (-457.457) (-455.071) -- 0:00:34
      491500 -- (-455.081) [-455.485] (-457.259) (-455.691) * (-454.551) [-454.622] (-454.499) (-454.819) -- 0:00:34
      492000 -- (-460.911) [-457.416] (-456.294) (-463.879) * (-458.681) [-455.270] (-456.219) (-456.249) -- 0:00:34
      492500 -- (-456.818) (-462.293) (-456.721) [-456.916] * [-454.997] (-454.278) (-458.547) (-456.778) -- 0:00:34
      493000 -- (-456.084) (-455.754) (-456.678) [-457.528] * (-458.751) [-456.850] (-456.147) (-455.015) -- 0:00:33
      493500 -- [-455.847] (-453.582) (-456.919) (-455.035) * [-454.870] (-461.791) (-456.277) (-457.062) -- 0:00:33
      494000 -- (-457.018) (-454.698) (-455.302) [-454.394] * (-454.726) (-456.272) [-456.452] (-457.660) -- 0:00:33
      494500 -- (-454.304) [-454.783] (-455.588) (-456.434) * (-454.823) [-455.497] (-455.465) (-454.713) -- 0:00:33
      495000 -- [-457.881] (-455.462) (-455.492) (-462.185) * (-456.054) (-457.156) [-462.305] (-454.253) -- 0:00:33

      Average standard deviation of split frequencies: 0.009504

      495500 -- (-454.684) [-454.906] (-455.779) (-461.346) * [-453.768] (-455.423) (-460.270) (-454.711) -- 0:00:33
      496000 -- (-462.312) (-454.795) [-454.468] (-456.448) * (-456.301) (-463.279) [-454.701] (-454.484) -- 0:00:33
      496500 -- (-455.312) [-453.657] (-455.843) (-458.794) * (-455.798) [-456.040] (-454.000) (-454.510) -- 0:00:33
      497000 -- (-459.028) (-456.988) (-458.023) [-454.077] * (-456.352) [-455.370] (-454.195) (-455.702) -- 0:00:33
      497500 -- (-457.551) (-454.488) [-457.159] (-453.508) * (-456.030) [-455.801] (-456.517) (-455.454) -- 0:00:33
      498000 -- [-455.469] (-460.959) (-456.702) (-456.032) * (-455.878) (-454.949) [-455.738] (-458.709) -- 0:00:33
      498500 -- (-454.923) (-454.835) (-454.519) [-456.595] * (-455.317) (-454.631) (-455.575) [-457.965] -- 0:00:33
      499000 -- [-457.901] (-455.833) (-454.302) (-455.471) * (-453.984) [-455.033] (-455.168) (-457.020) -- 0:00:33
      499500 -- (-456.976) (-457.616) [-456.312] (-454.689) * (-455.266) (-457.727) [-455.064] (-458.722) -- 0:00:33
      500000 -- (-456.802) [-459.035] (-457.539) (-457.901) * (-456.512) [-456.845] (-456.372) (-455.133) -- 0:00:33

      Average standard deviation of split frequencies: 0.009290

      500500 -- (-463.785) (-460.967) (-457.466) [-455.398] * (-461.561) (-457.522) [-457.306] (-462.994) -- 0:00:32
      501000 -- (-456.265) (-462.097) (-457.399) [-453.844] * (-456.751) (-456.712) [-455.693] (-455.194) -- 0:00:32
      501500 -- (-455.695) [-457.214] (-455.180) (-459.118) * (-455.753) [-457.688] (-456.425) (-454.078) -- 0:00:32
      502000 -- [-456.581] (-454.302) (-457.866) (-454.746) * (-458.671) [-454.188] (-456.114) (-455.490) -- 0:00:32
      502500 -- (-456.990) [-454.868] (-454.904) (-455.294) * (-457.712) (-456.366) [-456.845] (-455.343) -- 0:00:32
      503000 -- [-456.013] (-456.020) (-455.694) (-455.039) * [-457.545] (-459.589) (-454.974) (-455.206) -- 0:00:32
      503500 -- [-455.192] (-454.622) (-455.793) (-455.116) * (-455.952) (-456.073) (-460.240) [-454.306] -- 0:00:32
      504000 -- [-455.009] (-456.399) (-455.899) (-458.806) * (-455.550) (-455.193) [-461.310] (-454.529) -- 0:00:32
      504500 -- (-458.312) (-455.140) (-455.625) [-455.019] * (-457.155) (-454.746) [-457.201] (-462.752) -- 0:00:32
      505000 -- (-456.168) [-454.409] (-456.304) (-455.881) * (-455.975) [-456.454] (-455.283) (-455.837) -- 0:00:32

      Average standard deviation of split frequencies: 0.008944

      505500 -- (-457.689) (-455.603) [-457.970] (-460.163) * (-455.335) [-454.837] (-456.681) (-455.056) -- 0:00:32
      506000 -- (-458.328) [-453.762] (-459.191) (-458.821) * (-457.562) [-454.388] (-454.879) (-456.313) -- 0:00:33
      506500 -- (-454.711) [-455.724] (-457.237) (-457.091) * (-458.178) (-454.339) (-455.527) [-456.469] -- 0:00:33
      507000 -- (-456.067) (-457.561) (-460.633) [-454.689] * (-455.270) [-456.172] (-455.123) (-459.675) -- 0:00:33
      507500 -- (-455.032) (-455.991) [-456.936] (-456.760) * (-454.284) (-459.488) [-455.827] (-454.379) -- 0:00:32
      508000 -- (-455.150) (-458.161) (-454.219) [-453.628] * (-454.665) (-453.748) [-456.849] (-454.289) -- 0:00:32
      508500 -- (-458.181) (-455.645) [-454.985] (-457.671) * (-454.655) [-454.338] (-457.708) (-454.711) -- 0:00:32
      509000 -- (-454.675) (-454.955) (-463.097) [-455.962] * (-456.855) [-455.387] (-456.225) (-457.364) -- 0:00:32
      509500 -- (-457.359) (-457.650) [-455.602] (-454.482) * (-456.798) [-457.668] (-457.619) (-456.835) -- 0:00:32
      510000 -- (-455.614) (-461.093) (-456.208) [-456.720] * [-455.473] (-459.603) (-460.081) (-455.227) -- 0:00:32

      Average standard deviation of split frequencies: 0.009170

      510500 -- (-455.372) (-454.716) (-458.454) [-456.284] * (-459.201) [-459.274] (-455.073) (-458.316) -- 0:00:32
      511000 -- (-455.148) (-455.962) (-456.882) [-454.504] * (-456.815) (-456.780) [-455.399] (-459.944) -- 0:00:32
      511500 -- (-455.994) (-457.842) [-456.420] (-454.787) * [-456.280] (-458.687) (-457.995) (-454.719) -- 0:00:32
      512000 -- (-455.286) (-455.507) [-455.059] (-461.025) * (-456.874) [-457.040] (-460.464) (-456.388) -- 0:00:32
      512500 -- (-455.310) (-460.197) (-455.596) [-454.618] * (-456.068) (-456.182) [-460.547] (-454.287) -- 0:00:32
      513000 -- (-454.645) [-457.496] (-456.559) (-455.757) * (-456.379) (-456.248) (-461.120) [-456.100] -- 0:00:32
      513500 -- (-455.077) (-460.852) [-454.172] (-457.864) * (-455.827) (-456.130) [-458.667] (-455.307) -- 0:00:32
      514000 -- (-457.584) (-459.274) (-455.416) [-455.015] * (-465.177) (-458.443) [-454.850] (-455.770) -- 0:00:32
      514500 -- (-456.364) (-459.840) (-462.075) [-454.898] * [-458.069] (-463.203) (-455.595) (-455.482) -- 0:00:32
      515000 -- [-454.768] (-454.807) (-461.640) (-455.368) * (-458.365) [-455.081] (-459.684) (-457.084) -- 0:00:32

      Average standard deviation of split frequencies: 0.008953

      515500 -- (-456.903) [-454.518] (-460.350) (-457.097) * (-456.736) (-457.640) (-457.754) [-457.521] -- 0:00:31
      516000 -- [-454.735] (-456.087) (-457.439) (-457.687) * (-454.938) [-457.009] (-457.751) (-456.962) -- 0:00:31
      516500 -- [-455.405] (-454.775) (-463.728) (-456.540) * (-457.557) (-454.493) [-455.874] (-461.592) -- 0:00:31
      517000 -- (-459.812) (-456.805) (-455.384) [-457.552] * (-455.065) (-456.726) (-457.099) [-454.611] -- 0:00:31
      517500 -- (-454.648) (-455.505) (-456.689) [-457.358] * (-454.591) [-458.027] (-454.752) (-459.415) -- 0:00:31
      518000 -- (-454.458) (-457.338) (-454.527) [-454.887] * [-455.821] (-456.237) (-455.972) (-458.107) -- 0:00:31
      518500 -- (-457.615) (-460.940) [-454.124] (-454.249) * (-458.617) [-455.820] (-458.581) (-457.231) -- 0:00:31
      519000 -- (-458.505) (-459.091) [-454.141] (-454.491) * (-456.079) (-455.492) [-458.244] (-455.183) -- 0:00:31
      519500 -- (-459.015) [-458.557] (-455.275) (-456.909) * [-458.409] (-454.323) (-455.293) (-456.818) -- 0:00:31
      520000 -- (-456.044) (-455.917) (-455.273) [-458.328] * [-453.793] (-455.151) (-454.475) (-456.837) -- 0:00:31

      Average standard deviation of split frequencies: 0.008812

      520500 -- (-454.863) (-454.449) (-459.059) [-458.172] * (-454.842) [-453.630] (-457.249) (-458.531) -- 0:00:31
      521000 -- (-454.592) [-457.196] (-456.694) (-455.033) * [-454.862] (-454.963) (-458.140) (-455.759) -- 0:00:31
      521500 -- (-454.432) (-458.415) [-455.681] (-453.862) * (-457.220) (-456.389) (-457.800) [-454.316] -- 0:00:31
      522000 -- [-454.570] (-456.072) (-455.013) (-456.050) * (-458.244) (-456.053) (-458.770) [-455.509] -- 0:00:32
      522500 -- (-455.309) (-455.585) [-458.177] (-456.087) * (-454.742) [-455.429] (-456.797) (-456.243) -- 0:00:31
      523000 -- [-455.352] (-455.282) (-458.942) (-456.042) * (-456.472) (-458.033) (-458.196) [-454.529] -- 0:00:31
      523500 -- (-457.890) (-455.177) (-454.882) [-454.720] * (-455.809) [-457.948] (-454.712) (-455.534) -- 0:00:31
      524000 -- (-460.367) [-453.750] (-457.407) (-457.001) * (-455.838) (-455.218) (-456.589) [-459.573] -- 0:00:31
      524500 -- (-458.190) [-454.924] (-455.896) (-455.433) * [-454.386] (-459.080) (-455.643) (-454.072) -- 0:00:31
      525000 -- (-457.391) (-458.397) (-454.907) [-455.110] * (-456.059) (-459.189) (-455.196) [-453.891] -- 0:00:31

      Average standard deviation of split frequencies: 0.009380

      525500 -- (-459.521) (-454.244) [-460.038] (-459.502) * [-454.414] (-455.084) (-455.203) (-455.908) -- 0:00:31
      526000 -- (-456.684) [-455.128] (-459.719) (-453.768) * [-454.999] (-456.657) (-454.409) (-458.081) -- 0:00:31
      526500 -- (-458.018) [-454.208] (-456.909) (-456.745) * [-455.351] (-456.515) (-455.947) (-456.998) -- 0:00:31
      527000 -- (-458.617) (-454.598) (-455.617) [-455.993] * (-453.677) [-454.745] (-453.949) (-456.550) -- 0:00:31
      527500 -- (-455.590) [-460.836] (-453.986) (-456.668) * (-453.583) [-454.309] (-456.566) (-456.319) -- 0:00:31
      528000 -- (-455.265) (-460.602) [-455.925] (-456.327) * [-454.584] (-458.046) (-454.343) (-457.382) -- 0:00:31
      528500 -- (-456.248) [-457.771] (-456.270) (-453.723) * (-455.873) [-454.573] (-456.228) (-454.442) -- 0:00:31
      529000 -- (-456.236) (-456.693) [-456.710] (-455.761) * (-455.974) (-455.642) (-456.057) [-455.678] -- 0:00:31
      529500 -- (-454.489) (-460.733) [-455.939] (-454.430) * (-454.922) (-454.696) (-454.277) [-455.842] -- 0:00:31
      530000 -- (-459.526) [-456.565] (-456.096) (-456.803) * (-454.976) (-454.106) (-457.788) [-458.312] -- 0:00:31

      Average standard deviation of split frequencies: 0.009416

      530500 -- [-454.827] (-455.378) (-456.817) (-455.035) * (-457.962) [-457.562] (-456.019) (-460.160) -- 0:00:30
      531000 -- [-454.248] (-454.040) (-464.072) (-456.089) * (-456.617) (-455.146) [-455.561] (-459.568) -- 0:00:30
      531500 -- (-459.585) (-464.033) (-457.057) [-458.471] * [-456.356] (-464.901) (-453.764) (-464.750) -- 0:00:30
      532000 -- (-455.097) (-461.982) [-456.885] (-456.847) * (-454.362) [-459.380] (-453.725) (-458.421) -- 0:00:30
      532500 -- (-456.128) (-458.414) [-455.111] (-457.362) * [-455.299] (-456.593) (-455.291) (-458.934) -- 0:00:30
      533000 -- (-456.870) (-456.296) (-453.850) [-455.439] * (-455.668) (-457.982) [-454.537] (-454.872) -- 0:00:30
      533500 -- (-458.138) (-454.940) (-455.084) [-456.683] * (-457.031) (-457.139) [-454.713] (-457.062) -- 0:00:30
      534000 -- [-454.911] (-457.977) (-456.929) (-456.342) * (-455.165) [-455.676] (-454.421) (-455.924) -- 0:00:30
      534500 -- [-457.332] (-456.084) (-458.018) (-458.615) * (-458.385) (-453.971) [-454.693] (-455.989) -- 0:00:30
      535000 -- [-458.201] (-454.983) (-457.064) (-455.817) * (-457.672) (-455.387) [-456.718] (-456.882) -- 0:00:30

      Average standard deviation of split frequencies: 0.009205

      535500 -- (-459.388) (-457.409) [-454.003] (-454.830) * [-456.414] (-454.711) (-454.131) (-455.912) -- 0:00:30
      536000 -- [-456.410] (-455.975) (-454.032) (-454.399) * (-455.348) (-455.981) [-453.675] (-457.210) -- 0:00:30
      536500 -- (-456.033) [-455.524] (-454.473) (-456.888) * (-456.770) (-457.970) [-456.366] (-454.906) -- 0:00:30
      537000 -- (-454.806) (-456.661) [-454.830] (-460.173) * (-454.885) (-459.727) [-455.057] (-455.279) -- 0:00:30
      537500 -- [-454.806] (-454.750) (-456.975) (-463.766) * (-455.985) (-458.425) [-455.009] (-454.699) -- 0:00:30
      538000 -- (-457.884) [-456.880] (-455.879) (-458.018) * [-455.792] (-456.169) (-456.267) (-457.046) -- 0:00:30
      538500 -- (-456.795) (-456.003) [-459.082] (-455.464) * (-454.805) (-456.290) (-455.626) [-455.867] -- 0:00:30
      539000 -- (-456.053) [-457.135] (-456.779) (-455.035) * [-454.748] (-454.384) (-456.762) (-459.363) -- 0:00:30
      539500 -- [-454.122] (-456.161) (-456.867) (-457.618) * (-457.969) [-455.127] (-454.116) (-455.535) -- 0:00:30
      540000 -- (-454.835) (-455.751) (-458.220) [-455.019] * (-457.816) (-455.226) (-458.895) [-457.295] -- 0:00:30

      Average standard deviation of split frequencies: 0.009010

      540500 -- (-462.881) (-457.829) [-456.067] (-457.692) * (-456.777) (-454.808) (-456.842) [-456.683] -- 0:00:30
      541000 -- [-458.249] (-455.769) (-456.797) (-457.237) * (-456.741) (-454.824) (-457.829) [-457.897] -- 0:00:30
      541500 -- (-459.214) [-456.130] (-460.493) (-455.338) * (-457.584) [-457.206] (-455.209) (-458.643) -- 0:00:30
      542000 -- (-458.676) (-456.863) (-455.643) [-456.372] * (-456.124) (-454.804) [-454.815] (-458.228) -- 0:00:30
      542500 -- (-462.833) (-454.693) (-455.189) [-456.892] * (-456.484) (-455.342) [-453.997] (-456.374) -- 0:00:30
      543000 -- (-460.553) [-455.332] (-455.570) (-454.818) * (-455.016) [-458.885] (-453.890) (-455.690) -- 0:00:30
      543500 -- [-459.582] (-457.387) (-459.865) (-456.827) * (-454.845) [-457.060] (-454.375) (-454.328) -- 0:00:30
      544000 -- (-455.998) (-456.561) [-457.431] (-455.510) * (-455.154) (-457.605) [-455.010] (-459.915) -- 0:00:30
      544500 -- (-455.352) (-456.970) [-457.549] (-457.055) * (-455.799) [-454.077] (-458.767) (-456.072) -- 0:00:30
      545000 -- (-458.452) (-456.162) (-457.396) [-453.648] * (-455.494) [-454.838] (-455.277) (-454.944) -- 0:00:30

      Average standard deviation of split frequencies: 0.008806

      545500 -- (-457.310) [-457.011] (-457.466) (-453.622) * [-455.653] (-455.083) (-455.151) (-458.902) -- 0:00:29
      546000 -- (-460.285) [-455.788] (-453.997) (-454.438) * (-455.294) (-455.343) (-455.881) [-455.978] -- 0:00:29
      546500 -- (-455.651) (-460.089) [-455.098] (-457.296) * [-455.274] (-455.176) (-456.808) (-459.540) -- 0:00:29
      547000 -- (-462.265) (-457.151) [-454.970] (-457.647) * (-454.730) [-455.593] (-454.753) (-458.736) -- 0:00:29
      547500 -- (-454.796) [-455.019] (-454.581) (-458.600) * (-454.498) [-455.200] (-456.011) (-459.909) -- 0:00:29
      548000 -- [-455.737] (-455.809) (-457.156) (-457.399) * (-454.999) [-456.556] (-457.055) (-463.184) -- 0:00:29
      548500 -- (-458.865) (-455.648) [-454.780] (-454.477) * (-456.178) (-454.216) (-458.646) [-455.037] -- 0:00:29
      549000 -- (-466.052) (-456.927) (-455.200) [-455.527] * [-457.304] (-458.278) (-456.541) (-455.234) -- 0:00:29
      549500 -- (-455.079) (-457.094) [-455.285] (-454.327) * (-456.622) [-454.808] (-462.279) (-455.695) -- 0:00:29
      550000 -- [-457.529] (-456.272) (-453.938) (-455.136) * [-455.302] (-453.707) (-462.167) (-453.756) -- 0:00:29

      Average standard deviation of split frequencies: 0.008618

      550500 -- (-455.949) (-455.258) [-456.058] (-455.224) * (-461.141) [-454.252] (-458.467) (-457.791) -- 0:00:29
      551000 -- [-456.146] (-455.473) (-454.610) (-459.661) * [-458.235] (-454.320) (-458.703) (-461.908) -- 0:00:29
      551500 -- (-457.921) [-454.991] (-454.900) (-461.251) * (-456.374) [-453.772] (-455.550) (-458.002) -- 0:00:29
      552000 -- [-459.547] (-457.676) (-456.168) (-454.653) * (-457.915) (-457.173) (-458.129) [-457.361] -- 0:00:29
      552500 -- [-454.499] (-455.471) (-454.900) (-454.035) * (-453.968) [-454.554] (-458.622) (-455.877) -- 0:00:29
      553000 -- (-455.676) [-462.769] (-455.082) (-454.035) * (-457.389) (-458.726) (-461.380) [-457.346] -- 0:00:29
      553500 -- (-453.848) (-455.012) (-458.095) [-454.965] * (-454.642) (-453.768) [-455.020] (-456.813) -- 0:00:29
      554000 -- (-457.626) [-456.191] (-457.174) (-456.512) * [-455.504] (-454.656) (-455.462) (-460.663) -- 0:00:29
      554500 -- (-454.293) [-456.371] (-454.418) (-454.161) * (-455.038) (-454.027) [-454.517] (-455.636) -- 0:00:29
      555000 -- [-456.748] (-456.478) (-459.252) (-459.883) * (-456.987) (-454.183) [-455.278] (-457.737) -- 0:00:29

      Average standard deviation of split frequencies: 0.008648

      555500 -- [-457.482] (-455.811) (-454.665) (-455.743) * (-454.253) (-454.894) [-457.174] (-458.424) -- 0:00:29
      556000 -- (-455.573) (-454.441) (-454.735) [-454.490] * (-456.297) (-455.355) (-454.198) [-453.626] -- 0:00:29
      556500 -- [-455.524] (-455.331) (-454.457) (-455.048) * [-456.181] (-457.688) (-454.500) (-456.298) -- 0:00:29
      557000 -- (-454.609) (-457.887) (-454.178) [-455.480] * (-454.641) (-457.404) [-457.733] (-457.061) -- 0:00:29
      557500 -- (-456.250) (-454.732) [-454.241] (-455.580) * (-454.703) (-454.367) (-455.761) [-458.713] -- 0:00:29
      558000 -- (-456.759) (-455.226) [-454.034] (-455.669) * (-454.765) [-456.450] (-453.849) (-459.533) -- 0:00:29
      558500 -- (-454.540) [-455.429] (-460.090) (-454.749) * [-459.768] (-456.897) (-454.672) (-455.043) -- 0:00:29
      559000 -- [-456.887] (-455.637) (-455.584) (-455.516) * (-460.069) [-453.930] (-463.137) (-458.546) -- 0:00:29
      559500 -- (-456.176) [-457.400] (-455.577) (-455.275) * [-459.663] (-454.439) (-458.004) (-454.978) -- 0:00:29
      560000 -- [-456.318] (-454.926) (-456.027) (-459.142) * (-459.645) (-453.708) [-457.414] (-456.601) -- 0:00:29

      Average standard deviation of split frequencies: 0.008520

      560500 -- (-455.273) (-456.168) (-454.731) [-459.148] * [-458.318] (-454.966) (-456.569) (-455.577) -- 0:00:29
      561000 -- [-456.906] (-455.603) (-454.695) (-459.506) * (-458.801) (-457.345) (-459.494) [-455.037] -- 0:00:28
      561500 -- (-457.763) (-456.151) [-454.059] (-460.272) * [-455.032] (-454.468) (-455.029) (-456.961) -- 0:00:28
      562000 -- (-455.965) (-454.278) [-456.937] (-454.755) * [-454.527] (-455.559) (-456.668) (-456.188) -- 0:00:28
      562500 -- (-458.130) (-453.869) (-455.878) [-453.799] * (-455.510) [-454.271] (-456.166) (-456.869) -- 0:00:28
      563000 -- (-456.960) [-454.461] (-454.901) (-453.960) * (-454.146) [-458.593] (-455.593) (-460.382) -- 0:00:28
      563500 -- [-457.583] (-455.997) (-456.202) (-457.457) * (-456.263) [-458.772] (-454.454) (-456.991) -- 0:00:28
      564000 -- [-454.648] (-456.073) (-454.744) (-455.491) * (-457.060) (-454.809) (-456.919) [-455.352] -- 0:00:28
      564500 -- [-456.488] (-457.194) (-457.830) (-458.117) * (-457.889) (-455.870) (-454.337) [-459.279] -- 0:00:28
      565000 -- (-460.683) (-456.028) (-455.107) [-456.632] * [-457.757] (-456.210) (-455.056) (-456.527) -- 0:00:28

      Average standard deviation of split frequencies: 0.008606

      565500 -- (-455.813) (-456.845) [-454.273] (-456.375) * (-455.670) [-455.122] (-456.999) (-456.554) -- 0:00:28
      566000 -- (-463.372) (-455.925) [-455.422] (-458.914) * [-454.574] (-459.702) (-455.338) (-461.024) -- 0:00:28
      566500 -- [-454.634] (-454.960) (-456.453) (-456.349) * [-458.223] (-455.873) (-454.592) (-457.434) -- 0:00:28
      567000 -- (-455.077) (-460.322) (-454.925) [-457.691] * (-457.942) (-456.762) [-455.970] (-457.234) -- 0:00:28
      567500 -- (-458.647) (-455.058) (-455.210) [-457.217] * (-457.970) (-455.237) (-455.115) [-457.769] -- 0:00:28
      568000 -- (-457.787) [-454.528] (-454.798) (-458.798) * (-460.041) (-455.775) [-455.094] (-456.336) -- 0:00:28
      568500 -- (-457.039) (-460.936) (-454.554) [-456.848] * [-455.180] (-454.804) (-456.987) (-459.556) -- 0:00:28
      569000 -- [-456.186] (-456.960) (-455.226) (-454.826) * [-458.442] (-454.288) (-455.234) (-460.491) -- 0:00:28
      569500 -- (-454.744) [-458.301] (-456.273) (-455.231) * (-455.898) [-456.315] (-454.038) (-457.003) -- 0:00:28
      570000 -- (-458.310) (-455.479) (-457.613) [-454.344] * [-455.402] (-458.711) (-456.856) (-455.003) -- 0:00:28

      Average standard deviation of split frequencies: 0.008591

      570500 -- (-457.214) (-456.361) [-461.536] (-456.133) * (-459.486) (-457.771) [-454.932] (-458.047) -- 0:00:28
      571000 -- (-458.091) (-453.759) [-454.503] (-457.542) * [-456.363] (-459.728) (-459.968) (-456.707) -- 0:00:28
      571500 -- (-457.649) [-456.288] (-455.771) (-454.841) * (-455.935) (-456.171) (-459.274) [-455.436] -- 0:00:28
      572000 -- (-456.571) (-454.770) [-456.156] (-455.289) * (-455.738) [-456.573] (-456.593) (-456.568) -- 0:00:28
      572500 -- (-457.353) [-458.284] (-458.065) (-456.487) * (-456.324) (-456.607) (-455.821) [-457.156] -- 0:00:28
      573000 -- (-455.016) [-457.702] (-460.387) (-457.557) * (-457.151) (-454.593) [-455.602] (-456.517) -- 0:00:28
      573500 -- (-454.484) [-458.140] (-454.976) (-456.169) * (-457.208) (-454.743) [-453.790] (-454.352) -- 0:00:28
      574000 -- (-455.169) (-453.818) (-457.906) [-454.353] * (-456.727) (-457.084) [-454.513] (-455.669) -- 0:00:28
      574500 -- [-454.115] (-456.860) (-458.209) (-455.460) * [-456.403] (-461.958) (-454.348) (-456.375) -- 0:00:28
      575000 -- (-458.388) [-454.935] (-456.278) (-458.848) * (-459.793) (-458.374) (-454.736) [-455.349] -- 0:00:28

      Average standard deviation of split frequencies: 0.008621

      575500 -- [-455.982] (-455.906) (-456.309) (-459.790) * (-456.383) [-456.246] (-454.397) (-457.007) -- 0:00:28
      576000 -- (-457.797) (-457.340) (-457.727) [-455.815] * [-455.487] (-454.606) (-455.222) (-454.549) -- 0:00:27
      576500 -- (-455.784) (-458.639) [-457.428] (-454.307) * (-458.645) (-454.865) [-455.498] (-454.613) -- 0:00:27
      577000 -- (-459.233) (-454.229) [-456.709] (-459.343) * (-455.380) [-454.573] (-455.194) (-457.271) -- 0:00:27
      577500 -- (-458.954) (-457.570) (-455.909) [-456.671] * (-454.396) (-457.022) [-454.209] (-457.664) -- 0:00:27
      578000 -- [-455.466] (-457.613) (-453.896) (-460.362) * (-456.333) [-455.252] (-453.956) (-455.479) -- 0:00:27
      578500 -- (-455.928) (-458.717) [-458.087] (-459.105) * (-459.282) (-456.840) (-455.834) [-453.744] -- 0:00:27
      579000 -- (-454.544) (-457.050) (-457.876) [-455.369] * (-456.385) (-454.924) [-456.716] (-455.945) -- 0:00:27
      579500 -- (-454.756) (-460.689) (-454.267) [-454.776] * (-455.281) (-454.356) [-457.504] (-456.347) -- 0:00:27
      580000 -- [-455.588] (-457.300) (-456.517) (-457.723) * (-460.252) (-455.661) [-454.328] (-455.672) -- 0:00:27

      Average standard deviation of split frequencies: 0.008497

      580500 -- (-455.824) (-455.360) [-455.510] (-458.505) * [-456.771] (-456.817) (-454.221) (-455.286) -- 0:00:27
      581000 -- (-458.504) [-457.221] (-455.171) (-458.359) * (-456.784) (-456.614) (-455.941) [-457.359] -- 0:00:27
      581500 -- (-458.796) (-454.140) [-455.084] (-456.026) * (-455.771) (-455.909) (-456.595) [-456.546] -- 0:00:27
      582000 -- (-457.058) [-454.985] (-457.181) (-455.992) * (-456.860) (-454.959) [-458.568] (-454.285) -- 0:00:27
      582500 -- (-457.362) (-456.451) (-456.477) [-455.680] * [-457.887] (-456.168) (-458.121) (-454.186) -- 0:00:27
      583000 -- (-456.636) (-456.907) (-455.064) [-454.640] * (-457.534) [-455.087] (-455.157) (-455.476) -- 0:00:27
      583500 -- (-456.783) (-455.153) (-455.834) [-454.087] * (-455.014) (-454.817) (-455.984) [-454.711] -- 0:00:27
      584000 -- (-460.771) (-455.240) [-458.796] (-454.899) * (-454.586) (-456.087) [-455.905] (-455.231) -- 0:00:27
      584500 -- (-460.040) [-457.140] (-455.277) (-458.737) * [-455.208] (-454.270) (-456.335) (-454.191) -- 0:00:27
      585000 -- (-456.094) [-456.001] (-455.204) (-454.032) * (-459.324) (-459.347) [-460.225] (-454.878) -- 0:00:27

      Average standard deviation of split frequencies: 0.008527

      585500 -- (-456.531) [-453.828] (-455.866) (-456.076) * (-454.633) [-455.973] (-455.052) (-455.595) -- 0:00:27
      586000 -- (-456.911) (-456.716) (-456.577) [-459.002] * [-454.785] (-456.576) (-459.391) (-457.032) -- 0:00:27
      586500 -- (-454.462) [-456.764] (-458.067) (-458.971) * [-453.919] (-456.344) (-459.723) (-457.256) -- 0:00:27
      587000 -- (-457.439) (-457.172) (-456.825) [-455.379] * (-454.862) [-457.501] (-458.165) (-455.512) -- 0:00:27
      587500 -- [-455.740] (-461.973) (-459.097) (-459.277) * (-456.747) [-458.538] (-457.056) (-454.489) -- 0:00:27
      588000 -- (-461.418) [-456.448] (-455.972) (-456.311) * (-458.048) [-457.977] (-457.521) (-456.176) -- 0:00:27
      588500 -- (-459.826) [-454.838] (-455.442) (-455.381) * (-455.321) [-457.299] (-455.145) (-458.489) -- 0:00:27
      589000 -- (-456.514) (-456.001) [-456.039] (-454.548) * (-455.240) (-456.901) (-456.579) [-455.730] -- 0:00:27
      589500 -- [-455.220] (-454.472) (-454.189) (-455.571) * [-454.210] (-457.722) (-456.928) (-454.418) -- 0:00:27
      590000 -- (-455.285) (-456.727) [-454.109] (-457.224) * (-455.012) (-456.820) [-457.591] (-456.360) -- 0:00:27

      Average standard deviation of split frequencies: 0.008141

      590500 -- [-455.437] (-456.264) (-461.773) (-453.876) * (-456.828) (-454.764) [-455.422] (-458.250) -- 0:00:27
      591000 -- (-456.954) (-455.355) (-458.638) [-454.593] * (-456.467) (-456.336) (-455.343) [-455.543] -- 0:00:26
      591500 -- (-453.933) (-455.353) (-456.449) [-459.211] * (-455.285) [-454.956] (-454.686) (-455.899) -- 0:00:26
      592000 -- (-463.329) (-457.836) [-456.609] (-454.355) * (-456.110) (-458.218) (-455.152) [-457.775] -- 0:00:26
      592500 -- (-454.689) (-454.063) [-455.026] (-454.211) * (-456.236) (-460.669) (-454.892) [-454.840] -- 0:00:26
      593000 -- (-456.253) (-456.419) (-454.383) [-456.004] * (-457.016) (-455.036) [-455.505] (-456.177) -- 0:00:26
      593500 -- (-454.835) (-456.720) [-454.097] (-456.322) * (-458.283) (-455.221) [-455.844] (-454.562) -- 0:00:26
      594000 -- (-456.390) [-463.671] (-458.587) (-456.931) * [-454.314] (-456.965) (-454.716) (-454.614) -- 0:00:26
      594500 -- (-456.225) (-464.576) (-457.718) [-460.583] * (-454.664) [-455.640] (-453.889) (-456.757) -- 0:00:26
      595000 -- (-455.861) [-458.591] (-460.466) (-456.980) * (-454.171) [-457.300] (-455.399) (-454.947) -- 0:00:26

      Average standard deviation of split frequencies: 0.008489

      595500 -- [-457.149] (-454.075) (-454.731) (-461.113) * [-456.798] (-454.107) (-458.206) (-456.117) -- 0:00:26
      596000 -- (-459.586) [-455.288] (-458.235) (-456.505) * (-455.606) [-454.157] (-456.673) (-455.521) -- 0:00:26
      596500 -- (-456.775) (-454.338) [-457.527] (-456.614) * (-458.612) (-455.805) (-456.080) [-457.495] -- 0:00:26
      597000 -- [-453.789] (-455.779) (-456.888) (-455.918) * [-454.691] (-456.730) (-454.453) (-457.688) -- 0:00:26
      597500 -- (-458.594) (-458.233) [-455.842] (-455.485) * (-456.815) [-456.655] (-454.439) (-455.790) -- 0:00:26
      598000 -- (-456.534) (-455.166) [-455.210] (-454.986) * [-458.994] (-458.382) (-459.224) (-459.576) -- 0:00:26
      598500 -- (-453.891) (-457.473) (-456.101) [-455.951] * (-459.193) (-461.999) (-458.462) [-456.242] -- 0:00:26
      599000 -- [-454.737] (-456.113) (-455.359) (-455.312) * (-454.772) [-455.041] (-456.192) (-454.658) -- 0:00:26
      599500 -- (-455.872) [-454.953] (-456.222) (-457.323) * [-457.270] (-454.999) (-458.085) (-456.106) -- 0:00:26
      600000 -- [-457.398] (-456.510) (-456.565) (-458.546) * (-455.925) [-455.429] (-458.131) (-455.825) -- 0:00:26

      Average standard deviation of split frequencies: 0.007953

      600500 -- (-456.031) [-455.380] (-454.616) (-455.015) * (-456.357) (-457.184) [-456.791] (-453.940) -- 0:00:26
      601000 -- (-454.523) [-455.783] (-456.800) (-455.581) * [-455.049] (-462.447) (-459.834) (-453.904) -- 0:00:26
      601500 -- (-456.228) [-454.185] (-456.224) (-458.082) * (-457.870) [-455.361] (-456.856) (-453.747) -- 0:00:26
      602000 -- (-455.959) [-454.779] (-455.789) (-457.273) * (-457.280) [-455.777] (-457.994) (-456.619) -- 0:00:26
      602500 -- (-459.863) (-457.260) (-457.427) [-454.530] * (-457.942) (-455.574) (-455.930) [-454.848] -- 0:00:26
      603000 -- (-458.548) (-457.085) [-455.932] (-457.556) * [-453.929] (-457.483) (-457.482) (-456.014) -- 0:00:26
      603500 -- (-459.458) (-455.991) (-455.307) [-456.822] * (-457.627) (-456.817) (-454.685) [-455.141] -- 0:00:26
      604000 -- (-458.772) [-457.569] (-454.448) (-458.292) * [-456.179] (-458.003) (-454.781) (-454.912) -- 0:00:26
      604500 -- (-459.348) (-457.054) (-453.887) [-455.184] * [-457.134] (-457.178) (-456.594) (-455.589) -- 0:00:26
      605000 -- (-454.771) (-461.222) (-453.684) [-455.530] * [-455.860] (-455.843) (-455.486) (-458.224) -- 0:00:26

      Average standard deviation of split frequencies: 0.008246

      605500 -- [-455.675] (-454.269) (-454.971) (-456.759) * (-456.954) (-457.989) [-454.268] (-455.685) -- 0:00:26
      606000 -- (-457.201) [-454.409] (-454.365) (-456.803) * (-455.994) [-459.190] (-458.209) (-456.248) -- 0:00:26
      606500 -- (-456.754) [-456.038] (-456.864) (-456.375) * [-454.669] (-457.284) (-457.223) (-455.361) -- 0:00:25
      607000 -- (-456.063) (-456.561) (-458.032) [-459.709] * (-454.523) (-459.430) (-456.086) [-460.019] -- 0:00:25
      607500 -- (-456.231) [-455.861] (-459.470) (-461.102) * (-459.813) (-456.894) (-457.513) [-454.547] -- 0:00:25
      608000 -- [-454.467] (-454.161) (-455.319) (-456.848) * (-454.655) [-454.452] (-458.328) (-455.259) -- 0:00:25
      608500 -- (-454.040) (-456.059) (-454.486) [-454.217] * (-458.010) (-457.540) [-455.753] (-458.804) -- 0:00:25
      609000 -- (-456.229) (-455.351) [-454.211] (-455.635) * (-458.949) (-454.911) [-455.478] (-454.846) -- 0:00:25
      609500 -- (-455.529) (-457.423) (-455.513) [-453.794] * (-454.134) [-454.615] (-454.552) (-454.690) -- 0:00:25
      610000 -- (-454.763) (-458.403) (-454.686) [-455.275] * (-457.010) [-456.826] (-455.278) (-459.914) -- 0:00:25

      Average standard deviation of split frequencies: 0.008286

      610500 -- (-455.457) [-460.828] (-454.802) (-455.129) * (-455.970) [-456.476] (-453.965) (-458.352) -- 0:00:25
      611000 -- (-457.897) (-458.221) (-457.473) [-456.487] * (-456.048) (-454.870) [-454.067] (-458.350) -- 0:00:25
      611500 -- [-457.517] (-460.081) (-453.840) (-455.542) * (-457.965) [-455.437] (-457.238) (-454.675) -- 0:00:25
      612000 -- (-459.006) (-455.648) [-458.497] (-458.640) * (-455.759) [-457.998] (-454.043) (-455.623) -- 0:00:25
      612500 -- (-455.198) [-456.948] (-454.398) (-455.921) * [-453.972] (-455.196) (-456.480) (-458.183) -- 0:00:25
      613000 -- [-457.352] (-455.835) (-456.526) (-455.662) * [-454.259] (-454.765) (-456.640) (-457.008) -- 0:00:25
      613500 -- [-454.715] (-455.220) (-460.872) (-454.806) * [-455.447] (-455.959) (-457.658) (-456.702) -- 0:00:25
      614000 -- (-455.700) (-455.210) [-458.862] (-459.369) * (-455.004) (-454.215) (-456.783) [-458.302] -- 0:00:25
      614500 -- (-458.444) (-456.418) (-457.703) [-456.415] * (-456.568) (-455.308) (-458.883) [-454.942] -- 0:00:25
      615000 -- (-454.458) (-455.701) [-457.345] (-462.746) * (-456.811) (-455.249) [-455.119] (-454.113) -- 0:00:25

      Average standard deviation of split frequencies: 0.008848

      615500 -- [-457.912] (-456.159) (-457.185) (-455.187) * (-460.375) (-454.214) (-455.747) [-456.129] -- 0:00:25
      616000 -- [-459.460] (-455.072) (-455.528) (-454.974) * (-456.246) [-454.247] (-455.297) (-459.309) -- 0:00:25
      616500 -- (-456.199) [-458.085] (-455.373) (-455.698) * [-456.756] (-455.559) (-458.792) (-455.947) -- 0:00:25
      617000 -- (-454.716) (-457.218) (-454.898) [-459.310] * (-456.516) (-454.692) (-454.582) [-457.916] -- 0:00:25
      617500 -- (-456.815) (-455.875) [-454.410] (-455.894) * [-456.504] (-457.194) (-458.969) (-456.593) -- 0:00:25
      618000 -- (-455.759) [-455.563] (-453.944) (-459.942) * (-455.080) (-457.856) [-457.405] (-454.824) -- 0:00:25
      618500 -- [-458.282] (-456.634) (-454.273) (-454.270) * (-455.336) (-456.707) (-459.624) [-458.231] -- 0:00:25
      619000 -- (-456.191) (-453.877) [-454.228] (-454.990) * [-454.210] (-454.547) (-454.572) (-455.368) -- 0:00:25
      619500 -- (-463.243) [-454.220] (-457.650) (-456.767) * [-453.839] (-454.537) (-455.277) (-456.582) -- 0:00:25
      620000 -- (-455.851) (-458.264) (-454.542) [-457.839] * (-457.762) (-457.547) (-455.636) [-456.400] -- 0:00:25

      Average standard deviation of split frequencies: 0.009257

      620500 -- (-454.708) (-458.542) [-457.054] (-454.598) * (-455.619) [-453.902] (-455.401) (-456.751) -- 0:00:25
      621000 -- (-454.303) (-456.757) (-455.055) [-455.072] * (-454.733) [-456.892] (-454.878) (-460.587) -- 0:00:25
      621500 -- (-455.500) [-455.357] (-453.961) (-458.000) * (-458.586) (-456.008) (-453.647) [-455.175] -- 0:00:24
      622000 -- (-455.713) (-455.743) [-453.641] (-458.417) * (-455.332) (-454.338) [-456.389] (-454.101) -- 0:00:24
      622500 -- (-454.978) [-456.307] (-457.234) (-456.584) * (-456.055) (-461.764) (-458.155) [-456.186] -- 0:00:24
      623000 -- [-458.015] (-456.194) (-456.010) (-455.104) * (-458.572) (-458.037) [-454.232] (-461.279) -- 0:00:24
      623500 -- [-460.635] (-454.626) (-454.974) (-454.912) * (-456.766) (-453.737) [-455.584] (-456.601) -- 0:00:24
      624000 -- [-458.400] (-454.249) (-459.461) (-461.423) * [-455.579] (-455.729) (-456.225) (-453.984) -- 0:00:24
      624500 -- (-456.131) [-455.634] (-455.797) (-458.383) * (-454.785) (-456.455) (-455.729) [-454.424] -- 0:00:24
      625000 -- (-457.850) (-453.918) [-454.900] (-456.938) * (-456.732) (-456.497) [-454.694] (-457.588) -- 0:00:24

      Average standard deviation of split frequencies: 0.008848

      625500 -- (-458.204) (-454.653) [-455.849] (-456.052) * [-454.674] (-457.359) (-455.852) (-456.333) -- 0:00:24
      626000 -- (-455.786) (-455.407) [-459.370] (-456.772) * (-455.907) (-457.813) [-455.011] (-462.188) -- 0:00:24
      626500 -- [-455.865] (-455.400) (-453.822) (-457.169) * [-454.939] (-454.938) (-456.341) (-456.762) -- 0:00:24
      627000 -- (-458.889) (-459.157) [-454.776] (-455.908) * (-458.127) [-454.283] (-456.249) (-458.256) -- 0:00:24
      627500 -- (-454.746) (-458.273) [-454.559] (-456.789) * (-457.181) (-454.513) [-454.861] (-458.251) -- 0:00:24
      628000 -- (-455.608) [-455.716] (-456.083) (-455.777) * (-455.760) (-456.288) (-454.935) [-454.666] -- 0:00:24
      628500 -- (-454.859) (-457.610) [-455.351] (-455.248) * (-453.649) (-455.194) (-455.333) [-460.494] -- 0:00:24
      629000 -- [-454.922] (-454.866) (-459.726) (-454.872) * (-454.692) (-456.433) (-455.611) [-455.016] -- 0:00:24
      629500 -- (-457.250) (-456.697) (-458.372) [-456.490] * [-455.437] (-458.046) (-455.181) (-453.579) -- 0:00:24
      630000 -- [-456.940] (-459.234) (-460.997) (-458.001) * [-455.523] (-458.717) (-456.905) (-456.162) -- 0:00:24

      Average standard deviation of split frequencies: 0.008829

      630500 -- (-455.436) [-454.292] (-460.659) (-460.974) * (-456.663) [-457.715] (-455.933) (-453.806) -- 0:00:24
      631000 -- (-454.869) [-454.606] (-456.445) (-458.210) * [-456.457] (-455.578) (-455.888) (-454.513) -- 0:00:24
      631500 -- (-456.772) [-455.171] (-454.735) (-457.222) * (-453.965) (-455.873) [-457.186] (-456.756) -- 0:00:24
      632000 -- (-455.112) [-455.588] (-453.999) (-458.618) * (-459.004) (-455.711) [-454.934] (-456.646) -- 0:00:24
      632500 -- [-458.827] (-455.632) (-459.491) (-455.806) * (-456.531) (-456.135) (-454.730) [-455.655] -- 0:00:24
      633000 -- (-454.797) (-455.789) [-455.666] (-454.546) * (-456.255) (-454.780) [-455.010] (-458.924) -- 0:00:24
      633500 -- [-455.202] (-457.525) (-456.774) (-455.290) * [-456.946] (-458.016) (-455.125) (-455.022) -- 0:00:24
      634000 -- (-455.606) (-456.320) [-455.418] (-455.877) * (-456.531) [-455.190] (-454.495) (-456.947) -- 0:00:24
      634500 -- [-455.130] (-459.247) (-456.032) (-457.295) * (-460.212) (-457.593) (-456.373) [-454.358] -- 0:00:24
      635000 -- (-455.394) (-456.418) (-460.872) [-455.547] * (-455.838) (-459.130) [-459.696] (-453.998) -- 0:00:24

      Average standard deviation of split frequencies: 0.008524

      635500 -- (-454.191) (-456.140) [-456.765] (-455.539) * (-457.589) (-458.990) [-457.180] (-454.875) -- 0:00:24
      636000 -- [-454.535] (-457.184) (-458.458) (-455.723) * (-456.778) [-456.343] (-457.494) (-455.675) -- 0:00:24
      636500 -- (-456.758) (-455.919) [-454.415] (-458.463) * (-457.589) (-460.613) (-454.895) [-455.751] -- 0:00:23
      637000 -- [-454.694] (-455.163) (-455.877) (-456.366) * (-456.804) (-454.455) (-454.844) [-455.818] -- 0:00:23
      637500 -- (-457.245) [-455.820] (-454.759) (-456.141) * (-454.737) [-453.686] (-455.694) (-458.695) -- 0:00:23
      638000 -- (-456.850) [-454.073] (-458.991) (-456.840) * (-455.279) (-454.086) (-456.499) [-454.898] -- 0:00:23
      638500 -- [-454.964] (-455.734) (-459.014) (-459.887) * (-463.570) [-454.353] (-460.683) (-458.624) -- 0:00:23
      639000 -- (-454.112) (-453.921) [-454.661] (-461.000) * [-458.511] (-454.348) (-455.029) (-457.595) -- 0:00:23
      639500 -- (-454.236) [-458.173] (-453.991) (-460.089) * (-455.455) (-454.508) [-454.439] (-455.517) -- 0:00:23
      640000 -- (-458.318) (-460.873) [-454.630] (-455.376) * (-457.470) [-455.306] (-456.509) (-456.189) -- 0:00:23

      Average standard deviation of split frequencies: 0.008045

      640500 -- (-462.531) [-459.030] (-454.306) (-456.201) * (-455.091) [-456.868] (-456.910) (-460.427) -- 0:00:23
      641000 -- (-460.009) (-455.982) (-453.581) [-460.436] * (-454.379) (-456.089) [-455.817] (-455.556) -- 0:00:23
      641500 -- (-461.812) [-454.784] (-455.936) (-458.161) * (-454.872) (-455.166) (-455.907) [-455.256] -- 0:00:23
      642000 -- (-458.533) [-455.801] (-458.462) (-457.179) * (-461.172) (-455.215) [-455.678] (-455.121) -- 0:00:23
      642500 -- (-457.685) (-454.891) [-458.709] (-455.186) * (-457.864) [-455.294] (-457.792) (-455.929) -- 0:00:23
      643000 -- (-456.215) (-455.540) [-457.196] (-459.393) * [-454.171] (-454.310) (-454.832) (-455.919) -- 0:00:23
      643500 -- (-455.541) [-454.273] (-455.089) (-456.122) * (-457.399) [-458.067] (-456.129) (-456.441) -- 0:00:23
      644000 -- [-456.566] (-454.141) (-454.754) (-457.421) * (-454.077) (-456.210) (-458.404) [-454.926] -- 0:00:23
      644500 -- (-456.556) [-454.053] (-454.976) (-456.641) * (-456.650) [-455.881] (-455.302) (-454.334) -- 0:00:23
      645000 -- (-457.599) [-454.580] (-454.011) (-456.810) * (-456.144) (-460.071) [-454.348] (-458.939) -- 0:00:23

      Average standard deviation of split frequencies: 0.008301

      645500 -- (-457.152) (-456.443) (-454.930) [-456.013] * (-453.706) (-456.901) (-455.207) [-453.681] -- 0:00:23
      646000 -- [-455.954] (-454.957) (-455.096) (-457.401) * (-454.292) (-462.625) (-455.302) [-456.847] -- 0:00:23
      646500 -- (-455.643) [-457.581] (-458.456) (-458.759) * (-455.143) (-454.441) (-454.421) [-456.968] -- 0:00:23
      647000 -- (-454.929) (-456.230) (-455.999) [-455.244] * (-455.716) (-457.835) [-454.797] (-455.090) -- 0:00:23
      647500 -- (-457.956) (-457.280) (-455.175) [-454.556] * (-457.074) (-458.788) [-455.519] (-454.437) -- 0:00:23
      648000 -- [-455.590] (-455.367) (-455.643) (-456.906) * [-460.267] (-455.095) (-455.026) (-453.902) -- 0:00:23
      648500 -- [-455.830] (-454.404) (-457.388) (-456.432) * (-456.227) (-455.724) (-454.727) [-455.797] -- 0:00:23
      649000 -- [-454.706] (-455.261) (-457.605) (-454.167) * (-455.399) [-455.983] (-454.248) (-455.790) -- 0:00:23
      649500 -- [-455.459] (-458.034) (-455.787) (-454.518) * (-453.684) (-459.594) [-455.911] (-455.506) -- 0:00:23
      650000 -- [-453.935] (-459.553) (-457.333) (-453.925) * (-453.684) (-461.507) [-455.708] (-458.261) -- 0:00:23

      Average standard deviation of split frequencies: 0.008114

      650500 -- (-454.637) [-457.626] (-458.220) (-455.208) * (-453.944) (-459.001) (-454.816) [-455.449] -- 0:00:23
      651000 -- (-454.379) (-455.820) [-455.995] (-454.901) * [-458.984] (-454.043) (-458.773) (-454.586) -- 0:00:23
      651500 -- (-458.404) (-454.035) (-456.228) [-456.218] * [-457.714] (-453.661) (-458.765) (-456.453) -- 0:00:23
      652000 -- [-455.320] (-455.983) (-458.717) (-457.618) * (-456.326) (-457.795) [-456.863] (-463.226) -- 0:00:22
      652500 -- (-458.265) (-458.441) [-454.372] (-457.848) * (-457.123) (-458.549) [-456.064] (-463.376) -- 0:00:22
      653000 -- (-458.957) (-454.245) (-454.627) [-456.791] * (-456.716) (-455.642) [-458.426] (-458.157) -- 0:00:22
      653500 -- (-460.253) (-454.422) [-456.253] (-459.890) * (-456.158) [-455.319] (-455.650) (-455.693) -- 0:00:22
      654000 -- (-460.970) [-454.186] (-457.906) (-457.204) * (-457.291) (-454.940) [-460.069] (-456.157) -- 0:00:22
      654500 -- (-458.102) [-457.316] (-455.344) (-457.858) * (-459.316) [-454.096] (-454.538) (-455.567) -- 0:00:22
      655000 -- [-458.010] (-454.336) (-458.955) (-457.067) * (-454.296) [-455.807] (-456.860) (-457.309) -- 0:00:22

      Average standard deviation of split frequencies: 0.007809

      655500 -- (-454.468) (-454.639) (-457.119) [-454.490] * (-455.919) [-454.272] (-456.448) (-460.101) -- 0:00:22
      656000 -- (-454.241) (-454.074) (-456.189) [-454.199] * (-454.871) [-458.002] (-456.057) (-455.336) -- 0:00:22
      656500 -- (-459.505) (-454.086) (-455.935) [-454.874] * [-456.463] (-458.658) (-458.892) (-457.935) -- 0:00:22
      657000 -- (-458.484) [-457.861] (-455.269) (-454.978) * (-454.561) [-459.676] (-456.172) (-453.835) -- 0:00:22
      657500 -- (-454.907) [-455.870] (-456.159) (-454.322) * (-454.995) [-455.506] (-456.259) (-453.823) -- 0:00:22
      658000 -- [-458.362] (-459.096) (-454.637) (-455.253) * (-454.668) [-457.212] (-456.858) (-455.509) -- 0:00:22
      658500 -- [-453.933] (-455.819) (-457.382) (-456.298) * [-453.845] (-458.139) (-455.512) (-455.773) -- 0:00:22
      659000 -- (-456.756) [-457.111] (-456.181) (-457.209) * [-454.183] (-457.683) (-457.631) (-454.120) -- 0:00:22
      659500 -- [-454.167] (-457.510) (-454.816) (-454.505) * [-457.696] (-455.751) (-455.761) (-456.640) -- 0:00:22
      660000 -- [-454.522] (-461.848) (-456.197) (-455.718) * (-465.814) [-460.756] (-454.372) (-458.269) -- 0:00:22

      Average standard deviation of split frequencies: 0.007706

      660500 -- (-454.549) (-455.929) (-458.956) [-460.075] * (-455.610) (-454.782) [-455.537] (-455.032) -- 0:00:22
      661000 -- (-454.783) (-455.435) (-458.307) [-459.277] * (-456.482) (-454.347) (-456.589) [-454.954] -- 0:00:22
      661500 -- (-454.062) [-456.566] (-458.280) (-458.423) * (-457.372) [-454.575] (-454.216) (-455.499) -- 0:00:22
      662000 -- [-455.173] (-454.987) (-455.334) (-461.049) * [-454.727] (-456.841) (-456.889) (-454.363) -- 0:00:22
      662500 -- [-455.988] (-458.607) (-454.403) (-456.381) * (-462.767) (-458.665) [-458.898] (-456.867) -- 0:00:22
      663000 -- (-461.200) (-458.655) [-458.028] (-454.327) * (-458.266) (-457.191) (-458.168) [-457.413] -- 0:00:22
      663500 -- (-456.242) (-456.600) (-461.599) [-455.712] * (-458.771) (-457.014) (-460.863) [-454.823] -- 0:00:22
      664000 -- [-456.637] (-457.261) (-456.982) (-454.736) * (-457.044) (-455.765) [-454.574] (-461.150) -- 0:00:22
      664500 -- (-456.342) (-455.744) [-455.648] (-454.290) * (-458.047) [-456.238] (-455.992) (-456.621) -- 0:00:22
      665000 -- (-456.654) [-453.906] (-458.012) (-459.424) * [-457.020] (-454.394) (-454.659) (-458.723) -- 0:00:22

      Average standard deviation of split frequencies: 0.007880

      665500 -- (-456.744) (-458.908) (-457.076) [-456.351] * (-454.084) [-454.380] (-454.216) (-455.363) -- 0:00:22
      666000 -- (-455.384) (-455.413) [-454.596] (-453.903) * (-454.105) [-458.248] (-454.197) (-457.781) -- 0:00:22
      666500 -- [-454.821] (-456.077) (-455.981) (-459.956) * [-454.292] (-457.780) (-458.811) (-455.467) -- 0:00:22
      667000 -- (-455.377) [-454.991] (-455.178) (-455.353) * (-456.029) (-454.785) (-453.632) [-454.842] -- 0:00:21
      667500 -- (-458.316) (-455.783) (-454.194) [-458.588] * [-456.309] (-456.461) (-454.591) (-455.747) -- 0:00:21
      668000 -- [-456.625] (-455.735) (-454.405) (-454.926) * (-455.481) (-455.908) [-455.017] (-458.342) -- 0:00:21
      668500 -- (-455.342) (-456.773) (-454.024) [-458.197] * (-456.043) [-455.265] (-454.933) (-458.070) -- 0:00:21
      669000 -- (-460.961) [-455.346] (-456.066) (-461.243) * [-457.028] (-455.951) (-455.612) (-455.771) -- 0:00:21
      669500 -- [-458.934] (-454.507) (-459.547) (-457.584) * (-456.824) [-459.629] (-456.549) (-460.129) -- 0:00:21
      670000 -- (-456.700) (-456.194) (-454.304) [-457.812] * (-457.851) (-454.832) [-460.312] (-455.984) -- 0:00:21

      Average standard deviation of split frequencies: 0.007638

      670500 -- [-455.913] (-454.131) (-458.163) (-455.689) * (-456.155) (-456.645) [-454.435] (-457.296) -- 0:00:21
      671000 -- (-455.953) (-455.439) (-456.970) [-455.919] * (-454.475) (-457.585) [-457.708] (-458.902) -- 0:00:21
      671500 -- (-454.660) (-458.360) [-457.653] (-458.886) * (-456.065) [-456.746] (-457.702) (-454.090) -- 0:00:21
      672000 -- [-456.580] (-459.729) (-457.116) (-459.237) * [-455.566] (-456.381) (-456.254) (-455.487) -- 0:00:21
      672500 -- (-455.559) [-456.541] (-455.172) (-455.989) * (-458.411) (-455.508) [-454.446] (-456.528) -- 0:00:21
      673000 -- (-456.597) [-456.306] (-456.366) (-455.173) * [-459.099] (-455.660) (-455.451) (-456.247) -- 0:00:21
      673500 -- (-456.375) [-455.504] (-456.335) (-459.086) * (-457.128) (-454.044) (-454.481) [-455.695] -- 0:00:21
      674000 -- (-455.754) (-458.078) [-455.173] (-456.633) * (-454.638) (-454.600) [-456.386] (-454.792) -- 0:00:21
      674500 -- (-459.559) [-457.942] (-454.971) (-461.218) * (-456.280) (-456.414) [-455.221] (-454.652) -- 0:00:21
      675000 -- [-454.846] (-456.530) (-456.489) (-460.273) * [-454.303] (-458.134) (-456.325) (-455.450) -- 0:00:21

      Average standard deviation of split frequencies: 0.007810

      675500 -- (-454.067) [-454.554] (-456.908) (-454.007) * [-455.171] (-454.270) (-456.792) (-456.587) -- 0:00:21
      676000 -- (-453.742) (-458.606) [-455.504] (-461.574) * (-455.489) [-455.707] (-456.184) (-457.491) -- 0:00:21
      676500 -- (-454.210) (-455.229) (-457.844) [-454.440] * (-456.491) (-458.191) [-456.810] (-458.811) -- 0:00:21
      677000 -- (-454.287) (-457.582) [-459.830] (-456.701) * [-454.398] (-455.540) (-460.110) (-454.551) -- 0:00:21
      677500 -- [-454.675] (-459.068) (-454.714) (-461.921) * [-456.607] (-455.056) (-455.803) (-457.582) -- 0:00:21
      678000 -- (-455.085) (-458.520) (-456.871) [-455.706] * [-457.347] (-457.034) (-454.990) (-454.103) -- 0:00:21
      678500 -- [-454.801] (-457.954) (-456.507) (-454.927) * (-456.295) (-455.299) (-455.908) [-454.228] -- 0:00:21
      679000 -- (-455.611) (-454.443) [-454.148] (-455.475) * (-457.507) [-454.430] (-454.681) (-454.697) -- 0:00:21
      679500 -- (-459.359) [-454.396] (-454.870) (-455.050) * (-455.657) (-461.546) (-453.980) [-454.568] -- 0:00:21
      680000 -- (-454.902) (-455.208) (-456.286) [-456.232] * (-456.988) (-458.410) (-453.985) [-455.381] -- 0:00:21

      Average standard deviation of split frequencies: 0.007572

      680500 -- (-454.182) [-455.260] (-454.359) (-456.672) * (-458.431) (-458.347) (-454.339) [-454.078] -- 0:00:21
      681000 -- (-454.369) [-455.235] (-455.536) (-455.647) * [-458.541] (-462.744) (-457.949) (-454.324) -- 0:00:21
      681500 -- (-455.182) (-455.769) (-463.191) [-455.066] * [-456.310] (-462.854) (-455.481) (-455.495) -- 0:00:21
      682000 -- [-457.916] (-456.771) (-464.846) (-455.484) * (-458.366) (-457.649) [-455.772] (-454.999) -- 0:00:20
      682500 -- (-457.339) (-456.583) (-456.558) [-459.041] * (-460.086) (-455.544) [-454.851] (-455.558) -- 0:00:20
      683000 -- [-455.261] (-454.846) (-455.975) (-453.971) * (-457.616) (-454.218) [-454.130] (-456.036) -- 0:00:20
      683500 -- (-459.044) [-454.816] (-455.117) (-458.775) * (-454.479) (-454.011) (-457.504) [-455.535] -- 0:00:20
      684000 -- (-464.134) [-456.115] (-456.122) (-454.840) * (-456.800) (-454.808) (-460.088) [-460.438] -- 0:00:20
      684500 -- [-456.354] (-454.834) (-455.906) (-454.195) * (-455.253) [-454.556] (-454.897) (-456.971) -- 0:00:20
      685000 -- (-454.232) (-458.533) (-454.633) [-455.878] * [-459.846] (-453.895) (-456.042) (-454.526) -- 0:00:20

      Average standard deviation of split frequencies: 0.007376

      685500 -- (-455.043) (-455.732) [-454.280] (-455.751) * [-455.906] (-457.113) (-454.978) (-456.436) -- 0:00:20
      686000 -- (-455.268) [-455.894] (-457.419) (-457.677) * [-454.654] (-456.646) (-457.336) (-458.703) -- 0:00:20
      686500 -- (-456.292) (-455.479) [-455.930] (-454.741) * (-455.057) (-454.847) [-454.715] (-455.259) -- 0:00:20
      687000 -- (-456.686) (-454.569) (-455.321) [-454.163] * (-454.308) (-455.388) [-456.290] (-457.775) -- 0:00:20
      687500 -- (-455.184) [-458.490] (-456.679) (-458.162) * (-458.816) (-455.027) (-454.088) [-453.795] -- 0:00:20
      688000 -- (-454.552) [-455.669] (-458.641) (-456.611) * (-456.895) (-460.850) [-454.027] (-454.180) -- 0:00:20
      688500 -- (-455.180) (-455.031) [-455.963] (-455.688) * [-454.868] (-454.523) (-454.590) (-459.922) -- 0:00:20
      689000 -- [-457.629] (-457.853) (-461.357) (-456.757) * (-457.975) [-455.037] (-454.119) (-456.675) -- 0:00:20
      689500 -- (-454.290) (-457.827) (-461.902) [-459.342] * (-456.131) (-456.881) (-456.224) [-456.089] -- 0:00:20
      690000 -- [-455.865] (-457.642) (-462.978) (-454.236) * (-455.238) [-455.607] (-457.248) (-455.744) -- 0:00:20

      Average standard deviation of split frequencies: 0.007053

      690500 -- (-457.800) (-456.731) (-456.322) [-453.977] * (-455.115) (-456.184) (-458.780) [-454.715] -- 0:00:20
      691000 -- [-459.734] (-456.185) (-455.460) (-456.362) * [-454.056] (-461.857) (-460.034) (-455.669) -- 0:00:20
      691500 -- (-455.377) (-455.634) [-455.732] (-456.679) * (-456.038) [-455.477] (-460.911) (-457.712) -- 0:00:20
      692000 -- (-459.754) [-456.156] (-456.349) (-454.663) * (-454.185) (-455.115) [-457.486] (-456.375) -- 0:00:20
      692500 -- (-455.750) (-455.570) [-454.384] (-457.527) * (-457.537) (-455.090) (-456.395) [-457.181] -- 0:00:19
      693000 -- (-456.180) [-455.074] (-456.799) (-457.715) * (-457.034) [-454.722] (-455.498) (-455.731) -- 0:00:19
      693500 -- [-458.243] (-455.546) (-457.583) (-456.510) * (-453.904) (-454.112) (-456.337) [-456.021] -- 0:00:20
      694000 -- (-456.280) (-457.266) (-461.967) [-456.931] * [-454.804] (-455.298) (-456.075) (-454.433) -- 0:00:20
      694500 -- [-456.137] (-455.536) (-457.496) (-456.123) * (-454.688) (-453.868) [-454.927] (-454.873) -- 0:00:20
      695000 -- (-454.969) (-454.598) (-456.757) [-457.504] * (-459.169) (-453.956) [-455.011] (-454.676) -- 0:00:20

      Average standard deviation of split frequencies: 0.006818

      695500 -- (-457.026) [-459.415] (-454.340) (-456.196) * (-459.883) [-455.866] (-453.818) (-454.647) -- 0:00:20
      696000 -- [-455.016] (-457.011) (-454.537) (-458.010) * (-455.576) [-457.084] (-455.721) (-455.183) -- 0:00:20
      696500 -- [-459.693] (-459.045) (-455.148) (-460.884) * (-457.161) (-457.609) (-455.422) [-455.088] -- 0:00:20
      697000 -- (-459.459) (-460.288) [-454.877] (-461.104) * (-455.539) (-455.963) (-454.736) [-456.826] -- 0:00:19
      697500 -- [-462.231] (-458.248) (-456.314) (-457.403) * (-456.153) [-456.393] (-454.144) (-455.955) -- 0:00:19
      698000 -- (-462.306) (-456.805) (-454.926) [-454.084] * (-456.466) [-455.563] (-454.329) (-457.012) -- 0:00:19
      698500 -- (-461.504) [-454.095] (-454.918) (-454.679) * (-459.060) [-454.350] (-456.045) (-454.071) -- 0:00:19
      699000 -- [-454.865] (-459.201) (-454.918) (-455.357) * (-453.733) (-454.410) (-460.783) [-455.093] -- 0:00:19
      699500 -- [-453.771] (-456.631) (-454.907) (-456.147) * [-455.243] (-458.188) (-457.319) (-456.440) -- 0:00:19
      700000 -- (-461.512) [-455.955] (-455.883) (-454.668) * (-454.769) (-456.308) [-454.414] (-457.120) -- 0:00:19

      Average standard deviation of split frequencies: 0.006818

      700500 -- (-455.063) (-454.514) (-454.982) [-455.177] * (-454.536) (-454.164) [-455.086] (-454.963) -- 0:00:19
      701000 -- [-454.442] (-453.894) (-453.545) (-455.763) * (-455.260) (-458.108) (-457.215) [-455.125] -- 0:00:19
      701500 -- (-454.707) (-456.720) [-455.201] (-455.836) * (-454.862) (-456.165) [-453.751] (-463.469) -- 0:00:19
      702000 -- (-455.656) (-458.879) [-455.819] (-456.645) * (-454.373) (-456.555) [-455.436] (-456.299) -- 0:00:19
      702500 -- [-454.754] (-457.001) (-454.687) (-457.157) * (-455.540) (-454.088) [-455.393] (-456.178) -- 0:00:19
      703000 -- (-453.508) (-456.934) [-456.089] (-455.809) * (-455.553) (-458.299) (-455.919) [-454.253] -- 0:00:19
      703500 -- (-456.439) (-454.483) [-455.392] (-460.146) * (-457.912) (-456.655) (-455.109) [-453.856] -- 0:00:19
      704000 -- (-455.128) (-455.613) (-455.219) [-457.150] * (-455.586) (-455.498) (-455.559) [-454.713] -- 0:00:19
      704500 -- (-455.508) (-455.055) [-458.973] (-458.006) * (-457.132) (-456.019) [-454.789] (-456.568) -- 0:00:19
      705000 -- (-455.332) (-455.224) (-456.191) [-459.154] * (-455.343) (-454.426) (-454.143) [-455.766] -- 0:00:19

      Average standard deviation of split frequencies: 0.007256

      705500 -- (-457.247) (-459.701) (-459.503) [-456.203] * [-457.028] (-456.042) (-454.142) (-457.665) -- 0:00:19
      706000 -- (-462.492) (-457.599) [-454.649] (-453.997) * (-455.143) (-453.957) (-455.558) [-454.988] -- 0:00:19
      706500 -- [-454.767] (-456.803) (-457.334) (-459.642) * [-454.421] (-456.040) (-457.436) (-459.409) -- 0:00:19
      707000 -- (-457.815) (-455.850) (-456.212) [-454.486] * (-455.085) [-455.714] (-455.150) (-458.382) -- 0:00:19
      707500 -- (-457.828) (-455.354) [-456.016] (-459.117) * (-460.094) (-457.263) [-454.140] (-462.257) -- 0:00:19
      708000 -- (-455.031) (-455.529) (-460.346) [-454.175] * [-456.857] (-459.985) (-454.007) (-455.694) -- 0:00:18
      708500 -- [-457.210] (-457.500) (-455.054) (-455.450) * [-454.674] (-457.229) (-454.428) (-454.154) -- 0:00:18
      709000 -- (-455.861) (-456.112) (-457.799) [-454.228] * (-457.190) (-455.488) (-461.149) [-455.263] -- 0:00:18
      709500 -- (-455.020) (-460.266) (-455.523) [-454.504] * (-454.257) [-454.741] (-455.185) (-456.811) -- 0:00:19
      710000 -- (-455.260) (-456.168) [-457.113] (-454.421) * [-455.357] (-454.299) (-456.481) (-454.081) -- 0:00:19

      Average standard deviation of split frequencies: 0.007341

      710500 -- (-454.376) [-455.690] (-454.560) (-455.348) * [-455.582] (-455.821) (-455.680) (-454.951) -- 0:00:19
      711000 -- (-455.583) (-457.887) [-456.688] (-458.202) * (-456.400) [-456.307] (-454.567) (-458.461) -- 0:00:19
      711500 -- (-457.964) (-458.219) [-456.417] (-454.594) * (-455.848) (-460.980) (-454.328) [-457.965] -- 0:00:19
      712000 -- (-456.855) [-460.705] (-455.282) (-457.033) * (-457.416) (-454.467) [-455.797] (-454.853) -- 0:00:19
      712500 -- (-458.127) (-456.522) [-457.246] (-459.987) * (-454.566) (-453.961) [-454.879] (-458.708) -- 0:00:18
      713000 -- [-454.269] (-457.898) (-457.077) (-455.431) * (-461.613) (-455.412) (-455.091) [-457.527] -- 0:00:18
      713500 -- (-461.906) (-455.417) (-458.229) [-454.368] * (-455.082) (-455.493) [-456.552] (-457.590) -- 0:00:18
      714000 -- (-457.739) [-456.099] (-454.976) (-455.730) * (-454.961) (-457.781) [-454.146] (-455.941) -- 0:00:18
      714500 -- (-457.494) (-457.616) (-454.315) [-454.709] * (-457.635) [-457.514] (-454.529) (-455.983) -- 0:00:18
      715000 -- (-455.303) (-455.565) (-454.323) [-455.154] * [-455.767] (-455.410) (-456.194) (-457.951) -- 0:00:18

      Average standard deviation of split frequencies: 0.007462

      715500 -- (-455.961) (-454.691) (-454.591) [-455.936] * (-456.413) (-455.669) (-455.009) [-453.825] -- 0:00:18
      716000 -- (-458.020) (-457.066) [-455.012] (-458.577) * (-461.189) (-456.311) [-455.848] (-453.670) -- 0:00:18
      716500 -- (-457.397) (-455.854) [-455.664] (-456.762) * (-461.482) (-460.319) [-454.431] (-454.125) -- 0:00:18
      717000 -- (-454.215) [-454.932] (-457.841) (-457.558) * (-459.072) (-457.051) [-455.167] (-457.083) -- 0:00:18
      717500 -- [-454.293] (-457.144) (-454.842) (-456.353) * (-454.007) (-458.392) (-455.994) [-455.907] -- 0:00:18
      718000 -- [-455.206] (-457.104) (-455.425) (-455.442) * (-456.370) [-457.351] (-458.292) (-456.529) -- 0:00:18
      718500 -- (-454.964) (-457.492) [-455.770] (-456.361) * [-454.874] (-455.520) (-455.265) (-455.781) -- 0:00:18
      719000 -- (-460.046) (-456.732) (-456.488) [-455.623] * [-456.346] (-456.374) (-455.633) (-455.059) -- 0:00:18
      719500 -- [-455.751] (-455.607) (-458.056) (-454.867) * (-456.821) (-457.855) (-455.591) [-457.257] -- 0:00:18
      720000 -- (-459.137) (-456.866) [-455.808] (-455.109) * (-456.295) (-456.552) (-455.341) [-455.996] -- 0:00:18

      Average standard deviation of split frequencies: 0.007370

      720500 -- (-457.651) (-458.902) [-457.012] (-456.244) * [-457.000] (-454.327) (-457.864) (-456.643) -- 0:00:18
      721000 -- [-454.492] (-456.651) (-455.030) (-455.964) * (-457.230) (-455.864) [-455.619] (-453.828) -- 0:00:18
      721500 -- (-456.612) [-456.361] (-456.232) (-455.406) * (-455.411) [-456.597] (-456.812) (-459.548) -- 0:00:18
      722000 -- [-454.628] (-455.814) (-456.869) (-456.725) * (-458.375) [-456.630] (-456.897) (-457.360) -- 0:00:18
      722500 -- (-454.168) (-456.487) [-459.700] (-460.291) * (-456.763) (-456.683) (-454.931) [-458.061] -- 0:00:18
      723000 -- (-453.842) [-457.082] (-456.244) (-457.080) * (-455.566) (-456.294) (-453.666) [-456.268] -- 0:00:18
      723500 -- (-454.095) [-455.029] (-455.906) (-458.134) * (-458.479) [-455.782] (-454.816) (-457.417) -- 0:00:17
      724000 -- (-454.870) [-456.067] (-456.398) (-458.904) * (-458.341) (-455.743) [-455.236] (-455.760) -- 0:00:17
      724500 -- (-455.197) [-457.819] (-456.605) (-454.748) * [-457.613] (-455.820) (-458.711) (-455.141) -- 0:00:17
      725000 -- (-453.875) (-454.138) [-457.695] (-458.433) * [-457.104] (-457.347) (-455.387) (-454.346) -- 0:00:17

      Average standard deviation of split frequencies: 0.007316

      725500 -- (-454.598) (-456.045) [-454.961] (-454.677) * (-456.699) (-459.233) (-457.435) [-455.497] -- 0:00:18
      726000 -- (-459.272) [-454.471] (-455.956) (-458.024) * [-462.201] (-454.781) (-455.070) (-456.848) -- 0:00:18
      726500 -- (-456.124) [-455.768] (-454.950) (-456.536) * [-460.087] (-455.872) (-456.904) (-457.210) -- 0:00:18
      727000 -- (-456.755) [-454.856] (-454.409) (-454.817) * (-457.743) (-459.637) (-455.365) [-456.564] -- 0:00:18
      727500 -- [-455.755] (-459.204) (-459.236) (-454.874) * [-455.767] (-454.903) (-455.756) (-456.987) -- 0:00:17
      728000 -- (-457.037) (-457.972) [-454.009] (-457.668) * (-460.483) (-457.552) [-460.152] (-455.433) -- 0:00:17
      728500 -- (-454.998) (-455.478) (-456.893) [-461.116] * (-460.367) (-455.406) (-460.638) [-455.453] -- 0:00:17
      729000 -- [-458.353] (-460.680) (-458.335) (-458.967) * [-456.900] (-456.916) (-455.856) (-456.566) -- 0:00:17
      729500 -- [-455.844] (-459.798) (-460.273) (-457.976) * (-456.573) [-455.286] (-454.503) (-458.013) -- 0:00:17
      730000 -- (-458.462) (-458.427) (-460.538) [-458.734] * (-454.194) (-455.908) [-454.893] (-454.879) -- 0:00:17

      Average standard deviation of split frequencies: 0.007355

      730500 -- (-454.911) [-456.969] (-454.957) (-457.079) * [-455.512] (-460.604) (-456.023) (-461.391) -- 0:00:17
      731000 -- (-457.099) (-455.719) [-453.734] (-456.468) * (-457.214) (-458.010) [-455.810] (-455.755) -- 0:00:17
      731500 -- [-454.897] (-453.748) (-455.288) (-455.029) * [-456.953] (-457.258) (-455.312) (-456.845) -- 0:00:17
      732000 -- (-456.938) [-454.956] (-455.234) (-455.590) * [-456.058] (-454.287) (-456.512) (-456.834) -- 0:00:17
      732500 -- (-456.134) (-457.019) (-455.129) [-455.140] * (-457.775) (-454.685) (-457.476) [-454.705] -- 0:00:17
      733000 -- (-461.697) (-456.059) [-455.180] (-456.057) * (-456.496) (-458.499) (-457.380) [-455.087] -- 0:00:17
      733500 -- (-456.368) [-457.934] (-454.837) (-455.291) * (-454.230) [-454.353] (-459.311) (-456.240) -- 0:00:17
      734000 -- (-455.617) (-457.112) (-455.263) [-454.654] * (-455.443) (-454.721) [-454.962] (-456.883) -- 0:00:17
      734500 -- (-453.957) (-457.153) (-454.147) [-458.258] * (-455.888) (-456.003) (-456.460) [-456.295] -- 0:00:17
      735000 -- (-455.801) (-454.250) (-456.073) [-456.408] * (-456.660) [-459.079] (-456.352) (-455.782) -- 0:00:17

      Average standard deviation of split frequencies: 0.007387

      735500 -- (-454.329) [-454.869] (-455.528) (-453.917) * [-455.844] (-457.541) (-455.650) (-458.933) -- 0:00:17
      736000 -- [-454.105] (-455.252) (-457.123) (-455.319) * (-453.689) (-455.834) (-455.476) [-459.269] -- 0:00:17
      736500 -- (-455.907) (-455.348) [-456.409] (-456.100) * [-454.597] (-454.687) (-455.808) (-461.316) -- 0:00:17
      737000 -- (-455.743) (-454.867) [-454.321] (-457.114) * [-454.637] (-453.800) (-458.217) (-457.113) -- 0:00:17
      737500 -- [-456.310] (-455.703) (-460.412) (-455.206) * [-454.158] (-457.063) (-458.901) (-458.534) -- 0:00:17
      738000 -- (-455.637) (-457.245) (-457.721) [-454.837] * [-457.939] (-455.409) (-454.718) (-462.678) -- 0:00:17
      738500 -- [-456.431] (-458.557) (-456.619) (-455.529) * (-456.369) (-459.447) [-456.563] (-458.233) -- 0:00:16
      739000 -- (-454.689) (-456.565) [-459.253] (-456.158) * (-455.348) [-454.283] (-457.812) (-456.660) -- 0:00:16
      739500 -- (-457.132) (-456.415) (-455.936) [-455.212] * (-456.609) (-456.090) (-455.951) [-455.728] -- 0:00:16
      740000 -- (-456.952) [-455.952] (-458.408) (-454.863) * [-457.951] (-456.541) (-459.144) (-456.336) -- 0:00:16

      Average standard deviation of split frequencies: 0.007383

      740500 -- (-453.686) [-455.422] (-456.125) (-458.637) * [-460.920] (-458.923) (-454.865) (-457.495) -- 0:00:16
      741000 -- (-456.902) [-454.777] (-454.162) (-455.899) * (-457.081) (-455.620) (-455.129) [-458.541] -- 0:00:17
      741500 -- (-456.215) [-456.503] (-454.845) (-455.571) * [-457.787] (-455.037) (-458.639) (-455.175) -- 0:00:17
      742000 -- (-457.354) (-457.897) (-457.352) [-456.197] * (-456.992) [-455.431] (-455.588) (-456.326) -- 0:00:17
      742500 -- (-458.561) (-456.426) (-455.756) [-456.571] * (-458.932) [-456.864] (-456.230) (-455.360) -- 0:00:16
      743000 -- [-458.219] (-460.089) (-457.324) (-454.194) * (-456.146) (-454.644) (-455.704) [-453.814] -- 0:00:16
      743500 -- (-455.189) (-456.058) (-454.680) [-454.776] * (-456.344) (-454.406) [-454.700] (-455.516) -- 0:00:16
      744000 -- (-456.994) [-454.451] (-455.524) (-456.303) * [-454.497] (-454.889) (-453.762) (-459.657) -- 0:00:16
      744500 -- [-454.202] (-453.897) (-456.216) (-456.090) * [-454.462] (-456.840) (-456.569) (-455.642) -- 0:00:16
      745000 -- (-461.099) (-458.122) [-457.133] (-456.968) * [-455.841] (-456.454) (-454.216) (-454.422) -- 0:00:16

      Average standard deviation of split frequencies: 0.007414

      745500 -- (-459.734) (-459.866) (-455.841) [-454.924] * [-455.322] (-458.075) (-456.988) (-456.213) -- 0:00:16
      746000 -- [-457.692] (-455.630) (-459.446) (-455.990) * (-458.940) (-455.844) [-455.615] (-463.873) -- 0:00:16
      746500 -- [-454.958] (-455.193) (-456.142) (-454.757) * (-455.404) (-455.949) [-457.185] (-454.421) -- 0:00:16
      747000 -- (-453.893) [-454.766] (-455.261) (-454.173) * [-454.854] (-460.800) (-456.088) (-457.886) -- 0:00:16
      747500 -- [-453.716] (-455.780) (-453.903) (-457.602) * [-455.717] (-455.368) (-457.965) (-458.554) -- 0:00:16
      748000 -- [-454.896] (-456.659) (-454.628) (-457.717) * (-454.828) (-454.471) [-455.899] (-455.644) -- 0:00:16
      748500 -- (-455.130) [-458.118] (-455.646) (-455.274) * [-456.518] (-456.926) (-461.185) (-455.787) -- 0:00:16
      749000 -- (-455.828) [-454.185] (-453.915) (-455.014) * (-456.676) [-457.124] (-455.429) (-454.530) -- 0:00:16
      749500 -- (-457.979) (-454.589) (-454.362) [-456.812] * (-457.877) [-456.139] (-456.286) (-454.741) -- 0:00:16
      750000 -- (-455.740) [-454.583] (-454.434) (-458.077) * (-455.380) (-454.285) [-457.809] (-453.987) -- 0:00:16

      Average standard deviation of split frequencies: 0.007410

      750500 -- (-455.926) (-453.916) [-458.679] (-456.514) * (-461.532) (-454.712) [-457.043] (-454.705) -- 0:00:16
      751000 -- (-455.842) [-454.651] (-458.699) (-454.676) * [-457.649] (-454.893) (-454.931) (-455.911) -- 0:00:16
      751500 -- [-456.710] (-454.637) (-454.474) (-454.725) * (-455.536) (-455.562) [-456.956] (-455.942) -- 0:00:16
      752000 -- (-459.300) (-459.289) (-454.928) [-455.522] * (-456.383) [-454.567] (-455.462) (-458.953) -- 0:00:16
      752500 -- (-454.813) (-456.511) [-455.103] (-457.557) * [-456.234] (-456.279) (-459.164) (-457.346) -- 0:00:16
      753000 -- (-455.654) (-457.806) [-453.993] (-458.351) * (-453.784) (-456.283) [-454.542] (-456.180) -- 0:00:16
      753500 -- (-457.365) [-456.154] (-456.351) (-455.990) * [-454.059] (-454.050) (-455.269) (-455.256) -- 0:00:16
      754000 -- [-454.745] (-461.148) (-456.593) (-455.296) * [-459.150] (-454.542) (-455.078) (-454.416) -- 0:00:15
      754500 -- (-456.334) (-454.724) (-456.104) [-456.135] * [-454.707] (-455.072) (-454.463) (-455.998) -- 0:00:15
      755000 -- (-455.525) (-455.362) [-458.607] (-455.534) * (-456.177) (-456.639) (-454.430) [-455.760] -- 0:00:15

      Average standard deviation of split frequencies: 0.007233

      755500 -- (-458.182) (-456.465) (-456.850) [-456.041] * (-454.688) (-454.216) (-455.217) [-453.945] -- 0:00:15
      756000 -- (-455.790) [-459.755] (-457.958) (-464.364) * (-454.074) [-454.394] (-456.105) (-457.257) -- 0:00:15
      756500 -- (-454.919) [-457.311] (-456.172) (-457.018) * (-454.709) (-456.910) (-455.026) [-456.829] -- 0:00:15
      757000 -- (-454.522) [-458.665] (-458.190) (-459.470) * (-454.832) [-454.209] (-454.532) (-456.792) -- 0:00:15
      757500 -- (-454.005) (-460.647) [-453.860] (-456.177) * [-455.524] (-456.663) (-454.467) (-457.687) -- 0:00:16
      758000 -- (-455.740) (-457.862) [-454.150] (-458.081) * (-457.127) [-459.329] (-456.284) (-454.974) -- 0:00:15
      758500 -- [-454.875] (-455.189) (-455.979) (-457.291) * (-460.979) (-461.679) [-456.833] (-455.520) -- 0:00:15
      759000 -- (-455.107) (-455.529) (-455.139) [-454.666] * (-462.977) [-454.908] (-454.845) (-457.453) -- 0:00:15
      759500 -- (-455.314) (-454.780) [-455.180] (-454.984) * (-457.116) (-456.496) (-456.509) [-455.814] -- 0:00:15
      760000 -- [-456.690] (-455.277) (-458.658) (-457.975) * (-456.194) [-456.533] (-455.256) (-456.499) -- 0:00:15

      Average standard deviation of split frequencies: 0.006900

      760500 -- (-455.334) (-455.055) [-454.011] (-458.116) * (-455.913) (-454.782) (-454.554) [-453.885] -- 0:00:15
      761000 -- (-454.830) [-455.335] (-455.313) (-454.404) * (-456.702) [-456.069] (-456.568) (-453.616) -- 0:00:15
      761500 -- (-456.007) (-455.989) [-455.216] (-455.115) * (-456.574) [-458.286] (-456.561) (-458.078) -- 0:00:15
      762000 -- (-458.480) [-457.162] (-454.988) (-456.754) * (-454.528) [-456.154] (-456.414) (-458.166) -- 0:00:15
      762500 -- (-457.276) (-454.417) (-455.155) [-454.319] * [-455.712] (-456.851) (-454.606) (-455.546) -- 0:00:15
      763000 -- (-457.160) (-457.349) [-455.554] (-457.390) * (-455.085) (-455.655) [-455.214] (-457.631) -- 0:00:15
      763500 -- (-458.060) (-457.294) (-454.491) [-455.449] * [-454.959] (-459.338) (-456.914) (-455.383) -- 0:00:15
      764000 -- (-454.735) (-457.517) [-454.594] (-456.717) * [-455.696] (-458.096) (-454.819) (-456.412) -- 0:00:15
      764500 -- [-456.575] (-458.707) (-455.690) (-453.576) * (-454.139) (-459.650) [-454.818] (-454.250) -- 0:00:15
      765000 -- (-454.831) (-457.228) (-457.871) [-454.022] * (-456.138) [-455.341] (-454.179) (-454.152) -- 0:00:15

      Average standard deviation of split frequencies: 0.007885

      765500 -- (-455.720) (-455.364) [-455.671] (-455.043) * (-458.660) [-454.564] (-457.277) (-454.754) -- 0:00:15
      766000 -- (-455.145) (-457.457) [-456.817] (-457.775) * (-455.617) [-456.715] (-454.560) (-456.878) -- 0:00:15
      766500 -- (-458.851) (-458.646) [-458.259] (-456.630) * (-455.456) (-457.914) (-454.249) [-453.793] -- 0:00:15
      767000 -- [-460.184] (-456.983) (-454.950) (-456.879) * (-456.208) (-455.652) [-454.542] (-455.439) -- 0:00:15
      767500 -- [-455.405] (-458.338) (-456.654) (-454.935) * (-456.617) (-459.175) (-454.259) [-456.062] -- 0:00:15
      768000 -- (-454.778) [-456.255] (-455.722) (-454.036) * [-455.669] (-464.189) (-455.852) (-456.558) -- 0:00:15
      768500 -- (-457.344) (-454.632) [-453.983] (-455.858) * (-457.169) (-464.001) [-454.563] (-454.204) -- 0:00:15
      769000 -- (-455.468) (-458.001) [-455.485] (-454.595) * (-455.322) [-454.244] (-458.727) (-456.947) -- 0:00:15
      769500 -- (-455.356) [-455.543] (-457.218) (-454.433) * (-456.948) (-456.263) [-457.115] (-455.130) -- 0:00:14
      770000 -- (-454.623) (-457.634) (-454.429) [-454.446] * (-454.955) (-454.709) (-455.800) [-457.528] -- 0:00:14

      Average standard deviation of split frequencies: 0.007585

      770500 -- (-454.051) (-454.530) [-454.295] (-459.756) * [-456.861] (-454.113) (-453.898) (-455.301) -- 0:00:14
      771000 -- (-454.509) (-453.726) (-455.528) [-455.944] * (-455.294) [-454.565] (-455.671) (-455.810) -- 0:00:14
      771500 -- (-454.826) [-455.430] (-455.769) (-456.625) * (-457.400) (-455.315) [-454.948] (-455.259) -- 0:00:14
      772000 -- (-455.037) [-456.272] (-458.894) (-456.265) * (-457.320) (-454.436) [-454.740] (-458.654) -- 0:00:14
      772500 -- (-459.714) [-456.986] (-457.704) (-454.432) * (-456.563) (-454.344) (-454.385) [-454.181] -- 0:00:14
      773000 -- (-457.457) [-454.857] (-456.615) (-454.025) * [-454.295] (-456.640) (-455.438) (-454.086) -- 0:00:14
      773500 -- (-461.401) [-455.356] (-455.627) (-458.032) * (-454.713) (-454.792) (-455.998) [-455.903] -- 0:00:14
      774000 -- (-456.455) [-456.088] (-454.755) (-458.954) * (-459.630) [-455.614] (-457.734) (-456.731) -- 0:00:14
      774500 -- [-454.761] (-458.907) (-458.081) (-455.330) * [-454.927] (-454.718) (-454.062) (-454.217) -- 0:00:14
      775000 -- (-456.505) (-457.943) [-455.598] (-455.338) * (-457.083) (-455.360) [-457.472] (-455.750) -- 0:00:14

      Average standard deviation of split frequencies: 0.007411

      775500 -- (-456.469) (-456.006) (-455.980) [-456.460] * [-454.567] (-457.461) (-453.732) (-456.335) -- 0:00:14
      776000 -- (-454.093) [-455.530] (-454.609) (-456.819) * (-455.920) (-456.885) (-454.564) [-458.420] -- 0:00:14
      776500 -- (-457.361) (-456.807) [-454.524] (-457.077) * [-457.665] (-457.377) (-455.766) (-460.332) -- 0:00:14
      777000 -- (-456.235) [-458.987] (-457.225) (-457.320) * [-455.592] (-454.178) (-456.781) (-455.144) -- 0:00:14
      777500 -- (-457.496) (-454.535) (-457.788) [-454.689] * (-455.608) (-458.523) (-461.458) [-454.460] -- 0:00:14
      778000 -- [-457.374] (-454.624) (-456.092) (-454.769) * [-460.261] (-459.155) (-455.494) (-454.603) -- 0:00:14
      778500 -- (-455.641) (-457.304) [-459.417] (-454.539) * (-454.989) (-457.132) [-456.188] (-453.837) -- 0:00:14
      779000 -- (-457.085) (-453.801) (-454.406) [-456.697] * [-459.381] (-456.443) (-458.075) (-454.094) -- 0:00:14
      779500 -- [-453.704] (-454.711) (-453.584) (-462.330) * (-460.454) (-455.778) (-456.470) [-455.088] -- 0:00:14
      780000 -- (-455.742) [-454.915] (-454.501) (-461.545) * (-458.220) [-456.300] (-458.468) (-454.568) -- 0:00:14

      Average standard deviation of split frequencies: 0.007367

      780500 -- [-455.944] (-457.998) (-456.130) (-454.753) * (-457.096) [-455.597] (-458.488) (-454.500) -- 0:00:14
      781000 -- (-457.215) [-456.488] (-457.548) (-456.921) * (-456.873) (-454.583) [-454.822] (-455.705) -- 0:00:14
      781500 -- (-456.821) (-457.030) [-455.239] (-457.292) * (-456.894) [-455.056] (-457.702) (-455.485) -- 0:00:14
      782000 -- (-455.305) (-459.298) [-459.544] (-456.903) * [-455.918] (-455.455) (-457.483) (-455.491) -- 0:00:14
      782500 -- [-456.016] (-456.179) (-455.038) (-454.742) * (-455.682) [-455.632] (-455.629) (-456.295) -- 0:00:14
      783000 -- (-456.173) [-453.627] (-456.261) (-457.048) * (-456.439) (-454.920) (-455.236) [-454.400] -- 0:00:14
      783500 -- (-454.923) [-455.172] (-454.957) (-454.251) * (-457.791) (-455.372) [-456.217] (-454.678) -- 0:00:14
      784000 -- (-454.258) (-455.481) [-454.269] (-457.771) * [-455.202] (-456.549) (-458.952) (-454.595) -- 0:00:14
      784500 -- (-456.280) [-455.972] (-453.724) (-454.725) * [-455.033] (-456.228) (-458.878) (-455.029) -- 0:00:14
      785000 -- [-455.574] (-454.095) (-456.744) (-454.726) * [-455.029] (-457.863) (-456.214) (-455.247) -- 0:00:13

      Average standard deviation of split frequencies: 0.007237

      785500 -- (-454.801) (-455.548) (-460.255) [-456.385] * (-454.804) (-458.401) [-454.959] (-459.485) -- 0:00:13
      786000 -- (-456.770) [-456.678] (-457.176) (-458.331) * (-455.062) (-459.846) (-455.589) [-455.617] -- 0:00:13
      786500 -- (-459.869) (-456.281) [-456.626] (-457.183) * (-455.488) (-454.440) [-454.345] (-454.100) -- 0:0