--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:22:33 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0044/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -468.56 -472.54
2 -468.56 -473.01
--------------------------------------
TOTAL -468.56 -472.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889632 0.092964 0.375249 1.527400 0.858246 1288.83 1368.78 1.000
r(A<->C){all} 0.167578 0.020116 0.000203 0.460621 0.128932 214.11 237.14 1.007
r(A<->G){all} 0.166835 0.021129 0.000056 0.459919 0.127423 161.00 200.52 1.001
r(A<->T){all} 0.173453 0.021744 0.000122 0.474918 0.134752 201.54 233.16 1.004
r(C<->G){all} 0.165503 0.019072 0.000015 0.436211 0.133180 236.09 314.96 1.006
r(C<->T){all} 0.157954 0.018170 0.000070 0.426540 0.124090 293.49 318.34 1.001
r(G<->T){all} 0.168676 0.020191 0.000068 0.456560 0.131500 196.91 219.23 1.005
pi(A){all} 0.236229 0.000526 0.192468 0.280872 0.236064 1222.30 1304.13 1.000
pi(C){all} 0.264594 0.000562 0.220506 0.312474 0.263857 946.14 1171.52 1.000
pi(G){all} 0.294877 0.000595 0.245303 0.340872 0.294593 1344.23 1370.53 1.000
pi(T){all} 0.204299 0.000465 0.162946 0.246024 0.204197 1342.37 1351.84 1.000
alpha{1,2} 0.420074 0.243507 0.000204 1.421974 0.245043 1322.60 1358.87 1.000
alpha{3} 0.442315 0.208727 0.000158 1.388597 0.299092 1135.12 1169.08 1.000
pinvar{all} 0.995142 0.000039 0.984661 0.999998 0.996992 907.33 1176.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -452.754196
Model 2: PositiveSelection -452.754108
Model 0: one-ratio -452.754108
Model 7: beta -452.754293
Model 8: beta&w>1 -452.754105
Model 0 vs 1 1.7600000001039007E-4
Model 2 vs 1 1.7600000001039007E-4
Model 8 vs 7 3.760000000738728E-4
>C1
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C2
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C3
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C4
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C5
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C6
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
C1 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C2 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C3 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C4 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C5 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C6 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
**************************************************
C1 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C2 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C3 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C4 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C5 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C6 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
**************************************************
C1 SALSCSIGEPPPT
C2 SALSCSIGEPPPT
C3 SALSCSIGEPPPT
C4 SALSCSIGEPPPT
C5 SALSCSIGEPPPT
C6 SALSCSIGEPPPT
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3390]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3390]--->[3390]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.447 Mb, Max= 30.630 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C2 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C3 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C4 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C5 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
C6 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
**************************************************
C1 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C2 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C3 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C4 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C5 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
C6 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
**************************************************
C1 SALSCSIGEPPPT
C2 SALSCSIGEPPPT
C3 SALSCSIGEPPPT
C4 SALSCSIGEPPPT
C5 SALSCSIGEPPPT
C6 SALSCSIGEPPPT
*************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
C2 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
C3 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
C4 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
C5 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
C6 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
**************************************************
C1 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
C2 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
C3 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
C4 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
C5 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
C6 TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
**************************************************
C1 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
C2 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
C3 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
C4 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
C5 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
C6 AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
**************************************************
C1 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
C2 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
C3 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
C4 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
C5 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
C6 TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
**************************************************
C1 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
C2 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
C3 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
C4 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
C5 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
C6 CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
**************************************************
C1 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
C2 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
C3 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
C4 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
C5 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
C6 TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
**************************************************
C1 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
C2 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
C3 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
C4 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
C5 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
C6 TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
***************************************
>C1
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C2
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C3
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C4
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C5
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C6
ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT
TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA
AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG
TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA
CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG
TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG
TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>C1
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C2
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C3
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C4
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C5
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
>C6
MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
SALSCSIGEPPPT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 339 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789274
Setting output file names to "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1093436700
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0839200284
Seed = 1425352766
Swapseed = 1579789274
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -758.698209 -- -24.965149
Chain 2 -- -758.698209 -- -24.965149
Chain 3 -- -758.698252 -- -24.965149
Chain 4 -- -758.698252 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -758.698252 -- -24.965149
Chain 2 -- -758.698209 -- -24.965149
Chain 3 -- -758.698252 -- -24.965149
Chain 4 -- -758.698252 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-758.698] (-758.698) (-758.698) (-758.698) * [-758.698] (-758.698) (-758.698) (-758.698)
500 -- (-482.470) [-474.712] (-493.062) (-489.393) * (-481.161) (-475.389) [-484.588] (-478.542) -- 0:00:00
1000 -- (-485.509) [-474.459] (-481.072) (-473.793) * [-478.004] (-475.291) (-489.169) (-480.098) -- 0:00:00
1500 -- (-475.201) [-477.409] (-470.024) (-481.190) * [-478.463] (-479.393) (-476.362) (-478.771) -- 0:00:00
2000 -- (-481.382) [-478.310] (-481.240) (-480.953) * (-480.145) [-477.295] (-480.417) (-478.789) -- 0:08:19
2500 -- (-472.483) (-477.048) (-480.204) [-478.765] * (-483.358) (-477.485) [-484.909] (-476.933) -- 0:06:39
3000 -- (-484.160) [-474.251] (-481.871) (-483.934) * (-479.377) [-475.667] (-482.673) (-482.754) -- 0:05:32
3500 -- [-480.972] (-475.508) (-473.405) (-490.234) * (-478.227) (-480.896) [-474.799] (-474.134) -- 0:04:44
4000 -- (-482.079) (-476.767) (-474.747) [-479.730] * [-472.291] (-476.366) (-476.101) (-483.061) -- 0:04:09
4500 -- (-485.357) (-475.367) (-476.847) [-484.055] * (-477.740) [-477.253] (-475.438) (-476.000) -- 0:03:41
5000 -- [-479.311] (-482.436) (-482.010) (-485.556) * [-479.911] (-473.346) (-475.881) (-480.802) -- 0:03:19
Average standard deviation of split frequencies: 0.121422
5500 -- (-478.028) (-483.840) [-477.093] (-484.201) * [-476.889] (-480.326) (-480.035) (-475.368) -- 0:03:00
6000 -- (-483.042) (-488.366) (-475.234) [-479.437] * [-479.670] (-477.589) (-477.964) (-475.602) -- 0:02:45
6500 -- (-482.137) (-478.334) (-478.175) [-472.381] * (-478.472) (-475.711) (-480.637) [-476.666] -- 0:02:32
7000 -- (-492.472) [-480.095] (-480.900) (-483.160) * (-476.781) (-476.862) [-478.878] (-481.469) -- 0:02:21
7500 -- (-479.981) [-477.616] (-486.737) (-484.870) * [-479.392] (-483.192) (-483.799) (-478.301) -- 0:02:12
8000 -- [-470.046] (-475.470) (-479.908) (-488.148) * [-474.936] (-480.339) (-472.530) (-477.313) -- 0:02:04
8500 -- (-468.988) [-476.722] (-475.522) (-488.215) * (-480.243) [-477.312] (-477.354) (-477.783) -- 0:01:56
9000 -- (-469.285) (-482.902) (-478.698) [-470.053] * (-473.682) (-481.611) (-478.560) [-479.021] -- 0:01:50
9500 -- (-469.077) (-478.056) (-474.278) [-469.228] * [-476.121] (-472.990) (-478.532) (-477.287) -- 0:01:44
10000 -- (-470.179) (-480.847) (-486.244) [-467.652] * (-479.519) (-479.551) (-475.031) [-487.696] -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-468.268] (-486.507) (-484.969) (-470.543) * (-482.972) (-478.295) [-473.702] (-485.396) -- 0:01:34
11000 -- [-468.067] (-480.531) (-486.059) (-470.263) * (-485.928) (-478.027) (-478.024) [-486.143] -- 0:01:29
11500 -- [-468.490] (-479.453) (-474.599) (-469.284) * [-480.307] (-483.183) (-480.952) (-475.866) -- 0:01:25
12000 -- [-469.519] (-478.654) (-475.519) (-468.828) * (-475.991) (-476.490) (-476.366) [-478.126] -- 0:01:22
12500 -- (-469.764) [-475.510] (-482.441) (-471.028) * (-475.171) [-480.024] (-482.315) (-487.891) -- 0:01:19
13000 -- (-467.952) (-489.233) (-475.240) [-469.975] * (-471.302) [-478.934] (-480.235) (-481.786) -- 0:01:15
13500 -- (-469.148) (-478.459) (-487.077) [-467.863] * (-487.253) [-482.559] (-479.207) (-478.598) -- 0:01:13
14000 -- (-470.663) (-489.304) [-486.665] (-471.099) * (-472.606) (-486.889) [-477.498] (-482.686) -- 0:01:10
14500 -- (-467.730) (-479.092) [-476.911] (-472.685) * [-475.073] (-468.099) (-480.202) (-478.267) -- 0:01:07
15000 -- (-470.205) (-478.824) [-474.798] (-474.088) * (-477.004) [-468.151] (-484.573) (-475.638) -- 0:01:05
Average standard deviation of split frequencies: 0.044194
15500 -- (-469.185) (-482.380) [-478.130] (-470.949) * (-477.059) (-469.833) (-479.917) [-476.230] -- 0:01:03
16000 -- (-468.954) [-473.998] (-476.985) (-472.693) * (-479.227) [-472.380] (-477.072) (-476.144) -- 0:01:01
16500 -- (-467.574) [-474.503] (-483.819) (-470.420) * (-472.144) (-468.382) [-476.624] (-482.827) -- 0:00:59
17000 -- (-468.686) [-474.393] (-476.905) (-468.126) * (-475.853) (-468.951) (-477.473) [-475.916] -- 0:01:55
17500 -- (-468.391) (-479.705) [-474.086] (-468.119) * (-480.364) (-470.256) [-481.720] (-485.049) -- 0:01:52
18000 -- (-470.375) (-475.536) (-486.412) [-467.977] * (-485.006) (-469.318) [-473.323] (-475.357) -- 0:01:49
18500 -- (-470.355) (-482.599) (-484.385) [-471.558] * (-482.990) (-471.789) [-475.001] (-473.459) -- 0:01:46
19000 -- [-468.240] (-476.999) (-478.539) (-474.966) * [-482.914] (-472.248) (-476.454) (-481.975) -- 0:01:43
19500 -- [-470.362] (-479.704) (-468.169) (-471.298) * (-486.354) (-467.304) [-479.698] (-477.396) -- 0:01:40
20000 -- (-471.793) [-475.040] (-469.580) (-467.836) * (-493.501) (-467.237) [-479.320] (-479.238) -- 0:01:38
Average standard deviation of split frequencies: 0.038417
20500 -- [-469.899] (-484.505) (-469.853) (-469.191) * (-491.576) [-472.858] (-486.903) (-480.270) -- 0:01:35
21000 -- (-470.544) (-482.892) (-467.785) [-468.041] * [-468.239] (-475.075) (-482.808) (-480.747) -- 0:01:33
21500 -- (-468.426) [-475.373] (-468.087) (-468.299) * (-469.466) (-468.839) [-475.452] (-476.420) -- 0:01:31
22000 -- (-468.768) (-481.010) (-469.155) [-467.973] * [-468.928] (-469.139) (-489.683) (-474.355) -- 0:01:28
22500 -- [-468.470] (-479.305) (-468.020) (-472.394) * (-470.241) (-468.680) [-476.001] (-477.786) -- 0:01:26
23000 -- (-468.870) (-478.765) (-468.162) [-467.449] * (-468.543) (-468.372) [-477.409] (-475.858) -- 0:01:24
23500 -- [-468.815] (-479.266) (-467.990) (-468.371) * [-472.847] (-469.150) (-483.396) (-484.751) -- 0:01:23
24000 -- (-470.278) [-476.951] (-467.825) (-470.942) * (-468.549) (-469.601) (-486.489) [-475.359] -- 0:01:21
24500 -- (-471.994) (-480.554) (-468.616) [-471.415] * [-470.787] (-471.074) (-474.858) (-476.571) -- 0:01:19
25000 -- [-467.981] (-479.350) (-467.673) (-475.133) * (-468.044) [-472.069] (-473.822) (-474.843) -- 0:01:18
Average standard deviation of split frequencies: 0.041442
25500 -- [-468.082] (-483.633) (-467.902) (-472.232) * (-467.259) (-472.438) [-474.135] (-477.017) -- 0:01:16
26000 -- (-470.211) [-474.624] (-470.818) (-468.421) * [-468.040] (-470.963) (-482.462) (-474.977) -- 0:01:14
26500 -- (-471.997) (-477.338) (-468.473) [-470.351] * (-467.572) (-468.222) (-476.554) [-481.976] -- 0:01:13
27000 -- (-468.139) (-486.180) (-468.310) [-468.510] * (-468.277) [-468.962] (-479.092) (-474.315) -- 0:01:12
27500 -- (-472.238) [-473.763] (-469.179) (-469.597) * (-468.398) (-472.067) (-479.708) [-478.184] -- 0:01:10
28000 -- (-472.976) (-488.392) (-478.682) [-469.085] * [-468.361] (-470.271) (-486.856) (-477.083) -- 0:01:09
28500 -- [-471.205] (-474.071) (-471.211) (-469.865) * (-468.574) (-470.933) [-478.605] (-477.479) -- 0:01:08
29000 -- (-468.680) (-479.777) (-471.282) [-469.060] * (-468.871) (-470.414) [-475.863] (-475.734) -- 0:01:06
29500 -- (-468.558) [-475.980] (-468.940) (-475.171) * (-468.890) (-467.739) [-476.545] (-472.690) -- 0:01:05
30000 -- (-469.061) [-476.948] (-469.205) (-471.331) * [-469.002] (-469.330) (-480.960) (-477.869) -- 0:01:04
Average standard deviation of split frequencies: 0.042700
30500 -- (-470.867) (-483.109) [-467.848] (-468.495) * (-467.991) (-470.794) (-483.302) [-476.585] -- 0:01:03
31000 -- (-471.484) (-479.298) [-467.192] (-469.042) * (-469.219) [-467.480] (-476.714) (-475.306) -- 0:01:33
31500 -- (-467.355) (-477.735) [-467.029] (-468.984) * (-471.734) (-471.847) (-479.457) [-476.196] -- 0:01:32
32000 -- (-469.234) (-478.369) (-469.193) [-467.138] * (-468.463) (-467.631) [-481.167] (-479.640) -- 0:01:30
32500 -- [-469.002] (-477.662) (-471.334) (-468.017) * [-470.112] (-467.560) (-485.107) (-475.300) -- 0:01:29
33000 -- (-471.097) [-471.436] (-469.619) (-470.854) * (-475.055) (-468.432) [-475.000] (-481.304) -- 0:01:27
33500 -- (-468.714) (-477.894) (-472.072) [-467.860] * [-470.678] (-467.962) (-480.908) (-483.093) -- 0:01:26
34000 -- (-467.408) (-478.089) [-467.756] (-468.484) * (-468.508) (-471.484) (-472.805) [-480.328] -- 0:01:25
34500 -- (-470.044) (-476.916) (-472.579) [-468.778] * [-470.070] (-471.656) (-475.190) (-475.210) -- 0:01:23
35000 -- [-468.424] (-477.004) (-470.263) (-470.492) * [-468.675] (-468.768) (-482.545) (-473.884) -- 0:01:22
Average standard deviation of split frequencies: 0.042365
35500 -- (-471.176) (-480.859) (-468.157) [-469.811] * [-469.002] (-471.727) (-477.632) (-480.707) -- 0:01:21
36000 -- [-468.097] (-483.026) (-470.227) (-467.842) * (-467.594) (-469.277) (-482.054) [-476.680] -- 0:01:20
36500 -- [-468.776] (-477.374) (-470.593) (-467.954) * (-470.822) (-469.020) (-492.485) [-478.160] -- 0:01:19
37000 -- (-468.422) [-475.141] (-470.968) (-468.620) * (-467.688) (-467.698) [-475.635] (-476.662) -- 0:01:18
37500 -- [-469.109] (-485.141) (-469.507) (-467.220) * (-469.118) (-467.441) [-473.692] (-478.511) -- 0:01:17
38000 -- [-469.455] (-480.991) (-469.737) (-467.790) * (-470.010) [-468.268] (-480.731) (-476.793) -- 0:01:15
38500 -- (-468.884) (-473.731) [-470.989] (-469.422) * (-467.263) [-469.666] (-489.441) (-478.524) -- 0:01:14
39000 -- (-468.828) [-478.526] (-469.000) (-468.725) * (-469.843) [-474.045] (-480.199) (-485.404) -- 0:01:13
39500 -- (-468.503) (-481.445) (-468.247) [-470.150] * [-469.820] (-469.858) (-476.469) (-476.006) -- 0:01:12
40000 -- (-469.279) (-478.480) [-468.371] (-468.626) * (-469.189) (-467.658) (-489.182) [-474.837] -- 0:01:12
Average standard deviation of split frequencies: 0.045643
40500 -- (-469.211) (-481.268) [-469.769] (-467.477) * [-467.193] (-469.833) (-469.197) (-479.254) -- 0:01:11
41000 -- (-468.641) (-482.383) [-468.987] (-467.797) * [-467.915] (-469.765) (-469.518) (-490.847) -- 0:01:10
41500 -- (-468.112) (-475.476) (-468.059) [-471.367] * [-469.306] (-470.962) (-471.379) (-485.413) -- 0:01:09
42000 -- (-467.545) [-474.601] (-468.597) (-469.454) * (-469.975) (-469.671) [-469.800] (-480.800) -- 0:01:08
42500 -- (-470.312) (-482.857) [-467.447] (-468.403) * [-468.486] (-471.810) (-471.779) (-469.325) -- 0:01:07
43000 -- [-468.927] (-480.742) (-467.773) (-467.084) * [-473.241] (-471.510) (-468.053) (-468.686) -- 0:01:06
43500 -- (-471.504) (-475.611) (-473.166) [-470.419] * (-467.698) [-467.527] (-469.242) (-470.593) -- 0:01:05
44000 -- (-468.786) (-467.595) (-467.714) [-468.040] * (-467.324) (-468.229) [-469.028] (-479.840) -- 0:01:05
44500 -- (-471.619) (-469.407) (-469.574) [-469.656] * (-467.527) (-468.138) (-469.568) [-472.103] -- 0:01:04
45000 -- (-468.798) (-471.991) (-474.351) [-471.613] * (-468.043) (-470.375) [-471.545] (-470.248) -- 0:01:03
Average standard deviation of split frequencies: 0.033306
45500 -- (-468.056) (-468.237) (-471.212) [-467.865] * (-468.021) [-471.143] (-474.367) (-475.335) -- 0:01:23
46000 -- (-469.654) (-467.656) (-468.597) [-468.806] * (-469.393) [-470.525] (-474.055) (-469.185) -- 0:01:22
46500 -- [-468.788] (-467.228) (-469.011) (-470.058) * (-467.710) (-470.616) (-469.055) [-469.954] -- 0:01:22
47000 -- (-468.641) [-468.922] (-468.662) (-467.228) * (-470.743) [-467.291] (-468.839) (-468.953) -- 0:01:21
47500 -- (-468.298) (-468.182) (-473.284) [-467.649] * [-471.150] (-470.001) (-469.823) (-471.388) -- 0:01:20
48000 -- (-468.755) (-471.524) [-467.967] (-468.200) * (-469.391) [-468.476] (-468.668) (-468.746) -- 0:01:19
48500 -- [-471.535] (-470.009) (-468.207) (-467.139) * (-469.016) (-468.012) (-468.292) [-467.532] -- 0:01:18
49000 -- (-470.920) (-470.066) [-468.391] (-469.196) * [-468.581] (-468.338) (-468.959) (-470.694) -- 0:01:17
49500 -- (-468.028) (-470.485) (-468.710) [-471.340] * (-471.474) (-468.495) [-469.649] (-471.853) -- 0:01:16
50000 -- (-469.494) (-469.643) [-468.517] (-469.071) * (-468.987) (-468.799) [-467.143] (-473.073) -- 0:01:16
Average standard deviation of split frequencies: 0.037216
50500 -- (-468.174) (-467.828) [-467.891] (-471.115) * (-468.991) (-468.783) [-473.329] (-469.582) -- 0:01:15
51000 -- (-469.465) [-469.955] (-469.777) (-467.666) * (-468.532) [-471.271] (-474.305) (-470.911) -- 0:01:14
51500 -- [-467.553] (-470.278) (-468.383) (-468.782) * (-470.448) (-469.518) [-469.843] (-473.412) -- 0:01:13
52000 -- (-467.759) (-472.567) [-469.640] (-469.147) * (-477.355) (-471.310) [-469.421] (-470.372) -- 0:01:12
52500 -- (-468.500) (-470.904) [-469.519] (-468.755) * [-468.507] (-467.491) (-471.853) (-467.897) -- 0:01:12
53000 -- (-467.638) [-469.458] (-470.084) (-469.754) * (-471.148) (-470.940) [-468.024] (-471.112) -- 0:01:11
53500 -- (-468.756) (-470.440) [-467.943] (-468.722) * (-471.911) (-471.437) [-469.732] (-470.291) -- 0:01:10
54000 -- (-468.388) [-468.087] (-467.131) (-468.255) * (-473.155) (-468.973) (-467.366) [-468.425] -- 0:01:10
54500 -- [-468.760] (-470.089) (-469.036) (-469.896) * (-472.530) (-468.563) [-467.977] (-468.226) -- 0:01:09
55000 -- [-472.261] (-472.590) (-472.218) (-470.311) * (-470.333) [-468.897] (-470.940) (-469.292) -- 0:01:08
Average standard deviation of split frequencies: 0.033204
55500 -- (-471.238) (-470.012) [-471.003] (-467.601) * (-470.138) (-474.630) (-469.441) [-469.619] -- 0:01:08
56000 -- (-470.348) (-469.501) (-469.668) [-467.503] * (-468.953) (-469.538) [-469.050] (-468.345) -- 0:01:07
56500 -- (-469.684) (-469.133) [-474.261] (-467.688) * (-468.386) (-469.373) [-468.470] (-468.499) -- 0:01:06
57000 -- (-468.888) [-468.014] (-469.959) (-471.853) * (-469.911) (-470.561) (-467.133) [-469.609] -- 0:01:06
57500 -- (-470.885) (-468.682) [-468.522] (-469.100) * (-469.602) (-472.996) [-468.433] (-468.384) -- 0:01:05
58000 -- [-469.836] (-468.560) (-469.591) (-471.322) * (-470.014) (-468.182) [-467.827] (-468.923) -- 0:01:04
58500 -- (-469.356) [-469.468] (-468.882) (-474.173) * (-470.015) (-467.369) (-468.891) [-469.842] -- 0:01:04
59000 -- (-468.904) (-472.736) (-468.522) [-468.144] * (-469.500) (-468.887) (-470.172) [-472.478] -- 0:01:03
59500 -- [-467.306] (-468.728) (-469.788) (-468.600) * [-469.456] (-469.666) (-467.285) (-469.564) -- 0:01:03
60000 -- (-470.000) [-467.834] (-478.778) (-469.605) * (-469.571) (-467.786) [-467.983] (-468.231) -- 0:01:02
Average standard deviation of split frequencies: 0.035830
60500 -- [-467.743] (-468.813) (-467.193) (-468.756) * [-468.213] (-470.038) (-467.749) (-472.773) -- 0:01:17
61000 -- (-468.919) (-471.123) [-468.460] (-470.406) * [-469.698] (-473.339) (-467.411) (-472.352) -- 0:01:16
61500 -- (-470.774) (-468.169) [-468.630] (-469.956) * [-468.860] (-470.760) (-468.764) (-471.720) -- 0:01:16
62000 -- (-472.491) (-475.378) (-468.860) [-469.299] * (-473.034) (-470.100) (-468.433) [-471.684] -- 0:01:15
62500 -- (-467.880) (-469.501) [-467.769] (-471.959) * (-469.306) (-472.143) (-468.303) [-470.817] -- 0:01:15
63000 -- (-469.345) (-467.326) [-467.876] (-469.887) * [-468.366] (-468.306) (-467.874) (-468.326) -- 0:01:14
63500 -- (-470.967) (-468.322) (-468.157) [-468.916] * [-468.541] (-467.980) (-468.622) (-467.670) -- 0:01:13
64000 -- (-469.466) (-467.939) [-470.532] (-468.433) * (-468.992) [-469.632] (-472.379) (-470.286) -- 0:01:13
64500 -- (-471.623) (-469.312) (-469.231) [-469.719] * (-470.654) [-469.542] (-472.437) (-469.695) -- 0:01:12
65000 -- [-468.372] (-470.103) (-472.399) (-475.064) * [-467.647] (-467.836) (-473.188) (-468.316) -- 0:01:11
Average standard deviation of split frequencies: 0.034452
65500 -- [-470.238] (-467.073) (-470.831) (-468.145) * (-468.126) (-468.642) [-470.122] (-468.275) -- 0:01:11
66000 -- (-475.784) (-470.574) [-473.984] (-470.859) * (-467.683) [-469.141] (-468.562) (-473.764) -- 0:01:10
66500 -- (-469.673) (-468.875) (-469.421) [-470.904] * (-469.698) (-475.133) [-467.859] (-471.213) -- 0:01:10
67000 -- (-468.594) (-469.364) (-469.025) [-470.798] * (-468.149) (-473.911) [-470.984] (-469.325) -- 0:01:09
67500 -- (-476.756) (-470.510) [-467.393] (-471.680) * [-469.251] (-470.078) (-469.953) (-472.823) -- 0:01:09
68000 -- [-469.528] (-471.874) (-468.993) (-470.285) * (-467.754) (-472.179) [-470.272] (-470.570) -- 0:01:08
68500 -- (-470.451) (-473.307) (-471.945) [-467.394] * (-470.139) (-472.110) (-469.146) [-468.397] -- 0:01:07
69000 -- (-472.500) (-471.824) (-469.489) [-470.365] * (-468.506) [-469.035] (-470.332) (-470.188) -- 0:01:07
69500 -- (-469.945) (-472.640) [-469.072] (-471.941) * (-472.903) [-470.327] (-471.207) (-469.659) -- 0:01:06
70000 -- (-469.040) (-471.314) (-469.868) [-468.648] * [-472.674] (-469.333) (-469.167) (-471.006) -- 0:01:06
Average standard deviation of split frequencies: 0.027385
70500 -- (-469.418) (-469.948) (-471.091) [-468.645] * (-469.263) [-468.002] (-468.243) (-470.860) -- 0:01:05
71000 -- (-470.766) (-472.066) [-470.429] (-470.863) * (-476.899) (-469.153) (-468.909) [-468.805] -- 0:01:05
71500 -- (-468.561) [-469.770] (-469.109) (-469.100) * (-472.000) (-469.686) (-468.382) [-469.467] -- 0:01:04
72000 -- (-468.642) (-468.056) (-471.205) [-467.806] * (-471.603) [-468.385] (-467.305) (-470.287) -- 0:01:04
72500 -- [-467.404] (-470.422) (-469.545) (-469.035) * (-471.468) (-470.172) (-469.600) [-468.778] -- 0:01:03
73000 -- [-469.017] (-470.481) (-472.189) (-469.503) * [-469.592] (-468.919) (-468.898) (-470.757) -- 0:01:03
73500 -- [-468.675] (-468.301) (-471.571) (-469.830) * [-467.954] (-469.194) (-468.513) (-471.066) -- 0:01:03
74000 -- (-470.539) (-468.563) (-468.039) [-468.275] * (-470.135) (-476.288) [-468.360] (-473.124) -- 0:01:02
74500 -- (-469.665) [-468.917] (-469.776) (-470.679) * [-469.931] (-469.894) (-467.662) (-467.720) -- 0:01:02
75000 -- (-468.304) (-467.578) [-469.162] (-471.131) * (-468.555) (-470.922) (-468.492) [-474.087] -- 0:01:01
Average standard deviation of split frequencies: 0.029537
75500 -- [-469.885] (-468.180) (-468.674) (-469.682) * (-469.021) [-469.589] (-470.071) (-474.149) -- 0:01:01
76000 -- (-470.322) [-472.661] (-470.249) (-468.523) * [-468.762] (-468.700) (-467.504) (-470.820) -- 0:01:00
76500 -- (-472.290) [-467.400] (-471.512) (-469.554) * [-468.986] (-469.912) (-467.219) (-473.322) -- 0:01:00
77000 -- (-471.268) (-468.314) (-468.990) [-467.718] * (-471.663) [-469.086] (-468.248) (-477.735) -- 0:00:59
77500 -- (-472.254) (-474.856) [-468.761] (-470.788) * (-471.772) (-471.969) [-468.466] (-470.857) -- 0:01:11
78000 -- (-469.628) [-470.069] (-467.945) (-469.497) * (-469.217) [-472.995] (-471.630) (-471.381) -- 0:01:10
78500 -- [-467.301] (-468.216) (-469.803) (-468.821) * (-469.405) (-468.909) (-471.312) [-467.406] -- 0:01:10
79000 -- [-468.026] (-469.628) (-470.781) (-469.430) * (-469.291) [-471.230] (-469.378) (-470.075) -- 0:01:09
79500 -- (-469.970) [-469.356] (-470.055) (-468.437) * (-470.848) (-468.282) (-471.464) [-471.216] -- 0:01:09
80000 -- [-474.381] (-468.041) (-470.985) (-468.623) * (-470.367) (-468.986) [-469.183] (-469.603) -- 0:01:09
Average standard deviation of split frequencies: 0.030972
80500 -- (-467.432) (-471.209) (-469.244) [-468.149] * [-467.061] (-468.148) (-468.455) (-470.586) -- 0:01:08
81000 -- (-468.319) (-467.946) (-470.594) [-469.571] * (-470.011) (-472.631) [-468.705] (-468.987) -- 0:01:08
81500 -- (-468.444) [-470.503] (-470.490) (-471.124) * [-470.530] (-481.661) (-469.068) (-471.448) -- 0:01:07
82000 -- (-468.278) (-471.251) (-469.287) [-472.095] * [-469.284] (-467.759) (-471.551) (-476.673) -- 0:01:07
82500 -- (-467.925) (-468.023) [-469.434] (-467.101) * (-471.739) (-470.149) [-469.437] (-472.339) -- 0:01:06
83000 -- [-468.024] (-468.082) (-468.926) (-473.101) * (-473.513) [-468.262] (-468.645) (-470.354) -- 0:01:06
83500 -- [-467.133] (-468.657) (-470.255) (-467.890) * [-470.205] (-469.613) (-469.903) (-468.567) -- 0:01:05
84000 -- (-467.471) (-471.455) [-471.553] (-470.140) * [-468.664] (-468.969) (-469.193) (-471.978) -- 0:01:05
84500 -- [-469.102] (-467.780) (-469.328) (-472.859) * [-467.351] (-467.565) (-468.195) (-472.144) -- 0:01:05
85000 -- (-470.165) (-468.074) (-469.024) [-473.656] * (-468.451) (-467.873) (-467.423) [-469.269] -- 0:01:04
Average standard deviation of split frequencies: 0.026885
85500 -- (-470.758) (-467.775) (-469.913) [-469.144] * (-469.127) [-468.477] (-469.014) (-470.667) -- 0:01:04
86000 -- (-469.545) (-468.490) (-469.701) [-468.479] * (-467.823) [-468.440] (-470.827) (-469.291) -- 0:01:03
86500 -- (-468.833) (-469.761) (-469.854) [-468.421] * [-470.051] (-469.342) (-471.816) (-469.605) -- 0:01:03
87000 -- [-472.949] (-468.975) (-470.446) (-468.817) * (-468.617) [-467.222] (-470.946) (-470.022) -- 0:01:02
87500 -- (-474.195) [-467.795] (-468.902) (-468.667) * (-467.239) (-467.205) [-470.727] (-468.963) -- 0:01:02
88000 -- (-472.804) [-469.928] (-472.793) (-471.311) * (-468.947) (-469.389) [-470.815] (-469.761) -- 0:01:02
88500 -- (-470.607) (-468.468) (-471.412) [-466.985] * (-470.021) (-469.199) (-466.955) [-467.210] -- 0:01:01
89000 -- (-468.037) (-471.142) (-476.599) [-470.422] * [-471.613] (-468.963) (-468.305) (-471.487) -- 0:01:01
89500 -- (-469.620) [-470.037] (-474.525) (-469.575) * (-469.662) (-469.135) [-467.744] (-468.422) -- 0:01:01
90000 -- (-468.016) (-471.412) [-468.955] (-470.905) * (-471.500) (-468.260) (-469.459) [-469.956] -- 0:01:00
Average standard deviation of split frequencies: 0.024511
90500 -- (-470.275) [-467.675] (-473.431) (-469.902) * (-467.554) [-468.323] (-469.461) (-468.897) -- 0:01:00
91000 -- (-467.421) (-467.458) [-470.115] (-469.278) * (-467.366) (-468.170) [-469.472] (-467.862) -- 0:00:59
91500 -- (-467.296) [-469.470] (-469.694) (-469.395) * (-469.189) [-471.177] (-468.648) (-471.047) -- 0:00:59
92000 -- (-470.575) (-467.866) (-467.447) [-471.201] * (-472.503) [-467.811] (-468.740) (-469.146) -- 0:00:59
92500 -- (-469.630) (-467.815) [-468.286] (-469.810) * (-469.964) [-468.949] (-469.351) (-468.967) -- 0:00:58
93000 -- (-473.924) (-469.751) [-469.177] (-467.410) * (-467.923) (-471.023) (-470.299) [-467.684] -- 0:00:58
93500 -- [-468.458] (-468.791) (-470.456) (-468.715) * (-468.305) [-472.364] (-467.785) (-472.647) -- 0:00:58
94000 -- [-467.917] (-468.905) (-471.252) (-469.344) * [-467.963] (-468.466) (-467.996) (-474.647) -- 0:00:57
94500 -- (-470.096) [-469.265] (-470.746) (-469.147) * (-469.104) (-468.259) (-468.323) [-469.583] -- 0:01:07
95000 -- (-473.084) (-467.894) [-467.935] (-469.284) * (-469.088) (-468.747) [-468.565] (-468.106) -- 0:01:06
Average standard deviation of split frequencies: 0.029217
95500 -- (-473.216) [-467.603] (-467.766) (-469.987) * (-471.443) [-467.619] (-468.204) (-467.870) -- 0:01:06
96000 -- (-468.356) (-467.731) (-473.244) [-471.003] * (-467.137) [-469.848] (-472.866) (-467.410) -- 0:01:05
96500 -- (-471.625) (-469.520) (-473.125) [-470.369] * (-468.262) (-467.905) [-469.759] (-467.656) -- 0:01:05
97000 -- (-471.012) [-469.818] (-468.828) (-468.283) * (-468.224) (-468.220) (-467.853) [-470.475] -- 0:01:05
97500 -- (-476.025) [-469.914] (-470.132) (-469.569) * (-467.345) (-468.477) (-468.809) [-472.801] -- 0:01:04
98000 -- (-469.215) (-471.189) (-468.008) [-468.426] * (-468.724) (-469.784) [-467.936] (-469.604) -- 0:01:04
98500 -- (-470.840) (-467.710) [-467.727] (-469.114) * (-467.228) (-473.777) (-468.805) [-468.884] -- 0:01:04
99000 -- (-468.224) (-470.224) (-470.611) [-468.477] * (-468.085) (-469.052) [-470.593] (-468.827) -- 0:01:03
99500 -- [-468.906] (-468.498) (-468.100) (-469.425) * (-468.552) (-470.004) (-467.326) [-468.043] -- 0:01:03
100000 -- (-467.233) (-468.539) (-470.153) [-467.463] * (-469.383) (-468.828) [-468.911] (-467.741) -- 0:01:02
Average standard deviation of split frequencies: 0.025139
100500 -- (-478.846) [-468.461] (-469.369) (-470.452) * (-467.524) (-470.846) (-468.785) [-469.492] -- 0:01:02
101000 -- (-472.645) [-469.211] (-470.724) (-468.996) * (-467.952) (-467.923) [-467.655] (-468.690) -- 0:01:02
101500 -- (-469.403) (-468.516) (-471.502) [-469.008] * (-467.402) [-468.920] (-470.892) (-470.285) -- 0:01:01
102000 -- (-476.111) (-469.827) [-473.319] (-471.214) * (-467.402) (-470.711) [-470.249] (-469.826) -- 0:01:01
102500 -- [-470.590] (-467.968) (-470.638) (-469.991) * (-468.442) (-468.389) [-468.156] (-467.950) -- 0:01:01
103000 -- (-468.517) (-469.604) [-470.302] (-471.783) * (-471.557) (-469.068) [-469.413] (-467.952) -- 0:01:00
103500 -- (-468.718) (-467.935) (-470.621) [-467.883] * (-471.282) (-470.256) (-471.023) [-467.462] -- 0:01:00
104000 -- (-467.650) [-469.801] (-468.758) (-467.812) * (-469.514) [-467.815] (-469.379) (-467.759) -- 0:01:00
104500 -- (-471.269) (-470.384) [-468.346] (-470.768) * (-469.993) (-466.906) (-470.953) [-469.525] -- 0:00:59
105000 -- [-468.071] (-471.659) (-470.437) (-473.033) * (-470.074) (-467.783) (-475.283) [-469.988] -- 0:00:59
Average standard deviation of split frequencies: 0.019661
105500 -- (-468.532) [-469.427] (-470.081) (-470.570) * [-470.612] (-468.489) (-470.274) (-467.812) -- 0:00:59
106000 -- [-469.499] (-471.795) (-468.372) (-468.488) * (-468.706) (-468.097) (-473.219) [-467.085] -- 0:00:59
106500 -- (-468.498) (-472.079) (-468.374) [-467.648] * (-470.301) [-468.133] (-470.171) (-469.905) -- 0:00:58
107000 -- (-468.732) [-469.128] (-468.508) (-472.081) * (-471.447) (-470.558) [-469.069] (-468.321) -- 0:00:58
107500 -- [-467.629] (-467.945) (-467.373) (-470.106) * [-468.819] (-469.225) (-469.886) (-469.006) -- 0:00:58
108000 -- (-468.558) [-467.721] (-469.069) (-470.021) * (-471.915) (-468.554) (-467.936) [-467.826] -- 0:00:57
108500 -- (-467.679) [-469.430] (-470.378) (-480.077) * [-469.332] (-467.227) (-467.917) (-470.235) -- 0:00:57
109000 -- (-469.183) [-469.713] (-469.987) (-471.280) * [-469.525] (-470.002) (-471.097) (-467.839) -- 0:00:57
109500 -- [-469.615] (-471.945) (-467.840) (-469.834) * (-468.462) [-469.845] (-469.564) (-472.052) -- 0:00:56
110000 -- (-468.390) (-470.408) (-468.254) [-469.132] * (-471.413) [-468.012] (-468.663) (-470.577) -- 0:00:56
Average standard deviation of split frequencies: 0.019953
110500 -- [-467.491] (-472.478) (-467.555) (-468.423) * (-470.162) (-468.249) [-468.669] (-472.143) -- 0:01:04
111000 -- (-467.379) (-470.488) [-467.235] (-470.399) * (-471.196) [-468.023] (-469.549) (-467.919) -- 0:01:04
111500 -- (-468.290) (-468.007) [-468.578] (-469.098) * (-468.802) [-467.596] (-468.442) (-469.309) -- 0:01:03
112000 -- (-469.319) (-471.344) [-469.250] (-477.314) * (-468.974) (-473.461) (-471.256) [-469.034] -- 0:01:03
112500 -- (-469.241) (-471.350) [-469.926] (-467.714) * (-476.795) (-467.871) (-468.287) [-468.299] -- 0:01:03
113000 -- (-469.123) (-468.998) (-471.668) [-467.841] * (-471.848) (-469.724) [-468.102] (-471.408) -- 0:01:02
113500 -- (-467.944) [-470.828] (-468.635) (-469.255) * (-474.625) (-469.250) (-471.745) [-470.048] -- 0:01:02
114000 -- (-469.106) (-468.781) (-469.771) [-468.346] * (-480.442) (-469.061) (-468.109) [-469.520] -- 0:01:02
114500 -- (-467.884) [-469.662] (-470.516) (-472.516) * (-480.848) (-469.556) (-475.104) [-468.676] -- 0:01:01
115000 -- (-468.414) [-468.493] (-470.278) (-473.920) * (-474.946) [-469.363] (-468.324) (-469.589) -- 0:01:01
Average standard deviation of split frequencies: 0.021742
115500 -- (-471.614) (-470.866) (-471.673) [-470.376] * (-477.882) (-471.958) (-472.497) [-468.141] -- 0:01:01
116000 -- (-468.736) [-471.617] (-472.964) (-475.820) * (-472.355) (-471.377) (-469.926) [-470.577] -- 0:01:00
116500 -- [-468.459] (-468.336) (-468.341) (-472.064) * (-467.613) (-468.195) (-471.043) [-469.816] -- 0:01:00
117000 -- (-468.425) (-473.723) (-467.853) [-470.835] * [-469.899] (-468.367) (-469.896) (-469.228) -- 0:01:00
117500 -- (-468.667) (-474.524) (-468.521) [-468.400] * [-469.774] (-467.564) (-468.653) (-467.846) -- 0:01:00
118000 -- (-473.514) (-471.408) (-468.389) [-469.411] * (-470.969) (-470.010) (-468.149) [-467.854] -- 0:00:59
118500 -- [-469.266] (-469.597) (-467.468) (-472.478) * (-469.711) [-469.811] (-467.175) (-469.106) -- 0:00:59
119000 -- [-467.135] (-468.300) (-469.093) (-468.827) * [-473.878] (-469.041) (-468.866) (-470.488) -- 0:00:59
119500 -- (-467.069) (-470.489) (-469.892) [-471.655] * (-467.270) (-466.959) [-471.559] (-471.293) -- 0:00:58
120000 -- (-467.812) (-473.029) [-468.321] (-468.981) * [-471.987] (-469.248) (-471.571) (-470.055) -- 0:00:58
Average standard deviation of split frequencies: 0.016244
120500 -- [-467.263] (-469.858) (-467.459) (-472.033) * (-472.753) (-467.692) [-468.956] (-470.611) -- 0:00:58
121000 -- (-467.706) (-468.670) [-467.978] (-469.884) * (-471.093) [-469.324] (-468.032) (-469.113) -- 0:00:58
121500 -- (-467.413) [-467.046] (-469.628) (-468.119) * (-472.645) (-468.544) [-471.455] (-468.993) -- 0:00:57
122000 -- (-470.667) [-468.457] (-468.620) (-469.518) * (-469.345) (-470.381) (-471.613) [-468.806] -- 0:00:57
122500 -- [-469.833] (-468.293) (-468.572) (-467.648) * [-467.790] (-470.143) (-470.731) (-467.919) -- 0:00:57
123000 -- [-471.811] (-471.563) (-468.388) (-469.160) * (-467.818) (-468.565) [-467.159] (-469.688) -- 0:00:57
123500 -- (-470.252) [-469.127] (-468.757) (-471.613) * (-469.989) (-471.805) [-469.454] (-469.624) -- 0:00:56
124000 -- [-467.036] (-472.218) (-469.027) (-469.041) * (-471.747) [-469.521] (-471.151) (-468.291) -- 0:00:56
124500 -- (-468.166) (-469.943) (-468.030) [-470.873] * (-467.974) (-472.724) [-472.054] (-468.344) -- 0:00:56
125000 -- (-475.513) [-469.296] (-471.703) (-468.053) * [-469.238] (-470.389) (-478.325) (-468.754) -- 0:00:56
Average standard deviation of split frequencies: 0.017210
125500 -- [-472.676] (-468.610) (-468.850) (-472.672) * (-468.240) (-474.217) [-471.180] (-468.160) -- 0:00:55
126000 -- (-468.279) (-470.122) (-468.552) [-469.608] * (-470.367) [-469.518] (-469.083) (-468.121) -- 0:00:55
126500 -- (-469.058) (-468.090) (-468.442) [-467.467] * (-471.538) (-468.728) (-469.873) [-468.361] -- 0:00:55
127000 -- [-468.112] (-469.103) (-469.284) (-467.497) * (-471.085) (-471.283) [-468.992] (-469.152) -- 0:00:54
127500 -- (-469.223) (-470.516) (-469.285) [-469.292] * (-469.628) [-467.261] (-472.772) (-467.853) -- 0:01:01
128000 -- (-469.279) (-468.828) [-471.676] (-469.364) * [-468.040] (-470.706) (-471.091) (-469.508) -- 0:01:01
128500 -- (-468.473) (-468.594) [-469.942] (-471.799) * (-468.127) [-467.743] (-470.027) (-469.826) -- 0:01:01
129000 -- [-470.489] (-467.250) (-467.368) (-473.961) * (-468.520) (-469.973) [-467.947] (-467.444) -- 0:01:00
129500 -- [-468.485] (-469.181) (-467.919) (-470.162) * [-468.830] (-469.458) (-471.224) (-472.540) -- 0:01:00
130000 -- (-468.887) (-473.829) (-472.160) [-470.170] * [-467.746] (-471.980) (-468.323) (-467.964) -- 0:01:00
Average standard deviation of split frequencies: 0.014431
130500 -- [-468.311] (-473.015) (-469.685) (-468.083) * (-468.232) [-468.078] (-467.320) (-473.391) -- 0:00:59
131000 -- [-469.965] (-469.523) (-467.498) (-469.158) * (-467.705) (-467.650) (-472.947) [-468.668] -- 0:00:59
131500 -- [-471.855] (-470.970) (-468.584) (-469.439) * [-470.236] (-468.073) (-469.338) (-472.735) -- 0:00:59
132000 -- [-469.816] (-468.501) (-468.910) (-474.895) * (-470.582) (-472.160) (-469.056) [-468.106] -- 0:00:59
132500 -- (-470.243) (-469.327) [-469.589] (-469.305) * (-470.506) (-469.562) [-470.146] (-467.527) -- 0:00:58
133000 -- (-471.673) (-468.968) [-467.770] (-469.080) * (-471.282) (-470.256) [-472.182] (-467.642) -- 0:00:58
133500 -- (-472.358) (-469.546) (-467.649) [-468.866] * (-470.900) (-468.122) (-469.660) [-472.172] -- 0:00:58
134000 -- (-471.890) [-468.349] (-470.390) (-472.345) * (-470.957) (-469.513) [-468.673] (-468.571) -- 0:00:58
134500 -- (-471.314) [-469.538] (-471.264) (-472.220) * (-467.960) (-468.995) (-469.038) [-468.427] -- 0:00:57
135000 -- (-472.814) (-469.550) (-468.974) [-468.651] * [-468.519] (-474.639) (-471.711) (-471.869) -- 0:00:57
Average standard deviation of split frequencies: 0.014047
135500 -- [-469.695] (-469.410) (-467.989) (-470.515) * (-468.544) (-467.853) (-469.229) [-468.350] -- 0:00:57
136000 -- (-469.586) (-469.606) (-467.264) [-467.565] * (-468.918) (-468.038) [-470.003] (-467.574) -- 0:00:57
136500 -- (-468.779) (-471.103) [-467.835] (-469.342) * (-470.729) (-467.937) [-469.061] (-468.919) -- 0:00:56
137000 -- [-467.884] (-467.798) (-470.981) (-471.373) * (-469.081) (-467.403) (-468.176) [-471.982] -- 0:00:56
137500 -- (-469.030) [-469.143] (-471.127) (-470.888) * [-468.135] (-470.443) (-472.105) (-469.234) -- 0:00:56
138000 -- [-469.994] (-468.277) (-467.417) (-467.582) * (-468.773) (-467.520) (-467.673) [-470.117] -- 0:00:56
138500 -- (-469.299) (-468.013) [-469.434] (-469.940) * (-470.873) (-468.213) [-469.241] (-470.777) -- 0:00:55
139000 -- (-467.940) (-470.705) (-470.582) [-471.449] * (-471.163) (-470.148) (-470.691) [-469.951] -- 0:00:55
139500 -- [-470.182] (-472.656) (-469.118) (-471.560) * [-470.152] (-471.798) (-469.621) (-469.593) -- 0:00:55
140000 -- (-469.700) [-468.057] (-473.464) (-469.239) * [-467.829] (-471.234) (-469.532) (-467.315) -- 0:00:55
Average standard deviation of split frequencies: 0.013228
140500 -- (-470.680) [-469.034] (-467.147) (-468.225) * [-470.929] (-470.404) (-469.023) (-470.661) -- 0:00:55
141000 -- (-468.143) [-468.914] (-467.611) (-468.672) * (-468.692) (-467.365) (-472.741) [-469.853] -- 0:00:54
141500 -- (-469.014) (-470.897) [-469.256] (-469.456) * (-467.808) (-469.783) [-469.192] (-469.824) -- 0:00:54
142000 -- [-468.240] (-471.047) (-470.223) (-471.635) * [-467.121] (-469.791) (-474.340) (-468.685) -- 0:00:54
142500 -- [-467.312] (-473.866) (-469.138) (-469.979) * (-469.310) [-468.101] (-468.700) (-470.163) -- 0:00:54
143000 -- (-468.423) [-474.001] (-467.738) (-470.483) * (-468.191) (-468.936) (-475.848) [-468.956] -- 0:00:53
143500 -- [-469.496] (-467.294) (-468.674) (-470.379) * (-468.316) (-469.780) [-468.469] (-468.322) -- 0:00:53
144000 -- (-468.658) (-476.759) (-468.386) [-468.895] * (-469.874) (-469.432) [-470.784] (-471.318) -- 0:00:53
144500 -- [-468.474] (-468.150) (-468.351) (-469.680) * (-471.840) (-470.380) (-469.256) [-469.399] -- 0:00:59
145000 -- (-467.707) (-468.734) [-472.964] (-469.368) * (-472.746) [-477.357] (-477.820) (-469.534) -- 0:00:58
Average standard deviation of split frequencies: 0.014530
145500 -- (-469.168) (-469.012) (-469.728) [-470.627] * [-476.175] (-477.473) (-468.168) (-469.633) -- 0:00:58
146000 -- [-469.404] (-470.594) (-472.364) (-469.864) * (-471.930) (-473.475) [-469.573] (-471.932) -- 0:00:58
146500 -- (-469.279) [-467.717] (-472.216) (-472.288) * [-469.643] (-471.558) (-469.383) (-471.923) -- 0:00:58
147000 -- (-470.292) (-469.555) [-470.233] (-468.664) * (-469.634) (-470.879) (-471.887) [-468.315] -- 0:00:58
147500 -- (-468.847) (-467.747) [-469.736] (-468.029) * (-467.540) (-472.275) [-468.319] (-468.117) -- 0:00:57
148000 -- (-467.250) (-469.481) [-471.878] (-470.184) * (-469.948) (-469.271) [-474.111] (-468.797) -- 0:00:57
148500 -- [-471.202] (-468.731) (-469.092) (-469.925) * [-469.992] (-468.138) (-470.170) (-467.801) -- 0:00:57
149000 -- (-468.112) (-471.056) (-469.129) [-469.698] * (-468.685) (-470.560) [-467.758] (-468.270) -- 0:00:57
149500 -- (-468.621) (-468.985) (-467.958) [-468.167] * (-468.317) [-467.155] (-467.744) (-467.655) -- 0:00:56
150000 -- (-467.200) (-473.398) [-472.290] (-469.018) * [-469.742] (-473.314) (-467.423) (-467.324) -- 0:00:56
Average standard deviation of split frequencies: 0.015175
150500 -- [-468.413] (-467.471) (-469.794) (-469.826) * [-468.312] (-470.178) (-468.636) (-470.945) -- 0:00:56
151000 -- (-469.249) [-470.101] (-467.497) (-470.560) * [-468.646] (-472.350) (-469.056) (-469.465) -- 0:00:56
151500 -- (-470.530) [-470.475] (-471.199) (-471.328) * (-471.206) (-467.666) (-467.802) [-467.261] -- 0:00:56
152000 -- [-472.768] (-469.640) (-468.644) (-468.672) * (-467.617) (-468.263) [-471.111] (-469.690) -- 0:00:55
152500 -- (-472.160) (-470.785) [-471.162] (-470.040) * [-468.289] (-468.999) (-469.682) (-471.729) -- 0:00:55
153000 -- (-469.879) (-471.748) [-468.747] (-471.007) * (-474.548) (-471.575) [-472.254] (-468.883) -- 0:00:55
153500 -- [-469.356] (-468.830) (-469.330) (-467.796) * (-473.086) (-470.186) [-469.545] (-469.577) -- 0:00:55
154000 -- (-471.519) (-469.005) [-468.779] (-467.676) * (-475.329) [-469.888] (-472.765) (-469.989) -- 0:00:54
154500 -- [-469.466] (-471.729) (-471.210) (-470.102) * (-470.694) (-470.065) (-471.119) [-469.640] -- 0:00:54
155000 -- [-469.871] (-472.756) (-469.745) (-467.803) * (-469.041) [-473.625] (-469.488) (-470.153) -- 0:00:54
Average standard deviation of split frequencies: 0.014203
155500 -- (-470.674) (-470.795) [-468.474] (-468.747) * [-468.567] (-472.175) (-468.410) (-467.771) -- 0:00:54
156000 -- (-468.878) (-472.916) [-469.925] (-469.133) * (-471.985) (-469.400) (-468.167) [-468.850] -- 0:00:54
156500 -- [-469.535] (-470.322) (-472.434) (-469.982) * (-471.250) [-470.036] (-470.485) (-468.248) -- 0:00:53
157000 -- (-470.051) (-469.910) [-468.405] (-468.243) * (-472.640) [-467.332] (-471.277) (-469.335) -- 0:00:53
157500 -- (-468.455) (-474.976) [-467.001] (-469.063) * [-469.143] (-467.575) (-470.965) (-471.506) -- 0:00:53
158000 -- (-472.252) [-467.579] (-470.934) (-468.899) * (-469.719) [-468.921] (-467.980) (-468.190) -- 0:00:53
158500 -- [-473.122] (-467.607) (-468.650) (-466.944) * [-468.854] (-468.453) (-467.275) (-472.379) -- 0:00:53
159000 -- [-471.343] (-468.796) (-471.280) (-470.652) * (-470.809) [-468.045] (-470.583) (-468.660) -- 0:00:52
159500 -- [-468.095] (-468.418) (-470.945) (-472.749) * (-471.115) (-469.920) (-467.390) [-470.278] -- 0:00:52
160000 -- (-469.407) (-469.966) (-472.583) [-472.041] * (-473.303) (-470.461) (-470.467) [-469.028] -- 0:00:52
Average standard deviation of split frequencies: 0.016804
160500 -- [-467.872] (-476.475) (-469.819) (-472.100) * (-468.695) (-468.620) (-468.623) [-470.283] -- 0:00:52
161000 -- (-468.432) [-469.164] (-467.716) (-469.915) * [-468.032] (-468.644) (-471.377) (-469.579) -- 0:00:52
161500 -- (-467.516) (-467.439) [-468.432] (-470.911) * (-468.810) [-468.833] (-470.921) (-468.768) -- 0:00:57
162000 -- (-468.665) [-468.787] (-468.679) (-469.903) * (-468.690) (-468.347) [-467.914] (-470.675) -- 0:00:56
162500 -- (-468.901) (-475.019) (-467.845) [-467.324] * (-469.204) (-468.158) [-469.429] (-471.622) -- 0:00:56
163000 -- (-468.206) (-469.067) (-467.553) [-467.437] * [-470.798] (-469.283) (-467.560) (-468.825) -- 0:00:56
163500 -- [-471.825] (-467.460) (-467.246) (-467.445) * (-468.123) (-470.428) [-469.255] (-471.138) -- 0:00:56
164000 -- (-473.029) (-471.396) (-472.787) [-471.488] * (-470.356) (-467.989) (-467.485) [-468.574] -- 0:00:56
164500 -- (-471.935) (-468.154) [-469.400] (-468.310) * (-469.535) [-472.986] (-467.396) (-468.443) -- 0:00:55
165000 -- (-470.257) (-467.226) (-470.085) [-470.036] * [-467.722] (-470.701) (-468.726) (-473.469) -- 0:00:55
Average standard deviation of split frequencies: 0.016633
165500 -- [-469.510] (-467.210) (-469.567) (-470.722) * (-467.782) (-470.331) (-471.926) [-470.376] -- 0:00:55
166000 -- (-474.259) [-468.525] (-470.919) (-470.298) * [-468.043] (-469.754) (-469.838) (-469.070) -- 0:00:55
166500 -- (-470.697) (-470.207) [-472.780] (-469.547) * (-470.251) (-469.301) (-468.113) [-469.824] -- 0:00:55
167000 -- (-470.909) (-470.526) [-470.420] (-472.928) * (-472.604) [-468.305] (-470.615) (-470.360) -- 0:00:54
167500 -- [-467.656] (-468.912) (-469.367) (-470.789) * [-469.121] (-469.655) (-467.527) (-469.102) -- 0:00:54
168000 -- (-469.647) (-470.156) (-474.122) [-468.327] * [-468.304] (-470.782) (-468.707) (-469.127) -- 0:00:54
168500 -- (-470.952) (-467.705) [-469.665] (-471.308) * (-467.946) (-469.288) [-471.739] (-471.410) -- 0:00:54
169000 -- (-467.332) (-468.146) [-469.573] (-469.143) * (-469.888) (-468.179) [-470.112] (-470.596) -- 0:00:54
169500 -- (-469.061) [-469.040] (-472.120) (-467.603) * (-467.696) (-472.210) (-471.313) [-469.018] -- 0:00:53
170000 -- (-473.707) [-468.250] (-473.028) (-469.200) * [-470.420] (-470.499) (-469.161) (-469.756) -- 0:00:53
Average standard deviation of split frequencies: 0.016071
170500 -- [-468.070] (-470.602) (-471.059) (-469.645) * (-469.921) (-470.384) (-469.602) [-469.859] -- 0:00:53
171000 -- (-470.194) (-471.673) (-473.612) [-469.734] * [-470.702] (-470.010) (-469.372) (-467.674) -- 0:00:53
171500 -- (-470.452) (-468.575) [-470.805] (-468.732) * [-470.516] (-469.472) (-468.721) (-467.245) -- 0:00:53
172000 -- [-470.340] (-467.570) (-470.923) (-467.848) * (-468.782) (-469.135) [-469.787] (-468.884) -- 0:00:52
172500 -- (-468.798) (-468.311) [-469.870] (-470.819) * [-471.967] (-468.657) (-468.052) (-467.718) -- 0:00:52
173000 -- (-468.700) (-469.843) (-467.502) [-469.849] * (-470.356) (-469.487) (-469.586) [-468.957] -- 0:00:52
173500 -- (-468.907) [-469.178] (-468.520) (-469.761) * [-470.513] (-470.849) (-469.899) (-470.175) -- 0:00:52
174000 -- (-469.337) [-467.033] (-469.222) (-470.441) * (-471.260) (-471.615) [-470.945] (-469.820) -- 0:00:52
174500 -- (-469.365) [-467.144] (-467.717) (-468.675) * (-468.174) [-471.991] (-470.103) (-468.027) -- 0:00:52
175000 -- (-467.520) (-470.471) [-469.534] (-468.491) * (-469.327) (-472.011) [-469.053] (-472.879) -- 0:00:51
Average standard deviation of split frequencies: 0.014923
175500 -- (-467.934) (-470.596) [-471.137] (-467.441) * (-468.613) (-469.684) (-468.664) [-470.557] -- 0:00:51
176000 -- [-468.317] (-471.886) (-471.297) (-470.888) * (-469.999) [-468.146] (-471.725) (-469.141) -- 0:00:51
176500 -- [-470.542] (-468.978) (-469.680) (-469.392) * (-470.085) (-469.030) [-469.670] (-469.369) -- 0:00:51
177000 -- [-468.832] (-469.201) (-469.572) (-468.930) * (-469.328) (-469.111) [-468.696] (-469.605) -- 0:00:51
177500 -- (-468.481) (-468.667) [-469.268] (-468.214) * (-470.168) [-470.463] (-467.795) (-468.621) -- 0:00:50
178000 -- [-466.856] (-470.278) (-468.946) (-468.782) * (-473.580) [-468.170] (-469.158) (-468.176) -- 0:00:50
178500 -- (-469.860) (-468.538) [-468.590] (-468.056) * [-470.446] (-469.435) (-468.157) (-470.781) -- 0:00:55
179000 -- (-467.886) (-468.707) (-473.320) [-469.409] * (-473.943) (-469.676) [-468.934] (-469.898) -- 0:00:55
179500 -- (-469.266) (-469.012) [-472.334] (-469.805) * [-468.702] (-468.289) (-468.790) (-472.330) -- 0:00:54
180000 -- (-468.138) (-471.234) [-470.682] (-467.541) * (-477.136) [-468.324] (-468.153) (-470.978) -- 0:00:54
Average standard deviation of split frequencies: 0.015076
180500 -- (-468.001) (-468.538) [-468.969] (-468.401) * (-468.397) [-468.812] (-467.845) (-475.426) -- 0:00:54
181000 -- (-468.915) [-470.009] (-472.725) (-471.326) * (-468.537) [-468.447] (-467.755) (-472.386) -- 0:00:54
181500 -- (-467.945) (-470.191) [-470.043] (-468.418) * (-468.978) [-467.860] (-469.809) (-469.100) -- 0:00:54
182000 -- (-480.057) (-468.178) (-468.858) [-469.922] * (-471.889) [-467.657] (-469.274) (-467.666) -- 0:00:53
182500 -- (-474.413) (-469.764) [-470.088] (-467.152) * (-467.610) [-468.723] (-467.506) (-469.406) -- 0:00:53
183000 -- [-468.626] (-467.533) (-473.146) (-467.279) * [-467.857] (-470.189) (-467.414) (-470.473) -- 0:00:53
183500 -- (-467.892) [-469.378] (-470.777) (-468.854) * (-467.703) [-470.455] (-468.389) (-469.837) -- 0:00:53
184000 -- (-468.692) (-469.847) [-470.488] (-471.843) * [-470.785] (-468.051) (-467.667) (-470.701) -- 0:00:53
184500 -- (-472.314) [-473.596] (-469.327) (-469.357) * [-468.442] (-467.273) (-468.370) (-475.140) -- 0:00:53
185000 -- (-470.784) (-470.427) (-469.775) [-468.182] * (-469.528) [-468.026] (-468.104) (-467.664) -- 0:00:52
Average standard deviation of split frequencies: 0.014503
185500 -- (-469.742) (-468.411) (-471.444) [-469.620] * (-469.094) (-468.200) [-468.666] (-473.652) -- 0:00:52
186000 -- (-471.788) [-468.474] (-468.816) (-467.884) * (-467.490) (-472.586) [-471.958] (-468.047) -- 0:00:52
186500 -- (-469.774) (-469.833) [-469.224] (-467.736) * (-469.049) (-467.609) [-468.028] (-473.435) -- 0:00:52
187000 -- (-468.915) (-468.306) [-469.360] (-467.742) * (-468.050) [-470.744] (-467.746) (-468.474) -- 0:00:52
187500 -- (-468.545) (-470.879) (-470.638) [-471.372] * (-469.833) (-473.086) [-467.873] (-472.111) -- 0:00:52
188000 -- (-467.812) (-468.519) (-471.614) [-473.234] * [-472.569] (-470.391) (-468.627) (-468.722) -- 0:00:51
188500 -- (-467.876) (-470.428) (-470.350) [-467.524] * (-468.626) [-468.974] (-468.988) (-471.346) -- 0:00:51
189000 -- (-467.981) (-468.726) [-470.347] (-468.439) * (-468.966) (-472.011) (-469.533) [-467.535] -- 0:00:51
189500 -- (-467.740) (-471.676) (-468.312) [-468.732] * (-473.906) (-469.334) (-467.220) [-468.739] -- 0:00:51
190000 -- (-470.096) [-470.676] (-468.724) (-468.146) * [-468.422] (-474.319) (-467.270) (-467.771) -- 0:00:51
Average standard deviation of split frequencies: 0.014010
190500 -- (-471.898) (-470.350) (-469.124) [-467.598] * [-469.341] (-467.583) (-472.850) (-470.483) -- 0:00:50
191000 -- (-469.175) (-469.072) [-473.514] (-467.557) * (-472.705) (-469.400) (-468.056) [-468.872] -- 0:00:50
191500 -- [-468.390] (-471.975) (-467.415) (-468.649) * (-471.449) (-470.645) [-468.178] (-468.438) -- 0:00:50
192000 -- (-470.272) [-470.897] (-469.401) (-469.007) * (-473.745) (-471.256) [-470.730] (-468.056) -- 0:00:50
192500 -- (-470.647) [-471.231] (-470.166) (-472.094) * [-473.032] (-471.586) (-471.626) (-469.056) -- 0:00:50
193000 -- (-469.683) (-468.474) (-467.959) [-470.911] * (-469.917) (-473.014) [-469.268] (-471.380) -- 0:00:50
193500 -- (-468.973) (-470.058) (-471.666) [-468.873] * (-472.178) [-468.951] (-469.142) (-473.811) -- 0:00:50
194000 -- (-468.123) (-467.663) (-473.092) [-469.665] * (-470.386) (-468.559) [-471.108] (-470.992) -- 0:00:49
194500 -- (-467.597) [-469.256] (-467.717) (-475.381) * (-468.826) (-472.166) [-470.872] (-469.946) -- 0:00:49
195000 -- (-469.275) (-473.706) (-467.800) [-472.127] * (-472.655) [-469.428] (-470.001) (-470.573) -- 0:00:49
Average standard deviation of split frequencies: 0.014431
195500 -- (-468.608) (-471.414) (-469.602) [-467.591] * (-468.830) (-468.332) [-470.023] (-467.058) -- 0:00:53
196000 -- (-471.109) (-470.487) (-471.077) [-467.767] * (-469.637) [-470.253] (-469.023) (-468.396) -- 0:00:53
196500 -- (-473.238) (-473.888) [-470.548] (-467.768) * (-473.084) (-468.298) [-470.190] (-467.902) -- 0:00:53
197000 -- (-469.272) (-469.844) [-469.832] (-469.232) * (-468.600) [-469.134] (-467.464) (-468.944) -- 0:00:52
197500 -- (-470.531) [-468.017] (-468.336) (-468.868) * (-467.938) (-468.252) (-468.202) [-470.221] -- 0:00:52
198000 -- (-468.498) [-471.314] (-468.837) (-469.435) * (-467.513) (-470.774) [-471.250] (-472.803) -- 0:00:52
198500 -- (-469.055) [-468.798] (-468.831) (-468.085) * (-472.449) [-468.354] (-471.125) (-470.924) -- 0:00:52
199000 -- (-467.503) (-470.184) [-468.880] (-467.775) * (-472.822) (-470.213) (-468.889) [-467.570] -- 0:00:52
199500 -- (-468.466) [-471.179] (-468.425) (-470.063) * [-469.444] (-468.037) (-472.575) (-468.307) -- 0:00:52
200000 -- (-468.812) [-467.542] (-470.181) (-470.266) * (-469.463) [-467.868] (-472.886) (-475.530) -- 0:00:51
Average standard deviation of split frequencies: 0.014466
200500 -- (-469.938) [-469.722] (-470.393) (-470.220) * (-468.879) (-469.033) (-467.695) [-471.352] -- 0:00:51
201000 -- [-468.646] (-469.718) (-468.052) (-469.030) * (-468.679) [-468.855] (-468.908) (-469.421) -- 0:00:51
201500 -- (-469.083) [-467.849] (-468.790) (-469.374) * [-467.914] (-470.034) (-468.895) (-468.298) -- 0:00:51
202000 -- (-468.243) (-471.465) (-469.204) [-470.007] * (-468.862) (-471.735) (-473.140) [-468.520] -- 0:00:51
202500 -- (-468.928) (-469.487) [-468.850] (-477.797) * (-471.093) (-472.267) [-468.139] (-468.966) -- 0:00:51
203000 -- [-469.001] (-467.836) (-470.072) (-472.508) * [-470.571] (-470.085) (-470.299) (-473.152) -- 0:00:51
203500 -- (-468.769) (-470.722) [-469.091] (-470.988) * (-474.779) (-467.716) (-468.712) [-467.838] -- 0:00:50
204000 -- [-467.582] (-469.076) (-471.210) (-469.000) * (-473.301) [-473.130] (-468.628) (-469.822) -- 0:00:50
204500 -- (-469.959) (-468.640) [-469.299] (-471.645) * (-475.389) (-471.128) (-468.326) [-467.678] -- 0:00:50
205000 -- (-467.966) (-469.778) [-467.676] (-468.635) * (-471.447) (-467.548) [-470.245] (-471.975) -- 0:00:50
Average standard deviation of split frequencies: 0.014332
205500 -- (-470.556) [-467.521] (-468.069) (-467.282) * [-467.752] (-472.350) (-478.291) (-472.283) -- 0:00:50
206000 -- (-471.116) [-471.958] (-470.032) (-470.198) * (-469.064) (-468.262) [-475.293] (-474.166) -- 0:00:50
206500 -- (-469.439) [-468.875] (-467.351) (-472.353) * (-474.306) [-467.474] (-470.499) (-471.645) -- 0:00:49
207000 -- [-468.541] (-468.126) (-467.770) (-469.594) * (-474.934) (-468.103) (-472.404) [-468.917] -- 0:00:49
207500 -- (-468.356) [-468.173] (-469.430) (-468.055) * (-468.169) (-467.598) [-468.344] (-469.744) -- 0:00:49
208000 -- (-467.535) (-470.972) (-467.948) [-470.597] * (-470.728) (-469.277) (-469.395) [-468.444] -- 0:00:49
208500 -- (-469.040) [-469.254] (-473.061) (-471.196) * (-470.004) (-469.551) [-468.704] (-469.149) -- 0:00:49
209000 -- [-468.658] (-470.356) (-471.231) (-468.403) * [-467.392] (-470.315) (-469.074) (-469.648) -- 0:00:49
209500 -- (-469.869) (-468.975) (-468.802) [-469.550] * (-468.206) (-473.958) [-469.231] (-471.562) -- 0:00:49
210000 -- (-474.917) (-470.681) [-468.880] (-469.016) * (-469.762) (-470.750) (-470.263) [-467.780] -- 0:00:48
Average standard deviation of split frequencies: 0.012484
210500 -- [-468.150] (-468.027) (-469.952) (-467.950) * (-470.736) (-469.485) (-469.595) [-467.784] -- 0:00:48
211000 -- (-476.652) (-467.779) [-468.307] (-469.058) * (-472.001) (-469.907) (-469.288) [-467.995] -- 0:00:48
211500 -- (-473.337) (-469.103) [-470.520] (-474.510) * (-468.111) [-468.312] (-470.311) (-473.886) -- 0:00:48
212000 -- (-470.264) (-471.058) (-468.056) [-472.163] * (-471.766) [-470.067] (-468.324) (-473.660) -- 0:00:48
212500 -- (-468.065) (-471.256) [-468.565] (-471.635) * (-470.394) (-468.084) [-468.599] (-474.510) -- 0:00:51
213000 -- (-470.446) (-467.429) (-472.621) [-477.194] * [-468.518] (-468.408) (-471.220) (-477.578) -- 0:00:51
213500 -- (-472.241) (-467.390) [-470.724] (-469.279) * [-470.433] (-467.734) (-471.589) (-467.395) -- 0:00:51
214000 -- (-468.476) (-467.695) (-467.279) [-469.212] * (-470.659) (-470.047) [-470.464] (-471.451) -- 0:00:51
214500 -- (-468.805) (-468.177) (-466.996) [-468.876] * (-473.116) [-471.793] (-469.195) (-471.451) -- 0:00:51
215000 -- (-467.360) (-468.702) [-467.534] (-470.567) * [-467.839] (-471.081) (-468.453) (-470.729) -- 0:00:51
Average standard deviation of split frequencies: 0.011257
215500 -- (-471.718) (-468.534) (-468.200) [-468.126] * (-469.483) [-467.254] (-468.650) (-471.610) -- 0:00:50
216000 -- (-475.669) [-469.392] (-469.879) (-471.593) * [-468.979] (-469.236) (-469.239) (-468.137) -- 0:00:50
216500 -- [-470.709] (-472.201) (-470.634) (-466.999) * [-469.252] (-468.950) (-471.284) (-468.668) -- 0:00:50
217000 -- [-468.331] (-467.488) (-467.618) (-468.554) * (-470.924) (-471.908) (-474.954) [-468.570] -- 0:00:50
217500 -- (-473.366) [-468.646] (-468.442) (-468.549) * [-469.098] (-479.606) (-468.815) (-468.246) -- 0:00:50
218000 -- (-471.454) (-472.768) [-468.201] (-469.985) * [-469.062] (-472.125) (-471.243) (-468.390) -- 0:00:50
218500 -- (-469.646) (-468.595) (-469.486) [-468.997] * (-472.732) (-469.516) (-467.282) [-468.268] -- 0:00:50
219000 -- (-468.721) [-468.293] (-468.177) (-469.116) * (-473.015) (-469.195) (-468.421) [-468.522] -- 0:00:49
219500 -- (-471.073) [-472.451] (-470.383) (-471.538) * (-468.915) (-470.663) [-470.021] (-467.804) -- 0:00:49
220000 -- (-469.145) [-470.650] (-469.220) (-470.989) * (-471.216) [-467.681] (-468.990) (-468.506) -- 0:00:49
Average standard deviation of split frequencies: 0.012930
220500 -- [-467.714] (-467.687) (-468.508) (-471.727) * (-473.914) (-467.553) [-469.739] (-468.532) -- 0:00:49
221000 -- (-467.640) [-468.197] (-467.871) (-466.964) * (-469.548) (-469.902) (-468.355) [-469.373] -- 0:00:49
221500 -- (-467.516) (-469.185) (-469.396) [-467.978] * (-471.280) (-467.644) (-469.678) [-470.563] -- 0:00:49
222000 -- (-467.267) (-469.461) (-471.414) [-469.354] * (-468.216) (-468.339) [-470.834] (-472.447) -- 0:00:49
222500 -- (-470.762) (-468.864) [-467.445] (-470.559) * (-467.893) [-469.257] (-475.079) (-469.718) -- 0:00:48
223000 -- (-469.410) [-468.332] (-468.355) (-468.913) * (-472.452) (-471.243) (-467.634) [-470.285] -- 0:00:48
223500 -- [-469.011] (-470.083) (-468.511) (-470.606) * (-469.433) (-470.542) [-467.588] (-471.567) -- 0:00:48
224000 -- (-466.989) (-472.379) [-471.862] (-467.628) * (-469.908) (-469.477) [-469.294] (-469.196) -- 0:00:48
224500 -- (-468.235) (-474.125) [-470.999] (-475.046) * (-466.939) (-468.648) [-469.066] (-468.766) -- 0:00:48
225000 -- (-472.101) (-469.873) (-471.224) [-467.355] * (-472.904) [-469.992] (-469.820) (-469.545) -- 0:00:48
Average standard deviation of split frequencies: 0.013613
225500 -- [-469.181] (-471.074) (-471.086) (-467.615) * (-470.232) (-470.288) [-469.512] (-468.098) -- 0:00:48
226000 -- (-473.645) (-470.426) [-475.533] (-471.951) * (-471.457) (-471.008) [-471.037] (-468.622) -- 0:00:47
226500 -- [-472.238] (-470.149) (-470.566) (-466.935) * [-468.205] (-470.612) (-470.513) (-469.757) -- 0:00:47
227000 -- (-471.850) (-473.854) (-468.103) [-470.388] * (-467.938) (-471.056) (-473.760) [-471.151] -- 0:00:47
227500 -- (-467.263) [-468.128] (-470.419) (-469.778) * (-469.392) (-470.296) (-467.587) [-470.574] -- 0:00:47
228000 -- (-470.863) (-471.025) [-468.208] (-474.994) * (-468.579) (-471.755) [-470.036] (-469.018) -- 0:00:47
228500 -- (-468.915) (-468.962) (-468.969) [-471.191] * (-469.029) (-469.450) (-468.352) [-469.253] -- 0:00:47
229000 -- (-467.462) (-470.195) (-469.071) [-469.264] * (-467.888) (-468.362) (-470.323) [-470.380] -- 0:00:47
229500 -- [-468.727] (-471.679) (-471.148) (-471.501) * (-473.872) (-470.043) [-471.836] (-474.605) -- 0:00:50
230000 -- (-468.477) (-469.912) (-476.156) [-468.151] * (-470.485) (-470.281) (-471.841) [-472.034] -- 0:00:50
Average standard deviation of split frequencies: 0.012477
230500 -- [-468.726] (-467.939) (-467.071) (-467.635) * (-469.288) [-469.189] (-467.534) (-467.605) -- 0:00:50
231000 -- (-467.800) [-469.719] (-468.049) (-468.013) * (-473.501) [-467.582] (-468.195) (-470.687) -- 0:00:49
231500 -- (-468.279) (-469.620) (-469.337) [-470.653] * (-469.674) [-467.958] (-468.751) (-473.337) -- 0:00:49
232000 -- (-467.724) (-468.524) (-470.311) [-467.287] * (-467.538) (-467.588) (-468.149) [-469.347] -- 0:00:49
232500 -- [-470.072] (-472.342) (-472.750) (-468.685) * (-468.495) [-468.234] (-470.127) (-469.576) -- 0:00:49
233000 -- (-468.307) (-472.517) (-472.853) [-467.818] * (-471.626) [-468.151] (-467.766) (-471.462) -- 0:00:49
233500 -- (-467.885) (-469.648) [-467.774] (-469.769) * (-470.215) (-467.776) (-472.807) [-467.488] -- 0:00:49
234000 -- [-467.813] (-471.625) (-467.541) (-469.327) * [-471.334] (-468.026) (-471.900) (-468.201) -- 0:00:49
234500 -- (-469.657) (-470.078) [-468.946] (-468.127) * (-468.727) (-467.817) (-469.688) [-470.327] -- 0:00:48
235000 -- (-467.882) (-470.603) [-469.621] (-469.743) * (-469.368) [-468.610] (-470.078) (-470.074) -- 0:00:48
Average standard deviation of split frequencies: 0.012616
235500 -- (-467.352) (-468.745) [-470.802] (-469.857) * (-471.002) (-467.916) (-471.330) [-467.981] -- 0:00:48
236000 -- (-472.689) (-467.600) (-469.670) [-473.862] * (-467.996) (-469.913) [-471.056] (-469.037) -- 0:00:48
236500 -- (-470.858) (-467.806) (-467.874) [-469.081] * (-468.383) (-467.327) [-467.152] (-470.490) -- 0:00:48
237000 -- (-470.322) [-470.273] (-468.723) (-469.158) * (-469.186) (-469.572) (-467.879) [-468.261] -- 0:00:48
237500 -- [-468.675] (-470.477) (-467.896) (-468.748) * (-468.990) (-471.053) [-468.193] (-470.159) -- 0:00:48
238000 -- (-467.842) (-469.725) (-467.409) [-471.322] * (-467.736) (-471.162) [-468.011] (-468.309) -- 0:00:48
238500 -- (-468.965) (-471.865) [-468.987] (-469.193) * [-467.755] (-470.795) (-468.677) (-467.824) -- 0:00:47
239000 -- (-469.887) (-468.239) (-471.457) [-468.245] * (-469.391) (-469.140) [-468.261] (-467.439) -- 0:00:47
239500 -- (-469.082) (-468.480) (-470.707) [-469.000] * (-468.680) (-468.589) (-470.714) [-467.858] -- 0:00:47
240000 -- (-468.647) [-470.368] (-468.822) (-469.232) * (-472.647) (-468.939) (-468.611) [-468.213] -- 0:00:47
Average standard deviation of split frequencies: 0.014255
240500 -- (-470.955) (-469.142) [-467.723] (-469.822) * (-468.112) (-472.285) [-469.974] (-469.518) -- 0:00:47
241000 -- (-470.262) [-473.640] (-468.241) (-469.945) * (-467.027) (-469.365) (-468.755) [-469.283] -- 0:00:47
241500 -- (-469.507) (-471.797) (-468.130) [-468.449] * [-469.605] (-472.675) (-468.534) (-469.962) -- 0:00:47
242000 -- [-472.079] (-470.688) (-470.333) (-473.848) * (-468.549) (-472.973) (-470.413) [-468.079] -- 0:00:46
242500 -- (-474.036) (-468.446) [-469.455] (-467.564) * (-471.055) [-469.262] (-474.836) (-470.580) -- 0:00:46
243000 -- (-471.188) (-468.611) [-467.585] (-469.105) * (-470.792) (-474.306) [-467.562] (-470.820) -- 0:00:46
243500 -- (-468.713) [-467.591] (-468.023) (-467.242) * (-469.702) (-474.590) (-468.306) [-466.999] -- 0:00:46
244000 -- (-468.985) (-467.613) (-468.195) [-467.889] * (-468.603) (-471.510) [-468.613] (-467.246) -- 0:00:46
244500 -- (-468.119) (-470.732) [-467.935] (-467.284) * (-472.302) [-469.408] (-470.904) (-467.890) -- 0:00:46
245000 -- (-475.196) (-469.997) [-468.619] (-468.152) * (-469.646) (-470.146) [-468.891] (-468.861) -- 0:00:46
Average standard deviation of split frequencies: 0.014221
245500 -- (-467.733) [-467.463] (-468.584) (-467.044) * (-467.589) [-478.084] (-468.112) (-468.285) -- 0:00:46
246000 -- [-467.779] (-470.680) (-472.604) (-467.380) * (-469.184) (-468.350) (-469.118) [-470.617] -- 0:00:45
246500 -- (-473.974) [-467.742] (-468.099) (-467.632) * (-466.948) (-468.979) (-468.256) [-469.650] -- 0:00:48
247000 -- (-470.317) (-468.048) [-468.436] (-467.361) * [-468.513] (-471.915) (-469.762) (-473.700) -- 0:00:48
247500 -- (-474.253) (-469.387) [-467.957] (-471.842) * (-467.538) (-471.885) [-467.756] (-469.624) -- 0:00:48
248000 -- (-469.219) [-467.379] (-467.749) (-472.250) * (-468.198) [-467.940] (-468.514) (-467.691) -- 0:00:48
248500 -- (-468.709) [-472.692] (-470.620) (-467.902) * (-468.377) (-469.191) [-469.239] (-471.255) -- 0:00:48
249000 -- [-468.723] (-471.114) (-467.957) (-470.716) * (-467.591) (-475.704) [-467.322] (-471.345) -- 0:00:48
249500 -- [-468.208] (-467.635) (-467.718) (-469.644) * (-467.761) (-473.293) [-467.255] (-468.384) -- 0:00:48
250000 -- [-468.739] (-469.173) (-473.317) (-470.438) * (-467.691) (-469.721) [-467.797] (-467.900) -- 0:00:48
Average standard deviation of split frequencies: 0.013582
250500 -- (-472.003) (-467.473) (-469.089) [-471.113] * [-477.713] (-468.944) (-470.009) (-468.783) -- 0:00:47
251000 -- (-472.807) (-469.119) (-467.941) [-467.518] * (-469.700) (-468.103) [-469.523] (-468.697) -- 0:00:47
251500 -- (-468.344) [-471.272] (-470.502) (-471.168) * (-469.974) (-468.593) (-472.142) [-471.043] -- 0:00:47
252000 -- (-472.571) [-467.442] (-470.159) (-468.591) * (-470.018) [-468.507] (-470.124) (-468.986) -- 0:00:47
252500 -- [-470.471] (-468.207) (-468.733) (-469.839) * (-471.942) (-469.685) (-469.445) [-468.782] -- 0:00:47
253000 -- (-469.353) (-467.490) (-471.527) [-470.701] * (-468.743) (-468.244) (-468.927) [-468.472] -- 0:00:47
253500 -- (-468.464) (-468.147) [-468.765] (-468.086) * (-468.999) (-471.563) [-468.304] (-470.688) -- 0:00:47
254000 -- [-469.154] (-466.909) (-468.996) (-467.568) * (-470.387) (-470.279) [-469.235] (-470.804) -- 0:00:46
254500 -- [-468.876] (-467.802) (-470.005) (-467.442) * [-472.784] (-469.091) (-469.188) (-468.463) -- 0:00:46
255000 -- [-468.450] (-471.043) (-467.779) (-468.817) * (-472.281) [-471.775] (-469.987) (-470.916) -- 0:00:46
Average standard deviation of split frequencies: 0.013197
255500 -- [-467.970] (-469.386) (-470.492) (-468.771) * (-467.911) [-468.501] (-473.160) (-467.776) -- 0:00:46
256000 -- (-467.773) [-468.403] (-469.408) (-470.048) * (-470.595) [-468.200] (-471.289) (-470.516) -- 0:00:46
256500 -- (-467.727) (-470.735) (-469.960) [-469.933] * (-469.038) (-468.282) (-467.364) [-468.632] -- 0:00:46
257000 -- (-472.191) (-469.503) (-469.955) [-467.967] * [-467.328] (-471.570) (-468.333) (-470.451) -- 0:00:46
257500 -- (-471.328) [-468.218] (-469.003) (-470.132) * (-467.656) [-470.510] (-470.351) (-469.288) -- 0:00:46
258000 -- (-470.827) (-468.535) (-469.612) [-467.337] * (-470.938) (-468.763) [-468.591] (-472.587) -- 0:00:46
258500 -- (-468.800) (-467.514) (-476.908) [-467.558] * (-471.144) (-470.335) [-468.942] (-468.246) -- 0:00:45
259000 -- [-468.036] (-468.098) (-473.765) (-469.593) * (-468.939) (-471.580) [-470.163] (-469.989) -- 0:00:45
259500 -- [-468.345] (-469.160) (-471.200) (-468.445) * [-468.304] (-468.861) (-469.400) (-469.185) -- 0:00:45
260000 -- (-475.895) [-467.776] (-470.584) (-471.363) * (-468.554) [-468.800] (-470.479) (-471.510) -- 0:00:45
Average standard deviation of split frequencies: 0.013865
260500 -- [-470.596] (-467.881) (-467.547) (-468.381) * (-469.106) (-467.143) [-469.849] (-468.743) -- 0:00:45
261000 -- (-471.319) (-468.904) [-469.140] (-470.349) * (-467.133) (-470.264) [-468.919] (-467.852) -- 0:00:45
261500 -- (-470.097) (-469.302) (-470.744) [-469.856] * (-467.450) [-468.865] (-470.975) (-470.453) -- 0:00:45
262000 -- (-467.845) [-469.355] (-467.451) (-472.695) * (-467.504) (-467.180) [-469.947] (-468.686) -- 0:00:45
262500 -- (-475.572) (-471.771) (-469.956) [-468.495] * [-467.230] (-472.102) (-467.404) (-468.148) -- 0:00:44
263000 -- (-471.059) [-470.661] (-469.075) (-469.003) * [-469.868] (-470.764) (-468.685) (-468.207) -- 0:00:44
263500 -- (-467.703) [-468.000] (-470.223) (-470.915) * (-470.786) (-471.897) (-468.044) [-468.124] -- 0:00:44
264000 -- [-468.192] (-468.078) (-473.817) (-469.014) * (-470.595) [-468.244] (-467.408) (-468.993) -- 0:00:47
264500 -- (-469.487) (-467.858) [-467.880] (-469.490) * [-469.185] (-468.293) (-468.569) (-476.533) -- 0:00:47
265000 -- [-472.661] (-467.777) (-468.355) (-471.460) * (-468.066) (-473.481) (-471.306) [-472.077] -- 0:00:47
Average standard deviation of split frequencies: 0.013981
265500 -- (-472.749) [-468.925] (-471.652) (-468.666) * (-467.421) (-470.140) [-471.380] (-471.486) -- 0:00:47
266000 -- (-469.070) (-468.638) (-467.917) [-469.005] * (-468.226) (-470.351) [-473.758] (-470.976) -- 0:00:46
266500 -- (-467.584) [-469.078] (-470.863) (-467.794) * (-469.045) [-468.773] (-471.015) (-470.767) -- 0:00:46
267000 -- (-468.313) [-474.143] (-470.491) (-470.058) * (-473.449) (-468.598) (-471.318) [-468.031] -- 0:00:46
267500 -- (-468.220) (-469.434) (-469.430) [-467.601] * [-476.259] (-468.488) (-473.265) (-467.141) -- 0:00:46
268000 -- (-469.474) (-469.833) [-468.110] (-472.511) * (-471.806) [-467.634] (-470.069) (-469.909) -- 0:00:46
268500 -- (-472.178) (-469.966) [-470.001] (-469.792) * (-469.377) [-468.756] (-469.575) (-469.081) -- 0:00:46
269000 -- (-471.333) [-469.142] (-470.983) (-470.934) * (-474.449) [-468.189] (-472.274) (-477.932) -- 0:00:46
269500 -- (-471.343) (-468.942) [-470.489] (-469.551) * (-469.798) [-469.972] (-469.600) (-475.398) -- 0:00:46
270000 -- (-470.276) [-468.912] (-468.312) (-472.203) * (-471.818) (-469.854) [-468.537] (-470.068) -- 0:00:45
Average standard deviation of split frequencies: 0.012772
270500 -- [-468.823] (-469.217) (-468.183) (-468.395) * (-470.253) [-469.777] (-469.776) (-469.092) -- 0:00:45
271000 -- (-469.675) [-468.172] (-472.616) (-472.420) * (-470.698) [-469.567] (-468.935) (-468.107) -- 0:00:45
271500 -- (-474.126) [-468.493] (-467.635) (-469.197) * (-477.992) (-469.497) (-467.327) [-468.501] -- 0:00:45
272000 -- (-471.099) (-467.496) [-467.768] (-470.085) * (-470.161) (-469.345) (-467.313) [-471.249] -- 0:00:45
272500 -- (-472.960) (-467.409) (-470.294) [-469.437] * (-475.081) (-468.166) [-468.535] (-471.091) -- 0:00:45
273000 -- (-469.056) (-468.034) [-467.778] (-470.606) * (-472.078) (-470.117) (-472.559) [-468.253] -- 0:00:45
273500 -- (-470.049) (-469.921) [-472.680] (-468.822) * [-469.236] (-469.206) (-477.951) (-467.648) -- 0:00:45
274000 -- (-469.866) (-473.288) (-468.738) [-471.209] * (-468.099) [-469.052] (-470.718) (-470.970) -- 0:00:45
274500 -- (-469.102) (-469.734) [-468.206] (-469.093) * (-467.442) [-467.520] (-467.950) (-470.251) -- 0:00:44
275000 -- [-467.964] (-474.294) (-468.579) (-468.151) * (-467.948) [-468.927] (-469.139) (-469.913) -- 0:00:44
Average standard deviation of split frequencies: 0.012585
275500 -- (-468.622) [-469.217] (-468.767) (-469.911) * (-469.824) (-469.962) (-466.977) [-472.070] -- 0:00:44
276000 -- [-468.794] (-471.801) (-469.732) (-467.473) * (-467.947) (-469.694) [-468.066] (-470.345) -- 0:00:44
276500 -- (-470.546) [-469.222] (-470.739) (-467.722) * (-470.570) (-470.120) [-468.571] (-468.190) -- 0:00:44
277000 -- (-472.317) (-468.090) [-469.125] (-468.751) * [-473.484] (-467.584) (-469.254) (-468.738) -- 0:00:44
277500 -- [-469.987] (-470.006) (-472.387) (-467.393) * [-473.624] (-468.695) (-468.901) (-469.729) -- 0:00:44
278000 -- (-469.805) (-467.323) (-467.414) [-469.679] * (-477.486) (-469.730) [-467.948] (-473.456) -- 0:00:44
278500 -- (-468.283) (-467.850) [-467.181] (-474.314) * (-471.857) [-468.318] (-470.836) (-469.457) -- 0:00:44
279000 -- (-468.725) [-467.959] (-468.020) (-470.167) * [-467.877] (-467.811) (-469.948) (-471.330) -- 0:00:43
279500 -- (-469.094) (-469.288) [-468.309] (-468.520) * [-471.446] (-470.633) (-471.167) (-468.060) -- 0:00:43
280000 -- (-469.185) [-468.025] (-473.429) (-471.295) * [-468.742] (-468.684) (-468.698) (-469.698) -- 0:00:43
Average standard deviation of split frequencies: 0.013348
280500 -- (-472.426) (-468.120) [-468.131] (-472.028) * (-470.515) (-468.620) (-469.364) [-469.544] -- 0:00:46
281000 -- (-469.805) [-470.568] (-467.674) (-471.999) * (-467.261) (-470.219) (-468.485) [-467.338] -- 0:00:46
281500 -- (-468.776) [-471.920] (-469.708) (-469.564) * (-471.247) (-472.496) (-468.693) [-466.954] -- 0:00:45
282000 -- [-469.117] (-469.676) (-468.744) (-467.901) * (-471.012) (-471.447) (-475.052) [-468.254] -- 0:00:45
282500 -- (-470.768) (-471.075) (-470.839) [-468.348] * (-469.124) (-470.544) (-468.952) [-467.415] -- 0:00:45
283000 -- (-469.818) (-471.894) (-477.424) [-472.279] * (-470.277) (-470.992) [-468.292] (-468.573) -- 0:00:45
283500 -- (-469.620) [-470.550] (-470.548) (-470.951) * (-469.457) (-469.267) (-468.877) [-468.343] -- 0:00:45
284000 -- (-467.544) [-470.395] (-468.481) (-470.709) * (-469.564) (-470.727) (-469.680) [-471.588] -- 0:00:45
284500 -- (-468.898) [-469.780] (-468.850) (-468.163) * (-469.144) (-472.193) [-473.270] (-468.507) -- 0:00:45
285000 -- (-469.354) (-471.407) (-468.594) [-467.996] * (-468.462) [-466.929] (-476.019) (-468.051) -- 0:00:45
Average standard deviation of split frequencies: 0.014926
285500 -- [-467.835] (-468.852) (-474.327) (-470.465) * (-468.088) (-468.621) [-469.952] (-469.720) -- 0:00:45
286000 -- (-468.603) (-469.937) [-470.716] (-470.207) * (-470.633) (-470.769) [-471.516] (-471.700) -- 0:00:44
286500 -- (-470.448) (-469.102) [-468.568] (-471.254) * [-469.113] (-467.643) (-468.180) (-472.850) -- 0:00:44
287000 -- [-470.407] (-468.877) (-467.843) (-467.719) * (-468.229) (-469.048) (-469.863) [-470.076] -- 0:00:44
287500 -- [-469.675] (-468.236) (-467.706) (-468.269) * (-467.650) [-469.908] (-472.007) (-468.997) -- 0:00:44
288000 -- [-468.474] (-468.147) (-471.101) (-470.459) * [-468.331] (-470.514) (-469.995) (-472.722) -- 0:00:44
288500 -- [-469.626] (-470.480) (-470.654) (-467.153) * [-468.449] (-470.560) (-470.323) (-470.070) -- 0:00:44
289000 -- [-468.139] (-469.389) (-472.402) (-469.135) * (-468.436) (-467.921) [-468.972] (-469.385) -- 0:00:44
289500 -- [-469.683] (-468.937) (-469.473) (-467.739) * (-469.084) (-469.653) [-468.986] (-467.286) -- 0:00:44
290000 -- (-469.530) (-469.778) [-469.464] (-468.833) * (-468.996) (-468.014) (-468.484) [-467.194] -- 0:00:44
Average standard deviation of split frequencies: 0.015535
290500 -- [-473.183] (-469.921) (-467.434) (-468.661) * (-469.919) (-468.175) (-468.395) [-467.521] -- 0:00:43
291000 -- [-469.232] (-472.244) (-471.168) (-468.712) * (-470.865) [-467.496] (-467.388) (-469.554) -- 0:00:43
291500 -- (-471.078) (-472.090) (-468.328) [-470.899] * (-467.761) [-469.396] (-471.094) (-470.724) -- 0:00:43
292000 -- [-468.204] (-469.361) (-470.208) (-471.439) * [-468.754] (-470.883) (-470.387) (-467.860) -- 0:00:43
292500 -- (-468.853) (-468.725) (-469.864) [-471.139] * (-469.905) [-469.016] (-469.352) (-469.079) -- 0:00:43
293000 -- (-470.453) [-469.111] (-470.660) (-468.748) * (-468.080) (-468.386) (-470.671) [-468.094] -- 0:00:43
293500 -- (-469.994) (-468.833) [-471.770] (-467.354) * (-468.003) (-471.162) [-471.105] (-467.075) -- 0:00:43
294000 -- (-467.962) (-468.797) [-470.269] (-467.093) * (-468.143) [-468.336] (-477.326) (-468.867) -- 0:00:43
294500 -- [-468.364] (-467.200) (-475.510) (-467.794) * (-467.465) (-468.117) [-472.713] (-470.080) -- 0:00:43
295000 -- (-469.714) [-472.844] (-467.844) (-469.002) * [-467.189] (-467.476) (-467.503) (-469.316) -- 0:00:43
Average standard deviation of split frequencies: 0.014776
295500 -- (-475.866) (-467.886) [-467.545] (-469.858) * (-468.481) (-467.834) (-470.308) [-467.854] -- 0:00:42
296000 -- (-470.282) [-467.641] (-471.056) (-469.218) * [-467.559] (-469.082) (-468.144) (-469.020) -- 0:00:42
296500 -- [-468.866] (-468.619) (-468.350) (-468.504) * (-467.425) [-469.055] (-469.529) (-470.064) -- 0:00:42
297000 -- [-468.504] (-468.028) (-469.168) (-468.424) * (-468.037) [-469.381] (-468.129) (-472.327) -- 0:00:42
297500 -- [-469.861] (-468.707) (-473.170) (-468.639) * (-467.756) [-470.480] (-469.153) (-468.635) -- 0:00:44
298000 -- (-467.849) [-469.405] (-469.723) (-470.891) * (-472.820) (-468.415) (-468.496) [-468.415] -- 0:00:44
298500 -- [-467.577] (-467.772) (-470.186) (-468.782) * [-468.270] (-473.068) (-469.171) (-469.213) -- 0:00:44
299000 -- (-471.470) (-475.252) (-468.132) [-468.586] * (-468.340) [-469.496] (-471.172) (-470.512) -- 0:00:44
299500 -- (-471.235) (-477.006) (-469.650) [-469.354] * (-468.884) [-467.737] (-473.839) (-468.682) -- 0:00:44
300000 -- (-471.940) [-468.716] (-469.271) (-470.067) * (-470.871) (-469.527) [-468.907] (-469.117) -- 0:00:44
Average standard deviation of split frequencies: 0.015156
300500 -- (-471.030) [-471.028] (-470.819) (-469.157) * [-471.333] (-468.992) (-470.508) (-468.334) -- 0:00:44
301000 -- [-469.032] (-471.680) (-467.955) (-472.364) * (-470.191) (-469.629) [-470.485] (-467.759) -- 0:00:44
301500 -- [-467.773] (-472.953) (-467.428) (-473.484) * (-471.312) [-467.552] (-471.572) (-468.626) -- 0:00:44
302000 -- (-468.974) (-473.825) (-469.113) [-468.859] * (-469.996) [-467.317] (-469.363) (-470.792) -- 0:00:43
302500 -- (-471.392) (-470.822) [-470.716] (-467.210) * (-469.401) (-468.404) [-469.153] (-468.301) -- 0:00:43
303000 -- (-472.999) (-469.726) (-471.237) [-468.434] * (-469.766) [-468.252] (-472.065) (-470.228) -- 0:00:43
303500 -- (-469.634) (-468.285) [-468.937] (-470.047) * (-470.706) [-470.597] (-468.740) (-468.861) -- 0:00:43
304000 -- (-470.097) (-473.337) [-469.624] (-470.002) * (-467.860) (-472.959) [-468.826] (-469.566) -- 0:00:43
304500 -- (-468.482) [-470.816] (-467.857) (-468.600) * [-467.904] (-469.221) (-473.552) (-470.114) -- 0:00:43
305000 -- (-468.074) (-472.714) [-469.242] (-470.145) * (-471.252) [-469.242] (-469.239) (-471.723) -- 0:00:43
Average standard deviation of split frequencies: 0.014757
305500 -- (-470.325) (-475.489) [-467.954] (-473.166) * (-471.412) (-469.616) (-467.712) [-471.485] -- 0:00:43
306000 -- (-469.747) [-468.163] (-470.642) (-468.694) * (-474.273) (-470.945) [-468.106] (-469.652) -- 0:00:43
306500 -- (-472.062) (-470.762) [-468.802] (-469.379) * [-468.804] (-470.252) (-467.072) (-467.417) -- 0:00:42
307000 -- (-467.253) (-467.674) (-468.825) [-471.029] * (-469.432) (-470.470) [-467.182] (-468.130) -- 0:00:42
307500 -- [-468.526] (-468.360) (-470.170) (-471.336) * (-471.017) (-467.448) (-467.648) [-468.789] -- 0:00:42
308000 -- (-468.904) (-471.519) (-469.513) [-471.305] * (-468.884) (-469.116) [-467.233] (-474.825) -- 0:00:42
308500 -- (-473.184) (-468.527) [-470.850] (-468.760) * [-467.949] (-471.139) (-471.567) (-469.923) -- 0:00:42
309000 -- (-468.650) [-468.596] (-468.235) (-469.119) * (-468.831) (-468.205) (-468.854) [-469.526] -- 0:00:42
309500 -- (-469.374) (-468.075) (-468.273) [-469.066] * (-469.140) (-467.963) (-469.595) [-468.350] -- 0:00:42
310000 -- (-467.963) (-468.231) [-470.901] (-468.626) * (-474.217) [-469.516] (-471.661) (-470.688) -- 0:00:42
Average standard deviation of split frequencies: 0.014615
310500 -- [-469.484] (-471.505) (-469.167) (-469.673) * [-467.924] (-469.238) (-474.749) (-469.885) -- 0:00:42
311000 -- (-467.848) (-467.923) [-467.898] (-469.039) * (-469.888) [-468.173] (-469.673) (-469.673) -- 0:00:42
311500 -- [-468.481] (-469.551) (-469.099) (-474.525) * (-470.388) (-471.559) [-468.888] (-468.844) -- 0:00:41
312000 -- [-467.891] (-469.851) (-469.808) (-468.026) * (-468.038) [-467.427] (-468.423) (-470.451) -- 0:00:41
312500 -- (-470.328) [-469.760] (-467.608) (-467.981) * (-470.212) (-467.499) (-468.387) [-467.861] -- 0:00:41
313000 -- (-470.106) (-469.669) [-469.015] (-468.987) * (-468.828) [-468.788] (-468.173) (-471.085) -- 0:00:41
313500 -- (-467.778) (-468.947) [-468.712] (-469.106) * (-471.259) [-472.550] (-467.570) (-473.190) -- 0:00:41
314000 -- (-469.256) (-469.323) [-469.106] (-468.361) * (-468.251) (-471.548) [-468.807] (-469.109) -- 0:00:41
314500 -- [-470.227] (-470.288) (-473.865) (-470.305) * (-468.794) (-468.612) (-469.938) [-468.618] -- 0:00:43
315000 -- (-474.227) (-469.685) [-469.867] (-468.802) * (-471.476) (-468.338) (-474.626) [-468.715] -- 0:00:43
Average standard deviation of split frequencies: 0.014054
315500 -- (-471.618) (-469.341) (-469.616) [-469.403] * (-470.270) [-468.520] (-470.922) (-467.873) -- 0:00:43
316000 -- (-469.737) (-468.239) [-468.951] (-470.801) * (-473.514) (-468.620) (-472.648) [-467.880] -- 0:00:43
316500 -- (-468.129) (-471.865) (-468.735) [-472.044] * (-470.963) (-470.229) (-468.244) [-470.014] -- 0:00:43
317000 -- (-468.400) (-467.324) [-467.443] (-468.544) * (-469.552) [-467.491] (-469.503) (-468.188) -- 0:00:43
317500 -- (-469.897) (-470.397) (-470.048) [-470.861] * (-468.212) (-467.096) (-468.645) [-467.139] -- 0:00:42
318000 -- (-470.182) (-470.687) (-472.075) [-468.350] * [-468.784] (-467.953) (-468.220) (-468.128) -- 0:00:42
318500 -- (-469.726) [-467.632] (-467.360) (-469.545) * (-469.967) (-468.149) (-469.688) [-470.850] -- 0:00:42
319000 -- (-469.448) [-468.372] (-468.240) (-469.608) * (-471.471) (-468.468) (-468.720) [-467.442] -- 0:00:42
319500 -- (-470.256) (-468.277) (-470.994) [-468.084] * (-470.751) (-469.560) (-468.577) [-470.268] -- 0:00:42
320000 -- [-469.480] (-467.926) (-470.401) (-468.847) * (-470.004) [-468.207] (-471.058) (-470.806) -- 0:00:42
Average standard deviation of split frequencies: 0.014623
320500 -- (-469.324) [-470.954] (-470.981) (-471.697) * (-468.169) [-467.725] (-469.475) (-468.165) -- 0:00:42
321000 -- (-469.984) (-473.844) [-467.681] (-470.357) * (-470.769) (-467.156) [-467.644] (-471.809) -- 0:00:42
321500 -- [-468.701] (-470.411) (-467.585) (-468.255) * [-469.669] (-471.021) (-472.612) (-468.767) -- 0:00:42
322000 -- [-469.140] (-467.860) (-467.111) (-471.412) * (-469.303) [-469.552] (-469.876) (-467.667) -- 0:00:42
322500 -- [-467.178] (-469.630) (-468.017) (-468.612) * (-469.807) (-472.485) (-469.133) [-469.956] -- 0:00:42
323000 -- (-471.832) (-470.539) [-468.352] (-468.855) * (-468.067) [-469.250] (-471.484) (-469.543) -- 0:00:41
323500 -- (-473.024) (-467.424) (-468.477) [-467.876] * (-469.325) (-471.564) (-470.010) [-468.350] -- 0:00:41
324000 -- (-470.865) (-476.600) (-470.708) [-467.913] * [-470.420] (-467.442) (-473.197) (-470.186) -- 0:00:41
324500 -- (-469.813) (-470.455) (-469.308) [-471.531] * (-471.601) [-467.149] (-468.270) (-470.770) -- 0:00:41
325000 -- (-473.999) (-471.335) (-472.294) [-468.705] * [-469.700] (-468.510) (-473.328) (-471.120) -- 0:00:41
Average standard deviation of split frequencies: 0.015069
325500 -- (-469.757) (-473.767) (-470.620) [-468.136] * (-469.504) (-467.747) (-469.234) [-469.261] -- 0:00:41
326000 -- (-470.603) (-468.177) [-470.759] (-467.777) * (-470.690) (-467.934) [-468.492] (-468.999) -- 0:00:41
326500 -- [-468.962] (-468.961) (-474.381) (-468.357) * (-473.701) [-470.088] (-468.095) (-468.476) -- 0:00:41
327000 -- (-469.143) [-468.715] (-471.766) (-467.366) * (-471.256) (-468.475) (-468.631) [-467.487] -- 0:00:41
327500 -- (-469.083) (-467.418) [-470.306] (-468.443) * [-468.751] (-469.507) (-473.720) (-469.757) -- 0:00:41
328000 -- [-471.256] (-469.900) (-473.066) (-468.552) * (-468.714) (-468.957) (-467.844) [-471.359] -- 0:00:40
328500 -- (-467.271) [-469.794] (-471.218) (-467.315) * [-468.104] (-468.748) (-468.960) (-472.337) -- 0:00:40
329000 -- (-469.140) [-468.674] (-471.550) (-467.936) * (-467.514) (-468.095) [-468.134] (-468.386) -- 0:00:40
329500 -- (-472.743) (-468.299) (-475.070) [-468.622] * [-467.984] (-467.221) (-471.857) (-468.771) -- 0:00:40
330000 -- [-470.054] (-467.747) (-467.618) (-468.428) * (-470.505) [-469.278] (-468.399) (-468.169) -- 0:00:40
Average standard deviation of split frequencies: 0.015307
330500 -- [-468.416] (-471.582) (-472.566) (-470.889) * [-468.541] (-469.210) (-468.072) (-469.015) -- 0:00:40
331000 -- [-468.284] (-472.802) (-471.479) (-470.530) * (-469.154) (-470.075) (-471.643) [-469.240] -- 0:00:40
331500 -- [-466.942] (-474.718) (-469.595) (-469.451) * (-469.516) [-468.294] (-475.333) (-472.481) -- 0:00:40
332000 -- [-470.218] (-469.399) (-469.656) (-471.283) * [-471.409] (-468.237) (-472.431) (-469.059) -- 0:00:42
332500 -- (-469.764) (-467.538) [-468.441] (-469.329) * (-472.189) (-467.798) (-469.508) [-468.498] -- 0:00:42
333000 -- (-470.066) (-467.817) (-467.372) [-467.432] * (-468.453) (-468.354) [-468.975] (-467.828) -- 0:00:42
333500 -- (-469.679) [-469.875] (-471.826) (-471.579) * (-469.948) (-470.826) [-469.329] (-469.352) -- 0:00:41
334000 -- (-473.667) [-469.821] (-469.037) (-470.798) * (-467.848) [-469.469] (-470.008) (-469.054) -- 0:00:41
334500 -- (-473.601) [-472.532] (-468.199) (-469.079) * (-472.387) (-469.639) [-471.734] (-467.645) -- 0:00:41
335000 -- (-467.913) (-471.773) [-472.776] (-468.436) * (-467.198) [-468.786] (-468.642) (-469.059) -- 0:00:41
Average standard deviation of split frequencies: 0.015950
335500 -- [-468.967] (-467.578) (-469.995) (-469.980) * (-468.181) (-469.539) (-468.058) [-467.705] -- 0:00:41
336000 -- (-468.537) (-469.557) (-470.837) [-469.227] * [-473.908] (-469.960) (-470.988) (-468.572) -- 0:00:41
336500 -- (-468.904) (-476.558) [-468.642] (-469.025) * (-468.806) [-469.002] (-467.435) (-474.463) -- 0:00:41
337000 -- [-468.697] (-472.314) (-468.599) (-469.369) * [-469.097] (-470.524) (-469.139) (-469.276) -- 0:00:41
337500 -- (-468.957) [-470.686] (-468.049) (-469.273) * (-468.750) [-475.431] (-470.714) (-468.629) -- 0:00:41
338000 -- [-468.147] (-472.390) (-469.202) (-471.558) * [-469.587] (-474.830) (-468.188) (-467.725) -- 0:00:41
338500 -- [-468.080] (-467.897) (-469.483) (-468.320) * (-468.580) (-469.507) (-470.165) [-470.956] -- 0:00:41
339000 -- [-468.719] (-468.579) (-467.053) (-471.681) * (-469.997) [-467.110] (-473.373) (-468.626) -- 0:00:40
339500 -- [-467.174] (-469.947) (-472.324) (-470.647) * (-467.891) (-468.913) (-471.628) [-468.858] -- 0:00:40
340000 -- [-467.974] (-473.683) (-468.723) (-468.079) * [-467.801] (-467.971) (-474.501) (-468.203) -- 0:00:40
Average standard deviation of split frequencies: 0.015221
340500 -- (-468.520) (-475.096) (-469.111) [-474.850] * (-470.250) (-468.355) (-469.527) [-469.219] -- 0:00:40
341000 -- [-469.524] (-471.091) (-468.870) (-468.510) * (-469.847) (-468.008) [-467.622] (-467.820) -- 0:00:40
341500 -- (-472.649) (-468.996) [-468.697] (-469.053) * (-469.199) (-468.284) (-471.130) [-469.038] -- 0:00:40
342000 -- [-470.004] (-468.251) (-470.477) (-468.506) * [-468.148] (-470.131) (-472.436) (-469.166) -- 0:00:40
342500 -- (-470.915) [-470.911] (-468.549) (-468.434) * (-468.568) (-471.885) [-466.984] (-468.265) -- 0:00:40
343000 -- (-468.366) [-467.321] (-467.527) (-467.553) * (-471.187) [-470.388] (-467.749) (-469.426) -- 0:00:40
343500 -- (-470.416) [-469.926] (-470.049) (-468.958) * (-470.326) (-471.937) [-468.527] (-467.666) -- 0:00:40
344000 -- (-470.295) (-467.924) (-469.729) [-469.367] * (-467.924) (-468.651) [-469.354] (-468.714) -- 0:00:40
344500 -- [-468.492] (-468.057) (-469.086) (-469.373) * (-468.755) (-470.946) (-470.309) [-471.603] -- 0:00:39
345000 -- [-469.015] (-468.528) (-468.104) (-469.093) * (-469.537) (-469.955) [-475.135] (-468.084) -- 0:00:39
Average standard deviation of split frequencies: 0.014198
345500 -- (-470.478) (-468.693) [-469.409] (-470.798) * (-471.628) (-470.061) (-477.866) [-470.517] -- 0:00:39
346000 -- (-470.484) (-469.332) (-469.083) [-468.529] * (-470.769) (-470.808) [-470.438] (-469.806) -- 0:00:39
346500 -- (-471.729) [-469.172] (-469.238) (-469.371) * (-468.801) (-469.251) (-472.284) [-470.850] -- 0:00:39
347000 -- (-470.408) (-468.197) (-469.682) [-467.576] * [-467.946] (-471.156) (-473.638) (-470.511) -- 0:00:39
347500 -- (-468.749) (-468.760) [-469.177] (-469.931) * [-467.823] (-469.729) (-471.942) (-472.782) -- 0:00:39
348000 -- [-471.465] (-470.166) (-470.305) (-467.707) * (-469.543) (-469.475) (-468.903) [-471.430] -- 0:00:39
348500 -- [-472.466] (-470.256) (-469.059) (-470.967) * (-473.045) (-467.198) (-468.446) [-469.594] -- 0:00:39
349000 -- (-468.539) [-470.316] (-468.431) (-468.974) * (-468.506) [-469.675] (-471.232) (-468.311) -- 0:00:41
349500 -- [-467.849] (-469.701) (-467.127) (-468.221) * (-467.914) (-470.015) [-471.307] (-468.046) -- 0:00:40
350000 -- [-467.211] (-470.987) (-467.151) (-470.231) * [-467.555] (-467.099) (-467.623) (-468.218) -- 0:00:40
Average standard deviation of split frequencies: 0.015086
350500 -- [-468.481] (-474.317) (-467.642) (-472.450) * (-469.260) (-467.880) [-467.103] (-470.307) -- 0:00:40
351000 -- (-468.312) (-467.952) [-467.393] (-473.685) * (-471.019) (-470.443) [-469.906] (-468.165) -- 0:00:40
351500 -- [-467.468] (-467.464) (-471.003) (-471.974) * (-469.312) [-469.723] (-467.860) (-468.151) -- 0:00:40
352000 -- (-469.223) [-468.639] (-468.461) (-472.645) * (-471.862) (-468.546) (-469.982) [-469.964] -- 0:00:40
352500 -- [-469.038] (-468.564) (-467.707) (-470.002) * [-469.954] (-468.135) (-472.090) (-471.414) -- 0:00:40
353000 -- (-468.173) [-468.696] (-468.863) (-470.685) * (-469.167) (-469.579) (-469.809) [-469.019] -- 0:00:40
353500 -- (-470.431) (-469.354) (-467.480) [-469.145] * (-468.141) [-470.275] (-467.104) (-472.438) -- 0:00:40
354000 -- (-468.977) (-470.983) [-467.969] (-470.768) * (-468.343) (-469.218) (-469.099) [-471.543] -- 0:00:40
354500 -- [-467.946] (-467.527) (-468.388) (-472.374) * (-469.265) (-468.191) [-470.454] (-470.275) -- 0:00:40
355000 -- (-469.490) (-469.446) (-468.730) [-470.136] * (-467.981) [-468.071] (-472.903) (-467.344) -- 0:00:39
Average standard deviation of split frequencies: 0.016773
355500 -- (-469.145) (-468.305) (-468.633) [-467.485] * (-470.370) [-468.613] (-474.620) (-468.852) -- 0:00:39
356000 -- [-468.277] (-468.989) (-471.028) (-469.951) * (-468.188) (-469.544) (-471.884) [-469.573] -- 0:00:39
356500 -- (-469.164) (-470.503) (-468.970) [-468.649] * [-468.827] (-467.730) (-470.876) (-467.656) -- 0:00:39
357000 -- (-467.669) (-470.410) [-468.193] (-468.607) * [-467.875] (-472.813) (-468.760) (-473.707) -- 0:00:39
357500 -- (-472.370) (-470.415) (-469.617) [-468.849] * (-469.439) (-470.788) [-470.072] (-470.765) -- 0:00:39
358000 -- (-467.844) (-467.997) [-467.466] (-472.407) * (-471.284) [-471.623] (-467.305) (-469.114) -- 0:00:39
358500 -- (-468.491) (-467.963) (-468.072) [-468.736] * (-474.687) (-467.651) (-467.998) [-469.933] -- 0:00:39
359000 -- (-469.260) [-467.535] (-473.255) (-469.737) * (-469.941) [-467.774] (-468.758) (-470.336) -- 0:00:39
359500 -- (-471.016) [-467.300] (-472.024) (-472.892) * [-467.719] (-470.833) (-468.651) (-470.289) -- 0:00:39
360000 -- (-470.698) (-469.592) (-469.401) [-471.876] * (-468.094) [-469.838] (-469.203) (-468.802) -- 0:00:39
Average standard deviation of split frequencies: 0.016120
360500 -- (-468.545) (-468.277) (-468.476) [-468.284] * (-469.255) (-468.970) [-468.773] (-468.095) -- 0:00:39
361000 -- (-467.787) (-467.530) [-467.972] (-471.467) * (-471.995) (-470.536) (-470.524) [-469.894] -- 0:00:38
361500 -- [-470.347] (-467.901) (-467.919) (-472.835) * (-469.919) (-468.159) (-470.685) [-471.090] -- 0:00:38
362000 -- (-468.013) (-470.016) [-468.271] (-473.594) * (-470.888) [-469.120] (-468.707) (-469.017) -- 0:00:38
362500 -- (-468.040) (-467.768) [-467.006] (-468.791) * [-467.377] (-469.639) (-471.691) (-467.386) -- 0:00:38
363000 -- (-469.444) (-470.314) [-468.689] (-468.764) * (-467.803) (-467.826) [-467.162] (-467.580) -- 0:00:38
363500 -- (-473.841) (-469.230) [-469.899] (-468.438) * [-467.114] (-470.078) (-467.180) (-467.865) -- 0:00:38
364000 -- (-469.476) (-469.412) [-467.673] (-471.230) * (-469.436) [-468.659] (-470.717) (-467.413) -- 0:00:38
364500 -- (-467.598) (-469.709) (-474.148) [-473.954] * (-472.346) (-469.595) (-470.474) [-469.166] -- 0:00:38
365000 -- [-468.595] (-468.862) (-475.313) (-471.570) * (-468.385) (-472.583) [-467.708] (-467.803) -- 0:00:38
Average standard deviation of split frequencies: 0.017173
365500 -- (-469.527) (-467.644) (-470.671) [-471.479] * [-469.277] (-470.196) (-471.526) (-467.918) -- 0:00:38
366000 -- (-468.021) (-470.035) [-470.966] (-469.855) * (-468.384) (-473.207) (-469.051) [-469.756] -- 0:00:38
366500 -- (-469.666) (-469.414) (-470.428) [-468.403] * (-467.274) (-471.856) (-470.705) [-469.767] -- 0:00:39
367000 -- (-467.395) [-467.308] (-472.391) (-470.526) * [-467.300] (-469.208) (-468.659) (-471.450) -- 0:00:39
367500 -- (-469.369) [-467.230] (-473.354) (-468.975) * (-467.299) (-470.287) (-468.393) [-468.630] -- 0:00:39
368000 -- (-469.039) [-467.645] (-468.552) (-469.709) * (-469.783) [-468.110] (-468.349) (-467.061) -- 0:00:39
368500 -- (-474.509) (-468.483) [-467.818] (-469.977) * (-472.106) (-470.731) [-469.834] (-470.305) -- 0:00:39
369000 -- (-471.152) (-468.563) [-468.217] (-472.493) * (-473.103) (-470.735) [-474.053] (-468.437) -- 0:00:39
369500 -- [-469.155] (-468.342) (-470.177) (-470.451) * [-468.726] (-469.291) (-474.740) (-468.160) -- 0:00:39
370000 -- (-469.110) (-470.631) [-467.292] (-468.792) * (-471.189) (-467.901) [-470.951] (-473.183) -- 0:00:39
Average standard deviation of split frequencies: 0.017028
370500 -- (-470.621) [-470.107] (-470.078) (-467.772) * (-468.371) (-467.681) [-469.945] (-469.367) -- 0:00:39
371000 -- (-468.034) (-468.664) (-469.353) [-468.932] * [-467.300] (-469.630) (-467.406) (-468.804) -- 0:00:38
371500 -- (-467.938) [-469.839] (-470.371) (-470.149) * (-471.413) [-469.208] (-467.648) (-468.633) -- 0:00:38
372000 -- (-468.739) (-472.057) (-474.820) [-471.576] * [-469.732] (-470.597) (-468.625) (-469.910) -- 0:00:38
372500 -- [-472.423] (-468.277) (-472.921) (-470.082) * (-469.341) [-469.997] (-469.669) (-468.638) -- 0:00:38
373000 -- (-468.245) [-469.117] (-468.695) (-475.451) * (-469.188) (-470.262) (-468.559) [-469.229] -- 0:00:38
373500 -- (-469.226) [-469.852] (-469.087) (-467.626) * (-468.011) [-471.122] (-469.024) (-467.542) -- 0:00:38
374000 -- [-468.866] (-472.770) (-467.961) (-472.633) * (-468.186) (-469.851) [-471.412] (-469.113) -- 0:00:38
374500 -- (-471.923) [-470.745] (-469.206) (-477.685) * (-468.412) (-468.864) [-468.167] (-469.067) -- 0:00:38
375000 -- [-471.050] (-474.936) (-468.921) (-468.634) * (-469.359) (-469.841) [-468.158] (-468.246) -- 0:00:38
Average standard deviation of split frequencies: 0.016159
375500 -- [-467.301] (-467.432) (-468.145) (-469.210) * (-470.047) [-469.755] (-471.006) (-468.498) -- 0:00:38
376000 -- (-469.817) [-468.676] (-471.626) (-468.048) * (-473.992) [-469.798] (-469.089) (-468.725) -- 0:00:38
376500 -- (-468.148) (-471.295) [-470.367] (-468.327) * (-472.537) (-468.199) [-469.593] (-468.404) -- 0:00:38
377000 -- (-468.868) (-468.602) (-468.622) [-469.894] * [-469.537] (-469.251) (-469.649) (-470.213) -- 0:00:38
377500 -- (-470.167) (-469.521) (-469.989) [-470.064] * (-467.119) (-469.931) [-467.841] (-468.894) -- 0:00:37
378000 -- [-467.129] (-469.282) (-470.954) (-472.079) * (-467.650) [-470.281] (-468.837) (-468.056) -- 0:00:37
378500 -- (-467.196) (-469.547) [-469.542] (-469.343) * (-469.406) (-469.972) (-471.175) [-467.056] -- 0:00:37
379000 -- (-468.675) (-471.418) (-469.219) [-467.451] * [-468.975] (-469.162) (-470.824) (-467.058) -- 0:00:37
379500 -- (-468.800) (-469.271) (-467.646) [-467.761] * (-470.023) (-468.835) (-472.295) [-468.294] -- 0:00:37
380000 -- [-468.953] (-469.412) (-474.778) (-469.066) * (-470.901) [-467.266] (-470.356) (-468.152) -- 0:00:37
Average standard deviation of split frequencies: 0.016924
380500 -- (-468.821) (-468.506) (-474.737) [-470.329] * [-469.189] (-469.581) (-468.589) (-470.737) -- 0:00:37
381000 -- (-467.321) (-471.453) (-469.627) [-467.159] * [-469.426] (-469.661) (-470.589) (-469.626) -- 0:00:37
381500 -- (-468.129) (-469.443) (-473.950) [-467.148] * [-472.069] (-468.504) (-470.439) (-472.140) -- 0:00:37
382000 -- (-470.001) [-469.666] (-476.382) (-472.154) * (-470.393) (-470.353) [-469.536] (-471.785) -- 0:00:37
382500 -- (-469.996) [-470.260] (-470.866) (-470.333) * (-469.733) [-471.791] (-469.010) (-470.486) -- 0:00:37
383000 -- [-469.169] (-467.974) (-472.485) (-469.929) * (-469.051) [-473.899] (-471.788) (-467.815) -- 0:00:37
383500 -- (-472.440) [-471.573] (-469.470) (-467.792) * (-469.759) [-469.811] (-468.216) (-474.132) -- 0:00:38
384000 -- (-467.527) (-467.607) [-468.265] (-468.856) * (-468.487) [-469.747] (-467.563) (-471.238) -- 0:00:38
384500 -- (-472.059) (-469.887) [-469.674] (-472.304) * [-469.589] (-470.629) (-469.004) (-470.681) -- 0:00:38
385000 -- (-467.601) [-467.865] (-469.684) (-469.263) * [-469.527] (-469.400) (-467.705) (-469.369) -- 0:00:38
Average standard deviation of split frequencies: 0.016351
385500 -- (-469.724) [-469.122] (-467.950) (-467.024) * (-470.895) (-468.672) [-468.446] (-471.081) -- 0:00:38
386000 -- (-470.844) (-470.712) [-467.966] (-467.821) * (-468.299) (-471.781) (-468.618) [-468.600] -- 0:00:38
386500 -- [-468.805] (-473.732) (-468.097) (-468.502) * (-470.751) [-468.051] (-468.234) (-469.146) -- 0:00:38
387000 -- (-472.245) (-469.666) [-468.546] (-468.776) * (-468.448) (-469.910) (-470.491) [-467.973] -- 0:00:38
387500 -- (-471.447) (-469.453) [-469.527] (-469.693) * (-467.737) [-469.639] (-471.015) (-473.917) -- 0:00:37
388000 -- (-471.258) (-469.020) [-471.179] (-467.658) * (-468.347) (-467.782) [-472.067] (-471.300) -- 0:00:37
388500 -- (-471.856) (-474.425) [-468.002] (-470.127) * (-469.359) [-467.933] (-471.886) (-474.814) -- 0:00:37
389000 -- (-472.269) (-467.881) [-468.480] (-468.053) * (-468.422) [-472.217] (-469.369) (-468.467) -- 0:00:37
389500 -- (-472.087) (-467.416) (-470.636) [-469.059] * (-469.402) (-469.702) [-469.370] (-469.126) -- 0:00:37
390000 -- [-467.451] (-471.539) (-470.898) (-474.804) * (-468.604) (-467.172) (-468.599) [-467.891] -- 0:00:37
Average standard deviation of split frequencies: 0.015496
390500 -- [-468.074] (-472.180) (-470.474) (-467.563) * (-469.081) (-470.779) (-468.084) [-470.320] -- 0:00:37
391000 -- (-467.574) (-468.902) (-470.021) [-468.888] * [-467.368] (-468.679) (-468.120) (-469.088) -- 0:00:37
391500 -- [-468.932] (-468.720) (-468.302) (-469.279) * (-469.900) (-467.105) [-468.802] (-468.594) -- 0:00:37
392000 -- (-472.799) (-468.869) [-468.626] (-468.485) * (-467.876) (-472.348) [-472.132] (-470.828) -- 0:00:37
392500 -- [-468.128] (-468.879) (-468.082) (-470.711) * [-471.131] (-470.007) (-473.625) (-469.091) -- 0:00:37
393000 -- [-467.671] (-469.067) (-468.804) (-470.967) * (-468.374) [-468.282] (-468.507) (-468.667) -- 0:00:37
393500 -- (-467.660) (-470.652) [-468.866] (-467.461) * (-469.400) [-467.552] (-467.351) (-470.158) -- 0:00:36
394000 -- [-468.788] (-471.526) (-470.451) (-468.994) * (-471.389) (-467.513) [-468.034] (-468.915) -- 0:00:36
394500 -- [-471.172] (-467.777) (-468.701) (-467.929) * (-469.395) [-467.106] (-471.424) (-468.599) -- 0:00:36
395000 -- (-469.190) (-469.915) (-469.690) [-471.053] * (-468.215) (-471.841) (-473.214) [-471.434] -- 0:00:36
Average standard deviation of split frequencies: 0.014845
395500 -- [-468.822] (-468.958) (-472.960) (-469.590) * [-470.830] (-475.183) (-468.382) (-472.708) -- 0:00:36
396000 -- (-471.798) (-470.639) [-469.242] (-470.921) * (-467.996) (-471.293) [-470.144] (-468.308) -- 0:00:36
396500 -- (-471.802) (-468.752) [-469.481] (-471.125) * (-467.708) (-470.133) (-469.413) [-468.630] -- 0:00:36
397000 -- (-468.904) (-468.322) [-468.421] (-474.197) * (-471.989) (-468.236) [-472.067] (-474.929) -- 0:00:36
397500 -- (-469.362) [-467.614] (-467.703) (-468.229) * (-471.402) [-471.203] (-471.294) (-470.027) -- 0:00:36
398000 -- (-468.131) (-469.253) [-467.960] (-467.965) * [-471.614] (-468.158) (-471.749) (-469.963) -- 0:00:36
398500 -- (-470.656) [-470.975] (-473.477) (-468.469) * (-469.425) (-468.129) (-467.721) [-470.414] -- 0:00:36
399000 -- (-467.461) (-468.124) [-470.769] (-469.553) * (-471.958) [-471.160] (-469.428) (-469.812) -- 0:00:36
399500 -- (-472.173) [-471.287] (-469.283) (-470.148) * (-475.477) [-469.238] (-467.172) (-475.997) -- 0:00:36
400000 -- (-468.529) (-470.436) [-469.196] (-469.710) * [-471.331] (-469.240) (-470.169) (-471.431) -- 0:00:36
Average standard deviation of split frequencies: 0.015295
400500 -- (-471.016) (-469.879) (-468.582) [-469.231] * (-472.374) [-467.030] (-468.024) (-472.302) -- 0:00:37
401000 -- (-469.308) (-468.191) [-471.288] (-468.297) * [-469.678] (-467.163) (-468.984) (-467.691) -- 0:00:37
401500 -- (-470.733) [-467.162] (-471.230) (-468.182) * (-469.553) (-469.504) [-469.325] (-468.183) -- 0:00:37
402000 -- (-468.154) (-468.394) [-468.510] (-468.590) * (-475.161) (-469.248) [-469.717] (-471.346) -- 0:00:37
402500 -- (-469.904) (-469.122) (-470.144) [-470.661] * (-473.763) [-468.863] (-469.082) (-468.362) -- 0:00:37
403000 -- (-468.785) [-468.773] (-474.548) (-470.437) * (-471.292) (-470.059) [-468.270] (-468.140) -- 0:00:37
403500 -- (-471.980) [-469.793] (-469.670) (-473.357) * (-469.760) (-468.706) (-470.878) [-468.693] -- 0:00:36
404000 -- (-469.605) [-468.280] (-469.093) (-468.271) * [-467.548] (-470.582) (-470.757) (-477.123) -- 0:00:36
404500 -- (-469.247) [-468.780] (-468.111) (-468.245) * [-467.282] (-468.741) (-467.104) (-467.666) -- 0:00:36
405000 -- [-467.950] (-471.983) (-468.513) (-469.689) * (-470.689) (-471.424) (-468.356) [-467.362] -- 0:00:36
Average standard deviation of split frequencies: 0.014753
405500 -- [-467.981] (-469.641) (-470.875) (-470.573) * [-467.354] (-472.991) (-467.781) (-470.032) -- 0:00:36
406000 -- [-469.206] (-468.646) (-468.019) (-467.847) * (-468.095) [-471.301] (-468.791) (-471.538) -- 0:00:36
406500 -- (-468.471) (-468.762) (-468.809) [-469.521] * (-470.687) (-468.510) (-470.350) [-468.595] -- 0:00:36
407000 -- (-474.116) (-470.879) (-468.563) [-469.684] * (-470.245) (-468.376) [-470.171] (-469.157) -- 0:00:36
407500 -- [-469.267] (-471.322) (-468.792) (-467.967) * (-473.024) (-467.794) (-467.812) [-467.972] -- 0:00:36
408000 -- (-467.946) (-469.859) [-467.375] (-472.564) * [-468.101] (-470.350) (-468.871) (-467.768) -- 0:00:36
408500 -- (-472.016) (-467.872) [-470.911] (-467.989) * [-472.539] (-469.047) (-469.250) (-469.498) -- 0:00:36
409000 -- (-470.800) (-469.251) [-467.617] (-468.150) * [-470.709] (-474.394) (-471.643) (-469.523) -- 0:00:36
409500 -- (-470.464) (-468.158) (-470.910) [-468.683] * (-469.202) (-474.067) (-467.687) [-467.900] -- 0:00:36
410000 -- [-467.899] (-469.191) (-467.548) (-475.308) * [-467.237] (-469.187) (-470.104) (-470.543) -- 0:00:35
Average standard deviation of split frequencies: 0.015463
410500 -- (-467.612) (-470.009) (-469.285) [-468.808] * [-468.155] (-467.431) (-469.600) (-470.113) -- 0:00:35
411000 -- (-471.939) (-470.911) [-470.544] (-469.720) * (-467.373) [-467.624] (-467.677) (-470.823) -- 0:00:35
411500 -- [-467.998] (-470.140) (-469.067) (-471.098) * (-468.733) (-469.415) (-468.317) [-468.966] -- 0:00:35
412000 -- (-471.217) (-471.910) (-470.138) [-474.643] * (-468.744) (-471.596) (-467.438) [-470.067] -- 0:00:35
412500 -- (-467.501) (-467.996) (-475.974) [-473.173] * (-468.435) (-469.370) [-471.040] (-469.771) -- 0:00:35
413000 -- (-470.366) [-470.523] (-473.375) (-470.339) * (-467.834) [-471.166] (-469.936) (-470.110) -- 0:00:35
413500 -- (-470.537) (-469.410) [-474.446] (-474.078) * (-476.062) (-467.315) (-467.536) [-472.844] -- 0:00:35
414000 -- (-467.494) (-470.978) [-470.927] (-468.429) * (-468.574) [-469.885] (-469.432) (-469.851) -- 0:00:35
414500 -- (-469.198) [-469.432] (-469.002) (-468.649) * [-473.186] (-470.570) (-475.494) (-469.580) -- 0:00:35
415000 -- (-467.598) (-474.225) [-468.058] (-467.145) * (-472.521) [-469.399] (-472.836) (-468.962) -- 0:00:35
Average standard deviation of split frequencies: 0.015131
415500 -- [-469.885] (-467.351) (-468.988) (-469.694) * (-470.120) [-469.281] (-470.377) (-472.320) -- 0:00:35
416000 -- [-469.828] (-467.302) (-470.049) (-470.894) * [-470.176] (-467.922) (-471.511) (-472.515) -- 0:00:35
416500 -- (-472.157) (-471.107) [-468.356] (-470.099) * [-468.696] (-467.087) (-468.222) (-469.200) -- 0:00:35
417000 -- (-469.463) (-469.444) (-470.077) [-468.344] * [-467.543] (-468.996) (-468.223) (-472.241) -- 0:00:34
417500 -- (-469.251) (-470.112) (-468.664) [-467.940] * (-468.448) [-468.683] (-468.265) (-468.047) -- 0:00:36
418000 -- [-467.535] (-468.437) (-470.848) (-469.130) * (-471.766) (-469.337) (-469.384) [-467.612] -- 0:00:36
418500 -- [-468.014] (-468.998) (-470.479) (-468.686) * (-467.887) (-467.583) (-469.948) [-470.951] -- 0:00:36
419000 -- (-472.789) [-468.278] (-470.464) (-467.622) * (-468.388) (-470.939) (-468.700) [-467.895] -- 0:00:36
419500 -- (-473.108) [-469.863] (-468.576) (-468.489) * (-468.805) (-469.540) [-467.636] (-472.305) -- 0:00:35
420000 -- (-475.507) (-468.948) [-467.965] (-475.893) * [-470.181] (-467.940) (-469.613) (-469.933) -- 0:00:35
Average standard deviation of split frequencies: 0.014238
420500 -- [-468.146] (-468.896) (-474.508) (-470.446) * (-468.174) [-469.540] (-468.482) (-469.244) -- 0:00:35
421000 -- (-469.749) [-475.077] (-472.272) (-469.023) * (-470.546) [-468.033] (-470.374) (-470.289) -- 0:00:35
421500 -- (-468.501) (-467.372) (-470.517) [-469.900] * (-468.382) (-470.826) (-470.293) [-470.431] -- 0:00:35
422000 -- [-468.775] (-468.974) (-470.779) (-468.838) * (-471.797) (-469.323) [-470.393] (-469.056) -- 0:00:35
422500 -- (-473.794) (-470.104) (-469.828) [-468.119] * (-468.800) (-472.933) [-470.878] (-471.438) -- 0:00:35
423000 -- (-469.072) (-468.591) (-467.706) [-469.084] * (-468.511) (-469.071) (-468.799) [-468.442] -- 0:00:35
423500 -- (-469.920) (-471.876) (-467.641) [-469.358] * [-471.255] (-469.270) (-468.568) (-468.939) -- 0:00:35
424000 -- (-467.646) (-471.296) [-467.794] (-469.369) * [-468.518] (-469.203) (-468.972) (-470.343) -- 0:00:35
424500 -- [-469.428] (-469.398) (-470.497) (-468.080) * (-467.886) (-470.870) (-470.260) [-469.612] -- 0:00:35
425000 -- [-468.545] (-471.942) (-469.589) (-473.927) * [-467.622] (-477.529) (-471.182) (-472.271) -- 0:00:35
Average standard deviation of split frequencies: 0.013930
425500 -- [-467.400] (-469.656) (-468.194) (-473.999) * (-468.364) (-470.486) [-470.773] (-470.183) -- 0:00:35
426000 -- (-470.117) [-469.554] (-469.135) (-470.542) * [-467.486] (-474.048) (-467.810) (-469.355) -- 0:00:35
426500 -- (-468.065) (-470.574) [-468.628] (-474.265) * [-467.728] (-472.194) (-472.031) (-468.157) -- 0:00:34
427000 -- (-468.980) [-470.177] (-469.271) (-470.218) * [-468.525] (-471.261) (-473.004) (-470.294) -- 0:00:34
427500 -- [-468.116] (-471.543) (-468.352) (-468.569) * (-468.302) [-471.295] (-469.986) (-469.606) -- 0:00:34
428000 -- (-471.152) [-469.485] (-468.011) (-468.312) * (-471.131) (-470.190) (-471.853) [-467.927] -- 0:00:34
428500 -- (-469.128) [-468.440] (-471.586) (-468.656) * (-469.561) [-470.244] (-467.534) (-468.575) -- 0:00:34
429000 -- (-474.835) (-469.876) [-472.305] (-470.527) * (-467.868) [-470.078] (-467.366) (-471.527) -- 0:00:34
429500 -- (-469.666) [-467.587] (-467.930) (-471.558) * (-468.595) (-468.293) (-469.839) [-474.277] -- 0:00:34
430000 -- (-473.337) [-468.205] (-467.035) (-470.960) * (-467.851) (-468.156) (-470.311) [-467.820] -- 0:00:34
Average standard deviation of split frequencies: 0.013908
430500 -- (-468.152) (-469.441) (-468.290) [-469.869] * (-468.469) (-470.371) (-467.688) [-467.776] -- 0:00:34
431000 -- (-468.431) (-468.882) [-470.775] (-470.655) * (-470.174) [-470.382] (-468.671) (-470.675) -- 0:00:34
431500 -- [-468.349] (-470.554) (-471.454) (-470.650) * (-468.652) (-469.623) (-469.394) [-469.305] -- 0:00:34
432000 -- [-470.617] (-468.642) (-470.252) (-468.992) * (-470.066) (-469.063) (-469.504) [-468.677] -- 0:00:34
432500 -- (-471.113) (-468.964) [-468.148] (-468.345) * (-471.800) (-469.141) [-467.087] (-470.892) -- 0:00:34
433000 -- (-468.687) (-468.739) [-469.708] (-469.714) * (-468.243) (-473.130) (-470.855) [-468.986] -- 0:00:34
433500 -- [-469.224] (-469.888) (-468.017) (-469.735) * (-469.959) (-468.991) [-471.345] (-470.392) -- 0:00:33
434000 -- (-471.296) (-471.067) (-470.073) [-468.002] * (-468.091) (-472.304) [-468.467] (-470.567) -- 0:00:33
434500 -- (-469.962) (-475.907) (-468.616) [-471.226] * (-468.804) (-468.616) (-470.643) [-470.718] -- 0:00:35
435000 -- (-470.376) (-467.330) [-467.569] (-468.858) * [-470.731] (-469.683) (-469.263) (-473.589) -- 0:00:35
Average standard deviation of split frequencies: 0.012974
435500 -- (-471.339) [-467.684] (-471.532) (-470.972) * [-468.064] (-467.509) (-474.007) (-472.064) -- 0:00:34
436000 -- (-469.960) [-470.580] (-468.013) (-468.688) * (-469.036) (-467.868) (-469.356) [-469.142] -- 0:00:34
436500 -- [-469.531] (-469.171) (-469.274) (-469.086) * (-469.237) [-467.957] (-467.812) (-470.922) -- 0:00:34
437000 -- (-473.916) (-467.489) (-468.500) [-467.985] * (-468.899) (-467.892) [-470.797] (-468.947) -- 0:00:34
437500 -- (-470.526) (-469.789) [-469.796] (-468.716) * (-468.188) [-470.162] (-469.250) (-473.736) -- 0:00:34
438000 -- (-470.143) (-471.904) (-477.270) [-468.719] * (-470.419) [-467.986] (-471.659) (-474.397) -- 0:00:34
438500 -- (-469.793) [-468.827] (-472.967) (-469.576) * (-471.416) (-472.370) (-468.787) [-467.795] -- 0:00:34
439000 -- (-468.639) (-469.656) (-468.040) [-469.402] * (-468.170) [-473.659] (-470.043) (-468.285) -- 0:00:34
439500 -- (-468.449) (-470.521) [-469.128] (-472.829) * (-467.915) (-476.507) [-470.649] (-467.020) -- 0:00:34
440000 -- (-468.347) [-467.940] (-473.051) (-469.649) * [-471.713] (-469.943) (-467.209) (-468.316) -- 0:00:34
Average standard deviation of split frequencies: 0.013215
440500 -- [-467.403] (-467.813) (-469.028) (-473.977) * (-468.802) (-470.919) (-467.183) [-468.144] -- 0:00:34
441000 -- (-470.227) (-467.643) (-467.392) [-468.194] * (-469.302) [-467.558] (-470.752) (-470.773) -- 0:00:34
441500 -- (-468.380) [-467.870] (-468.566) (-468.292) * (-472.178) (-470.010) [-469.322] (-468.145) -- 0:00:34
442000 -- [-467.358] (-473.693) (-472.989) (-467.365) * (-467.338) [-468.240] (-471.701) (-471.268) -- 0:00:34
442500 -- (-467.346) (-471.563) (-471.532) [-470.176] * [-469.475] (-471.066) (-468.514) (-467.597) -- 0:00:34
443000 -- (-468.010) (-470.986) (-471.475) [-471.019] * (-468.468) [-469.511] (-467.800) (-469.952) -- 0:00:33
443500 -- [-467.832] (-467.932) (-469.044) (-477.302) * [-470.394] (-468.134) (-467.230) (-470.556) -- 0:00:33
444000 -- [-468.791] (-469.491) (-468.999) (-471.576) * [-469.221] (-470.680) (-470.893) (-474.500) -- 0:00:33
444500 -- [-473.577] (-468.137) (-470.588) (-468.520) * [-467.961] (-469.470) (-469.003) (-469.000) -- 0:00:33
445000 -- [-472.037] (-469.546) (-471.301) (-468.283) * (-468.500) (-470.893) [-468.897] (-468.981) -- 0:00:33
Average standard deviation of split frequencies: 0.013367
445500 -- (-468.830) (-468.111) (-470.759) [-467.369] * [-469.950] (-469.678) (-469.372) (-471.312) -- 0:00:33
446000 -- (-468.467) [-468.223] (-472.799) (-470.657) * [-467.654] (-470.957) (-470.119) (-467.646) -- 0:00:33
446500 -- (-467.907) (-468.284) [-468.834] (-470.359) * (-471.793) [-469.270] (-468.373) (-471.605) -- 0:00:33
447000 -- (-467.130) (-476.818) (-471.044) [-470.287] * (-471.262) [-468.614] (-469.845) (-469.559) -- 0:00:33
447500 -- (-468.214) (-473.028) [-468.299] (-468.775) * (-470.410) (-469.281) (-479.962) [-471.521] -- 0:00:33
448000 -- (-468.752) [-469.310] (-473.654) (-469.688) * (-470.760) [-468.057] (-472.326) (-468.791) -- 0:00:33
448500 -- (-468.661) (-469.375) [-468.690] (-468.260) * (-471.859) (-467.384) (-470.234) [-467.859] -- 0:00:33
449000 -- (-468.693) (-471.376) [-468.889] (-468.712) * (-470.769) [-469.342] (-469.868) (-469.069) -- 0:00:33
449500 -- (-471.368) (-468.527) (-469.758) [-468.995] * (-471.155) (-470.935) [-468.688] (-468.537) -- 0:00:33
450000 -- (-469.746) (-477.837) [-470.470] (-468.087) * (-471.337) (-467.570) (-469.773) [-469.010] -- 0:00:33
Average standard deviation of split frequencies: 0.013967
450500 -- (-468.158) [-469.828] (-469.651) (-468.353) * [-467.778] (-469.098) (-467.986) (-469.294) -- 0:00:32
451000 -- (-471.566) (-468.247) [-468.348] (-467.692) * (-470.040) (-468.074) (-467.896) [-470.822] -- 0:00:32
451500 -- (-468.658) (-468.995) [-471.484] (-468.610) * (-469.717) (-471.270) [-467.974] (-468.699) -- 0:00:34
452000 -- (-468.840) [-468.141] (-472.536) (-467.504) * (-468.312) (-473.984) (-468.062) [-469.085] -- 0:00:33
452500 -- (-469.107) (-470.532) [-470.142] (-471.118) * (-472.020) (-467.874) (-468.585) [-469.308] -- 0:00:33
453000 -- (-471.746) (-471.166) (-470.087) [-468.840] * [-469.169] (-469.884) (-468.554) (-469.200) -- 0:00:33
453500 -- (-471.514) (-471.457) (-468.757) [-472.312] * (-467.955) (-471.924) (-471.542) [-468.778] -- 0:00:33
454000 -- [-469.534] (-468.479) (-468.676) (-468.807) * (-467.805) (-468.033) (-470.602) [-468.771] -- 0:00:33
454500 -- (-468.139) (-469.077) (-467.630) [-471.082] * [-470.803] (-468.141) (-468.634) (-472.232) -- 0:00:33
455000 -- (-469.704) [-468.124] (-474.690) (-469.284) * [-467.605] (-469.170) (-468.804) (-467.493) -- 0:00:33
Average standard deviation of split frequencies: 0.013568
455500 -- (-472.002) (-468.082) [-468.579] (-469.875) * [-468.433] (-469.518) (-467.456) (-468.892) -- 0:00:33
456000 -- (-471.275) (-469.038) [-467.831] (-468.947) * (-468.708) (-469.692) [-468.131] (-470.058) -- 0:00:33
456500 -- (-470.498) (-467.829) (-469.890) [-468.501] * (-468.015) (-469.303) [-468.194] (-469.029) -- 0:00:33
457000 -- (-468.992) [-468.312] (-469.537) (-468.780) * [-467.384] (-469.112) (-473.823) (-469.286) -- 0:00:33
457500 -- (-467.833) (-469.514) [-468.736] (-472.629) * (-469.904) [-471.376] (-469.635) (-467.537) -- 0:00:33
458000 -- (-470.930) [-468.706] (-471.109) (-477.406) * (-467.590) [-468.400] (-476.394) (-467.537) -- 0:00:33
458500 -- [-471.633] (-468.581) (-469.433) (-481.394) * (-467.303) (-469.227) [-470.870] (-468.920) -- 0:00:33
459000 -- (-469.458) (-467.678) [-469.827] (-467.413) * [-467.843] (-472.751) (-467.410) (-469.869) -- 0:00:33
459500 -- (-468.961) (-468.650) (-467.629) [-467.548] * (-471.247) (-470.430) (-468.036) [-468.478] -- 0:00:32
460000 -- (-468.163) (-470.058) [-467.119] (-468.556) * (-469.097) (-469.205) [-471.373] (-469.265) -- 0:00:32
Average standard deviation of split frequencies: 0.013879
460500 -- (-467.922) (-472.650) [-467.602] (-472.983) * (-468.428) [-470.039] (-470.240) (-471.694) -- 0:00:32
461000 -- (-469.807) (-470.816) (-469.637) [-469.571] * [-468.174] (-468.628) (-468.815) (-468.934) -- 0:00:32
461500 -- (-467.802) [-470.530] (-472.042) (-469.566) * (-469.209) (-469.360) [-469.244] (-471.376) -- 0:00:32
462000 -- [-468.208] (-468.299) (-470.238) (-469.059) * (-468.919) (-469.509) (-470.603) [-471.187] -- 0:00:32
462500 -- (-470.699) [-467.328] (-473.802) (-467.800) * [-468.934] (-471.419) (-467.695) (-469.201) -- 0:00:32
463000 -- (-469.001) (-466.840) [-467.569] (-469.782) * (-468.757) [-467.801] (-470.103) (-471.290) -- 0:00:32
463500 -- (-469.695) (-471.535) [-470.743] (-471.192) * (-468.748) (-468.538) [-468.069] (-468.483) -- 0:00:32
464000 -- (-470.636) (-467.493) (-468.341) [-470.347] * (-467.961) (-470.317) [-467.848] (-469.582) -- 0:00:32
464500 -- (-469.264) (-473.703) [-468.618] (-470.055) * (-470.248) (-469.553) [-468.189] (-473.985) -- 0:00:32
465000 -- (-469.199) [-468.702] (-468.050) (-471.059) * (-467.424) (-468.557) (-473.935) [-467.561] -- 0:00:32
Average standard deviation of split frequencies: 0.013210
465500 -- (-468.633) [-468.709] (-472.686) (-468.940) * (-470.013) [-470.101] (-467.683) (-469.307) -- 0:00:32
466000 -- [-469.833] (-471.315) (-474.111) (-469.407) * (-468.846) (-467.931) (-468.900) [-468.991] -- 0:00:32
466500 -- [-469.319] (-472.086) (-468.307) (-468.330) * (-469.545) (-470.139) [-468.386] (-469.243) -- 0:00:32
467000 -- (-472.336) (-468.919) [-469.180] (-470.711) * (-473.657) [-469.929] (-468.956) (-470.554) -- 0:00:31
467500 -- (-469.213) (-468.173) (-470.897) [-468.303] * (-473.156) (-470.806) [-470.136] (-468.930) -- 0:00:31
468000 -- (-468.683) (-468.456) (-468.236) [-470.203] * (-467.370) [-475.777] (-470.780) (-472.854) -- 0:00:31
468500 -- (-469.965) (-468.572) [-468.492] (-467.088) * (-467.520) [-471.139] (-468.632) (-469.803) -- 0:00:32
469000 -- [-469.138] (-468.310) (-468.085) (-467.497) * [-467.665] (-469.116) (-467.928) (-469.126) -- 0:00:32
469500 -- (-471.878) (-472.896) [-469.477] (-467.445) * (-469.373) [-468.468] (-467.658) (-467.562) -- 0:00:32
470000 -- (-469.023) (-469.755) (-472.221) [-467.923] * (-468.491) (-470.485) (-469.120) [-469.986] -- 0:00:32
Average standard deviation of split frequencies: 0.013138
470500 -- [-467.768] (-469.781) (-474.911) (-468.986) * (-471.860) (-468.695) (-470.172) [-470.647] -- 0:00:32
471000 -- (-468.186) [-468.609] (-470.179) (-470.830) * (-468.087) [-467.922] (-471.608) (-468.647) -- 0:00:32
471500 -- [-468.235] (-471.808) (-467.549) (-468.425) * [-468.123] (-469.913) (-469.540) (-469.949) -- 0:00:32
472000 -- (-471.346) (-467.669) (-468.431) [-467.582] * (-468.173) [-467.183] (-470.864) (-468.125) -- 0:00:32
472500 -- (-470.992) (-469.919) [-468.475] (-470.665) * [-468.134] (-467.041) (-470.176) (-471.043) -- 0:00:32
473000 -- [-471.473] (-470.579) (-472.220) (-468.429) * [-469.478] (-469.072) (-470.845) (-470.034) -- 0:00:32
473500 -- (-470.921) (-468.766) (-467.535) [-468.825] * [-467.673] (-469.612) (-468.249) (-469.295) -- 0:00:32
474000 -- [-468.407] (-468.697) (-468.830) (-469.154) * [-470.425] (-467.129) (-469.382) (-468.378) -- 0:00:32
474500 -- (-469.715) (-470.166) (-470.214) [-467.917] * (-469.465) (-468.705) [-467.622] (-472.255) -- 0:00:32
475000 -- (-469.637) (-468.613) (-470.679) [-468.669] * [-468.968] (-474.443) (-469.371) (-468.416) -- 0:00:32
Average standard deviation of split frequencies: 0.012751
475500 -- (-468.640) (-467.894) (-470.494) [-470.211] * [-470.411] (-473.302) (-468.127) (-469.523) -- 0:00:31
476000 -- (-467.885) (-470.709) [-469.638] (-471.197) * (-469.239) (-467.857) [-468.150] (-468.314) -- 0:00:31
476500 -- (-468.361) (-468.375) [-467.845] (-469.600) * (-468.096) (-471.092) [-470.696] (-467.970) -- 0:00:31
477000 -- [-468.203] (-471.230) (-467.974) (-468.790) * [-467.991] (-469.033) (-467.936) (-468.018) -- 0:00:31
477500 -- (-468.625) [-469.178] (-468.566) (-468.000) * (-469.490) (-467.932) [-468.437] (-467.979) -- 0:00:31
478000 -- (-470.822) [-468.765] (-467.946) (-468.577) * (-468.378) [-469.084] (-469.764) (-475.000) -- 0:00:31
478500 -- (-468.399) [-469.488] (-468.329) (-471.226) * (-469.688) (-468.215) (-469.230) [-468.080] -- 0:00:31
479000 -- [-470.771] (-467.564) (-471.273) (-468.339) * [-470.201] (-469.750) (-470.011) (-472.789) -- 0:00:31
479500 -- (-467.650) (-468.348) [-470.520] (-468.971) * (-469.524) (-470.082) (-475.208) [-469.203] -- 0:00:31
480000 -- [-467.638] (-469.107) (-469.663) (-471.343) * (-470.177) [-470.860] (-471.357) (-467.607) -- 0:00:31
Average standard deviation of split frequencies: 0.012566
480500 -- (-473.648) (-469.027) [-468.893] (-468.658) * (-470.122) (-469.468) [-467.639] (-470.039) -- 0:00:31
481000 -- (-469.542) (-469.042) [-467.567] (-468.485) * [-466.967] (-469.488) (-467.546) (-470.708) -- 0:00:31
481500 -- (-470.010) [-471.143] (-468.516) (-472.532) * (-470.511) (-469.756) [-469.437] (-469.068) -- 0:00:31
482000 -- [-469.324] (-472.199) (-468.089) (-472.873) * (-475.101) (-468.427) (-469.543) [-468.929] -- 0:00:31
482500 -- (-469.251) (-471.449) (-468.833) [-467.540] * [-471.807] (-467.080) (-467.885) (-467.406) -- 0:00:31
483000 -- (-469.549) (-467.224) (-471.255) [-469.384] * [-468.632] (-469.242) (-468.038) (-468.535) -- 0:00:31
483500 -- [-469.458] (-471.157) (-468.315) (-469.230) * (-469.399) [-467.121] (-468.727) (-469.636) -- 0:00:30
484000 -- (-471.584) [-468.142] (-469.478) (-472.713) * (-468.889) [-469.978] (-468.869) (-471.457) -- 0:00:30
484500 -- (-469.973) (-469.998) [-468.092] (-469.150) * [-469.777] (-468.854) (-469.847) (-467.699) -- 0:00:30
485000 -- (-471.461) [-470.032] (-470.082) (-468.373) * (-471.673) [-469.458] (-467.684) (-471.500) -- 0:00:30
Average standard deviation of split frequencies: 0.012610
485500 -- [-468.679] (-471.341) (-470.438) (-469.653) * (-467.343) [-468.631] (-470.678) (-474.453) -- 0:00:31
486000 -- (-469.177) (-471.108) [-467.701] (-470.480) * (-467.735) (-473.381) [-469.289] (-469.482) -- 0:00:31
486500 -- [-467.870] (-468.345) (-469.442) (-469.036) * (-469.421) [-469.451] (-468.455) (-469.814) -- 0:00:31
487000 -- [-470.118] (-470.010) (-471.369) (-470.938) * (-471.602) [-468.538] (-468.576) (-470.057) -- 0:00:31
487500 -- (-469.572) (-468.822) [-472.726] (-470.752) * (-470.569) (-467.782) [-468.683] (-469.123) -- 0:00:31
488000 -- (-470.995) (-469.990) (-469.599) [-472.490] * (-470.921) (-468.143) [-467.193] (-474.266) -- 0:00:31
488500 -- [-471.179] (-471.552) (-468.352) (-468.760) * (-469.142) (-467.756) [-467.866] (-469.667) -- 0:00:31
489000 -- (-471.061) [-467.366] (-467.207) (-468.095) * (-471.839) (-468.559) [-467.939] (-468.984) -- 0:00:31
489500 -- [-470.534] (-467.297) (-467.268) (-467.227) * [-470.559] (-470.683) (-468.531) (-469.054) -- 0:00:31
490000 -- [-468.510] (-469.728) (-467.721) (-467.513) * (-471.436) [-468.432] (-467.642) (-468.634) -- 0:00:31
Average standard deviation of split frequencies: 0.012610
490500 -- (-469.819) (-472.261) (-471.966) [-468.019] * (-468.417) [-467.665] (-469.076) (-469.420) -- 0:00:31
491000 -- (-475.557) (-471.980) [-467.337] (-469.068) * [-468.646] (-467.746) (-468.335) (-470.042) -- 0:00:31
491500 -- [-468.033] (-471.866) (-471.968) (-467.740) * (-469.418) (-467.713) (-468.882) [-471.892] -- 0:00:31
492000 -- (-471.857) (-469.509) [-469.991] (-467.801) * (-468.293) (-467.582) (-468.796) [-467.852] -- 0:00:30
492500 -- (-467.791) [-470.720] (-467.808) (-468.540) * (-467.250) (-467.682) [-467.921] (-471.189) -- 0:00:30
493000 -- (-473.067) [-469.582] (-468.737) (-470.487) * (-473.970) (-468.447) [-468.163] (-471.500) -- 0:00:30
493500 -- (-469.822) (-469.717) (-469.862) [-470.937] * [-471.376] (-468.345) (-469.274) (-469.296) -- 0:00:30
494000 -- (-471.210) [-470.689] (-470.246) (-468.932) * (-468.712) [-467.698] (-469.096) (-469.999) -- 0:00:30
494500 -- (-467.147) (-469.662) [-468.166] (-470.922) * [-467.925] (-469.745) (-469.361) (-469.346) -- 0:00:30
495000 -- (-469.620) (-470.059) [-468.703] (-469.930) * (-467.532) (-467.651) [-472.803] (-468.058) -- 0:00:30
Average standard deviation of split frequencies: 0.011999
495500 -- [-472.847] (-466.946) (-470.268) (-472.002) * (-469.953) (-468.307) [-467.872] (-470.195) -- 0:00:30
496000 -- (-471.331) (-469.589) [-469.734] (-469.545) * (-469.838) (-470.134) [-468.477] (-468.920) -- 0:00:30
496500 -- (-468.858) (-467.165) [-468.302] (-467.919) * [-469.361] (-471.149) (-468.269) (-468.878) -- 0:00:30
497000 -- (-468.987) (-469.587) (-467.867) [-467.468] * (-471.572) [-468.466] (-467.874) (-471.425) -- 0:00:30
497500 -- (-469.989) (-468.096) [-473.270] (-469.242) * [-470.046] (-468.540) (-472.184) (-469.013) -- 0:00:30
498000 -- [-470.155] (-471.416) (-470.175) (-468.367) * (-469.671) (-467.660) [-468.659] (-469.057) -- 0:00:30
498500 -- (-470.134) (-471.406) [-471.178] (-468.608) * [-467.352] (-469.462) (-471.270) (-469.145) -- 0:00:30
499000 -- (-469.486) (-468.162) (-468.723) [-471.347] * (-467.518) [-468.059] (-468.790) (-468.404) -- 0:00:30
499500 -- [-472.064] (-469.074) (-469.028) (-468.552) * [-468.038] (-472.042) (-467.827) (-467.952) -- 0:00:30
500000 -- (-474.961) [-471.213] (-474.582) (-468.581) * (-467.398) (-471.653) [-469.181] (-469.188) -- 0:00:30
Average standard deviation of split frequencies: 0.011063
500500 -- (-470.885) (-470.807) (-470.465) [-472.177] * (-468.176) (-468.107) [-469.832] (-473.336) -- 0:00:29
501000 -- [-469.018] (-470.789) (-469.469) (-467.651) * [-468.497] (-469.647) (-471.295) (-468.594) -- 0:00:29
501500 -- (-470.008) (-471.061) (-469.480) [-469.783] * (-470.623) [-467.796] (-470.242) (-468.777) -- 0:00:29
502000 -- (-471.031) [-468.193] (-467.902) (-469.856) * (-469.588) [-468.548] (-468.007) (-468.792) -- 0:00:29
502500 -- (-476.301) (-469.861) (-467.623) [-471.559] * (-469.628) (-468.709) (-473.821) [-470.518] -- 0:00:30
503000 -- (-469.698) [-468.007] (-472.528) (-468.764) * (-468.773) (-471.158) (-469.952) [-467.727] -- 0:00:30
503500 -- (-469.677) [-470.248] (-469.312) (-469.598) * (-467.688) (-471.307) [-469.873] (-469.219) -- 0:00:30
504000 -- (-468.748) [-475.165] (-468.811) (-479.440) * (-469.766) (-469.736) (-470.968) [-467.968] -- 0:00:30
504500 -- [-469.937] (-468.064) (-468.213) (-477.675) * (-473.859) [-469.356] (-468.482) (-470.583) -- 0:00:30
505000 -- (-468.554) (-474.784) (-467.751) [-468.046] * (-471.236) [-468.091] (-469.942) (-471.084) -- 0:00:30
Average standard deviation of split frequencies: 0.011762
505500 -- (-468.799) (-479.993) (-468.997) [-474.184] * (-467.630) (-469.734) (-467.257) [-469.892] -- 0:00:30
506000 -- (-470.397) (-473.989) [-469.726] (-469.354) * [-470.408] (-473.031) (-469.511) (-468.585) -- 0:00:30
506500 -- [-469.872] (-472.691) (-468.261) (-468.634) * (-469.666) (-469.796) (-472.892) [-468.309] -- 0:00:30
507000 -- (-471.246) (-468.011) [-467.312] (-468.756) * (-471.405) (-469.270) (-472.202) [-468.282] -- 0:00:30
507500 -- (-468.298) (-469.072) [-467.572] (-473.385) * (-470.361) [-468.697] (-469.044) (-469.960) -- 0:00:30
508000 -- (-468.261) [-468.422] (-467.954) (-469.021) * [-469.323] (-470.719) (-469.502) (-471.431) -- 0:00:30
508500 -- [-468.590] (-473.377) (-469.731) (-471.608) * (-468.580) (-469.628) [-468.745] (-469.120) -- 0:00:29
509000 -- [-467.051] (-469.068) (-468.932) (-469.628) * [-468.830] (-469.188) (-469.926) (-469.426) -- 0:00:29
509500 -- (-467.561) [-468.404] (-468.941) (-468.288) * (-467.753) (-473.784) (-470.454) [-472.651] -- 0:00:29
510000 -- (-469.752) (-469.034) (-468.765) [-468.369] * (-470.327) (-470.964) [-474.845] (-471.135) -- 0:00:29
Average standard deviation of split frequencies: 0.012174
510500 -- (-468.410) (-470.911) [-468.253] (-467.439) * (-471.168) [-468.555] (-469.729) (-474.674) -- 0:00:29
511000 -- (-468.633) (-468.944) [-468.752] (-467.886) * (-470.354) [-473.961] (-469.968) (-469.389) -- 0:00:29
511500 -- (-468.738) [-467.415] (-467.990) (-469.629) * (-468.847) (-467.317) (-471.384) [-467.753] -- 0:00:29
512000 -- (-469.235) (-468.256) (-470.116) [-468.781] * (-472.057) (-470.304) [-469.790] (-469.451) -- 0:00:29
512500 -- (-468.763) (-473.126) [-468.460] (-468.174) * (-469.377) [-472.105] (-469.124) (-471.273) -- 0:00:29
513000 -- (-469.735) (-469.006) [-467.963] (-468.994) * (-470.320) (-468.477) [-470.332] (-471.436) -- 0:00:29
513500 -- (-469.979) (-468.206) (-467.627) [-471.384] * (-469.229) (-468.676) [-467.977] (-472.408) -- 0:00:29
514000 -- (-474.284) [-468.795] (-467.679) (-467.783) * (-468.368) (-469.957) (-470.418) [-472.409] -- 0:00:29
514500 -- (-468.978) (-470.229) (-469.086) [-467.900] * (-469.634) (-469.467) (-468.510) [-470.598] -- 0:00:29
515000 -- (-468.145) (-468.981) (-468.725) [-467.605] * [-467.066] (-469.131) (-468.003) (-472.759) -- 0:00:29
Average standard deviation of split frequencies: 0.011819
515500 -- (-471.275) (-469.091) [-472.562] (-468.051) * [-469.205] (-467.968) (-467.076) (-469.738) -- 0:00:29
516000 -- (-468.110) (-468.252) (-469.653) [-469.003] * (-469.362) [-468.383] (-470.452) (-470.950) -- 0:00:29
516500 -- [-467.585] (-470.613) (-470.268) (-469.592) * (-472.299) (-467.556) (-467.867) [-468.788] -- 0:00:29
517000 -- (-468.735) (-470.205) (-470.301) [-472.572] * (-467.377) (-468.170) [-467.324] (-467.742) -- 0:00:28
517500 -- (-468.199) (-472.325) [-469.093] (-469.067) * [-469.836] (-472.046) (-471.626) (-468.493) -- 0:00:28
518000 -- (-469.079) [-469.458] (-469.253) (-468.770) * (-469.536) (-472.839) (-468.768) [-469.561] -- 0:00:28
518500 -- [-471.278] (-470.517) (-471.559) (-467.793) * [-468.293] (-472.658) (-468.787) (-469.111) -- 0:00:28
519000 -- (-468.938) [-470.739] (-470.161) (-469.164) * (-474.358) [-470.378] (-467.169) (-468.917) -- 0:00:28
519500 -- (-467.757) (-469.397) (-470.631) [-467.623] * (-469.376) (-472.983) (-467.935) [-468.883] -- 0:00:29
520000 -- [-467.428] (-470.730) (-467.860) (-468.152) * (-470.480) (-470.466) [-468.133] (-468.511) -- 0:00:29
Average standard deviation of split frequencies: 0.011940
520500 -- (-468.649) [-469.688] (-470.062) (-469.253) * (-468.028) [-469.933] (-468.726) (-468.529) -- 0:00:29
521000 -- (-469.866) (-469.807) (-473.208) [-469.942] * (-468.907) (-471.797) [-469.713] (-468.934) -- 0:00:29
521500 -- (-476.363) (-470.858) (-469.691) [-468.173] * (-468.656) [-468.159] (-469.651) (-471.195) -- 0:00:29
522000 -- [-469.386] (-469.318) (-469.364) (-471.729) * [-470.689] (-471.817) (-467.873) (-471.052) -- 0:00:29
522500 -- (-470.333) [-468.785] (-468.989) (-468.543) * (-472.555) (-474.009) [-468.604] (-468.369) -- 0:00:29
523000 -- (-472.345) [-469.667] (-467.569) (-471.184) * [-467.729] (-468.712) (-468.763) (-470.863) -- 0:00:29
523500 -- (-467.786) (-467.911) [-471.816] (-467.250) * [-467.150] (-469.565) (-473.633) (-470.601) -- 0:00:29
524000 -- (-467.700) (-468.343) [-469.544] (-468.959) * (-470.051) [-468.503] (-471.611) (-468.161) -- 0:00:29
524500 -- [-470.342] (-467.370) (-471.319) (-470.490) * (-470.165) [-467.682] (-469.526) (-468.282) -- 0:00:29
525000 -- (-467.505) [-469.139] (-469.743) (-467.338) * (-468.872) (-468.621) [-468.961] (-467.998) -- 0:00:28
Average standard deviation of split frequencies: 0.011763
525500 -- (-469.734) [-468.059] (-467.706) (-470.109) * [-469.312] (-471.299) (-474.614) (-469.516) -- 0:00:28
526000 -- (-470.406) (-468.162) [-469.359] (-469.085) * (-470.339) (-466.847) [-471.134] (-472.529) -- 0:00:28
526500 -- (-467.732) (-467.884) (-469.429) [-470.133] * (-470.244) (-468.395) (-469.143) [-469.186] -- 0:00:28
527000 -- (-471.254) (-467.973) [-468.301] (-466.977) * (-470.828) [-467.945] (-467.837) (-468.542) -- 0:00:28
527500 -- [-473.020] (-469.758) (-468.657) (-467.000) * (-469.800) (-469.149) (-471.101) [-468.693] -- 0:00:28
528000 -- (-467.488) (-469.353) [-469.251] (-470.143) * (-468.197) (-469.603) [-471.068] (-467.947) -- 0:00:28
528500 -- [-469.003] (-471.290) (-468.144) (-468.910) * (-467.741) (-469.473) (-470.115) [-469.519] -- 0:00:28
529000 -- (-467.446) [-472.060] (-469.068) (-471.572) * [-470.653] (-467.464) (-467.020) (-471.097) -- 0:00:28
529500 -- (-472.943) [-470.625] (-468.023) (-471.913) * (-468.017) (-467.067) [-467.020] (-468.238) -- 0:00:28
530000 -- [-467.922] (-467.263) (-469.969) (-468.494) * (-468.164) [-467.276] (-474.783) (-468.669) -- 0:00:28
Average standard deviation of split frequencies: 0.011326
530500 -- [-468.240] (-469.487) (-472.879) (-467.595) * (-467.928) (-467.970) (-469.599) [-469.172] -- 0:00:28
531000 -- (-471.129) [-467.523] (-468.955) (-468.903) * (-468.231) [-467.876] (-472.158) (-467.831) -- 0:00:28
531500 -- (-472.069) (-468.904) [-469.030] (-467.752) * (-470.173) (-468.435) (-471.049) [-468.885] -- 0:00:28
532000 -- (-467.200) [-468.244] (-469.242) (-467.367) * (-468.917) [-468.398] (-468.995) (-468.968) -- 0:00:28
532500 -- [-469.457] (-469.708) (-470.851) (-473.620) * (-467.208) (-468.890) [-468.533] (-470.099) -- 0:00:28
533000 -- (-468.307) (-469.383) [-468.804] (-475.816) * (-476.063) (-467.998) [-469.410] (-471.595) -- 0:00:28
533500 -- (-473.887) (-472.691) (-468.042) [-467.542] * (-468.161) (-467.973) [-468.033] (-471.016) -- 0:00:27
534000 -- (-469.334) (-471.061) (-468.206) [-469.237] * (-470.591) (-470.104) (-469.527) [-468.818] -- 0:00:27
534500 -- (-468.666) (-471.330) [-468.212] (-469.752) * (-468.247) (-468.953) (-470.348) [-468.725] -- 0:00:27
535000 -- (-469.598) (-471.409) (-468.632) [-470.671] * (-468.219) [-468.350] (-470.284) (-468.735) -- 0:00:27
Average standard deviation of split frequencies: 0.010279
535500 -- (-468.557) [-468.648] (-476.231) (-469.295) * (-468.320) (-469.325) [-467.676] (-470.694) -- 0:00:27
536000 -- [-470.447] (-469.404) (-477.521) (-468.958) * (-473.915) [-468.815] (-471.893) (-468.305) -- 0:00:27
536500 -- [-467.473] (-468.785) (-472.431) (-470.461) * (-471.011) (-472.803) (-471.022) [-470.394] -- 0:00:28
537000 -- (-468.547) (-467.219) [-470.464] (-469.539) * (-468.695) (-467.503) (-467.289) [-470.120] -- 0:00:28
537500 -- (-467.835) (-468.529) (-467.527) [-469.254] * (-469.975) (-467.279) [-468.695] (-469.176) -- 0:00:28
538000 -- (-467.516) [-473.241] (-469.627) (-469.559) * (-474.273) [-468.148] (-469.187) (-476.954) -- 0:00:28
538500 -- [-469.945] (-468.794) (-469.306) (-470.516) * (-470.465) (-471.479) [-467.563] (-471.113) -- 0:00:28
539000 -- (-473.179) (-468.521) [-468.329] (-470.746) * (-467.957) [-469.120] (-469.003) (-470.528) -- 0:00:28
539500 -- [-469.823] (-469.165) (-471.581) (-469.198) * [-467.558] (-469.558) (-468.400) (-470.829) -- 0:00:28
540000 -- (-470.344) (-468.651) [-468.297] (-473.733) * (-468.031) (-472.133) (-469.141) [-468.655] -- 0:00:28
Average standard deviation of split frequencies: 0.011117
540500 -- (-470.622) (-469.324) [-468.039] (-469.287) * (-468.314) (-469.341) (-468.107) [-467.472] -- 0:00:28
541000 -- (-469.179) (-469.166) [-469.027] (-470.084) * [-469.689] (-468.679) (-468.576) (-469.320) -- 0:00:27
541500 -- [-469.854] (-468.046) (-467.376) (-468.601) * [-470.596] (-469.796) (-469.481) (-472.824) -- 0:00:27
542000 -- (-469.348) (-469.331) (-471.029) [-469.237] * [-471.628] (-470.780) (-471.282) (-469.552) -- 0:00:27
542500 -- (-471.307) (-468.709) (-468.808) [-470.183] * [-467.511] (-468.980) (-471.483) (-472.421) -- 0:00:27
543000 -- (-468.622) [-467.851] (-467.530) (-468.211) * [-468.221] (-471.588) (-468.517) (-470.476) -- 0:00:27
543500 -- (-467.644) (-468.327) [-467.625] (-469.270) * [-470.254] (-470.409) (-471.789) (-470.936) -- 0:00:27
544000 -- (-468.815) (-472.548) (-468.092) [-467.970] * (-471.052) [-470.234] (-468.493) (-469.043) -- 0:00:27
544500 -- (-470.763) (-474.105) (-468.716) [-468.451] * (-468.457) (-470.155) [-471.043] (-468.633) -- 0:00:27
545000 -- (-472.893) (-469.164) (-469.090) [-470.207] * (-473.976) (-471.736) (-469.235) [-469.184] -- 0:00:27
Average standard deviation of split frequencies: 0.010900
545500 -- (-468.215) (-469.416) (-469.705) [-467.614] * (-468.707) (-468.611) (-482.068) [-468.377] -- 0:00:27
546000 -- (-475.447) (-469.234) (-470.585) [-468.375] * (-468.942) (-469.518) [-469.467] (-468.557) -- 0:00:27
546500 -- (-468.451) (-468.765) (-470.399) [-471.646] * (-468.157) (-468.764) [-468.814] (-468.798) -- 0:00:27
547000 -- (-468.154) (-472.581) [-468.839] (-473.630) * [-469.127] (-468.215) (-471.382) (-469.712) -- 0:00:27
547500 -- [-468.506] (-468.979) (-469.691) (-472.449) * [-468.756] (-471.574) (-467.856) (-471.486) -- 0:00:27
548000 -- (-468.273) [-470.067] (-468.403) (-469.197) * [-468.858] (-469.725) (-469.860) (-470.200) -- 0:00:27
548500 -- (-469.201) [-467.677] (-469.084) (-473.672) * (-471.369) (-469.304) [-468.749] (-469.184) -- 0:00:27
549000 -- (-471.498) [-467.331] (-471.657) (-468.288) * (-468.699) [-467.475] (-471.024) (-470.781) -- 0:00:27
549500 -- (-468.208) [-467.048] (-469.504) (-468.666) * (-473.051) (-472.635) (-469.137) [-467.871] -- 0:00:27
550000 -- (-477.836) (-469.380) [-468.208] (-470.500) * (-471.921) (-469.634) (-469.457) [-467.846] -- 0:00:27
Average standard deviation of split frequencies: 0.011022
550500 -- (-467.390) (-470.309) [-470.379] (-470.090) * [-468.816] (-471.304) (-472.362) (-467.395) -- 0:00:26
551000 -- (-469.292) (-469.647) (-472.009) [-469.166] * (-469.530) (-473.628) (-473.810) [-471.108] -- 0:00:26
551500 -- (-468.292) [-468.291] (-470.047) (-468.046) * [-470.132] (-470.980) (-471.544) (-469.037) -- 0:00:26
552000 -- (-468.143) (-468.931) [-469.998] (-468.505) * (-470.572) (-470.299) [-470.856] (-468.540) -- 0:00:26
552500 -- (-468.891) (-469.756) (-467.352) [-469.254] * [-468.675] (-470.559) (-469.414) (-469.130) -- 0:00:26
553000 -- (-469.329) (-468.003) (-470.137) [-472.082] * (-470.355) (-468.715) (-467.867) [-469.121] -- 0:00:26
553500 -- [-469.665] (-467.941) (-470.803) (-470.112) * (-469.047) (-473.338) [-468.754] (-470.172) -- 0:00:27
554000 -- (-468.149) (-468.491) [-469.633] (-468.623) * [-468.316] (-468.147) (-467.756) (-467.643) -- 0:00:27
554500 -- (-467.437) (-469.374) [-470.460] (-475.323) * (-468.241) [-469.288] (-473.603) (-468.967) -- 0:00:27
555000 -- (-467.398) (-468.109) [-469.501] (-468.391) * (-472.322) [-468.864] (-471.404) (-470.335) -- 0:00:27
Average standard deviation of split frequencies: 0.010492
555500 -- [-467.189] (-473.961) (-467.499) (-469.588) * [-470.627] (-468.282) (-468.530) (-470.984) -- 0:00:27
556000 -- (-466.949) (-469.950) [-469.014] (-473.337) * [-470.228] (-476.227) (-471.252) (-471.287) -- 0:00:27
556500 -- (-467.007) [-470.996] (-470.537) (-469.374) * (-467.786) (-467.230) [-471.162] (-470.651) -- 0:00:27
557000 -- (-468.240) (-469.124) (-472.005) [-468.650] * (-469.472) (-467.950) [-470.472] (-470.595) -- 0:00:27
557500 -- (-468.380) [-471.745] (-467.551) (-468.848) * (-467.933) (-469.177) (-469.331) [-469.763] -- 0:00:26
558000 -- [-468.722] (-469.428) (-470.729) (-471.886) * (-470.085) (-468.800) [-469.431] (-471.782) -- 0:00:26
558500 -- (-470.420) [-468.518] (-468.544) (-471.122) * (-471.620) (-468.996) [-470.151] (-467.551) -- 0:00:26
559000 -- (-468.313) (-470.523) (-469.839) [-471.336] * (-471.393) (-469.053) [-467.087] (-467.796) -- 0:00:26
559500 -- (-468.857) (-470.508) [-468.385] (-468.487) * (-470.016) (-470.214) [-471.191] (-470.443) -- 0:00:26
560000 -- (-469.864) [-470.325] (-468.507) (-472.515) * [-467.359] (-469.165) (-469.293) (-473.542) -- 0:00:26
Average standard deviation of split frequencies: 0.010142
560500 -- [-469.596] (-469.734) (-467.117) (-469.224) * (-470.889) (-470.926) [-468.627] (-469.742) -- 0:00:26
561000 -- (-469.657) [-468.924] (-470.242) (-471.305) * (-469.438) (-471.081) (-468.958) [-468.238] -- 0:00:26
561500 -- (-469.885) (-469.382) (-467.626) [-471.372] * (-467.716) (-473.071) (-468.704) [-471.313] -- 0:00:26
562000 -- (-467.653) (-470.404) (-468.234) [-473.327] * (-467.157) [-470.757] (-470.891) (-469.130) -- 0:00:26
562500 -- [-467.240] (-470.942) (-467.675) (-471.387) * (-468.492) (-470.813) (-468.516) [-469.825] -- 0:00:26
563000 -- (-467.625) [-473.890] (-467.683) (-468.892) * (-470.494) (-469.765) [-471.285] (-470.219) -- 0:00:26
563500 -- (-470.753) [-470.067] (-469.671) (-471.529) * [-470.448] (-471.109) (-469.879) (-471.310) -- 0:00:26
564000 -- [-470.864] (-470.037) (-467.841) (-470.992) * [-474.872] (-472.304) (-473.228) (-472.190) -- 0:00:26
564500 -- (-470.236) [-471.125] (-476.092) (-472.030) * (-469.910) [-469.961] (-471.589) (-468.211) -- 0:00:26
565000 -- (-469.831) [-468.832] (-468.201) (-467.450) * (-469.943) (-469.075) (-471.789) [-469.205] -- 0:00:26
Average standard deviation of split frequencies: 0.010255
565500 -- (-469.406) (-469.780) [-472.069] (-470.239) * [-467.897] (-468.421) (-471.218) (-472.949) -- 0:00:26
566000 -- (-467.856) (-469.705) (-468.964) [-470.447] * [-467.302] (-474.455) (-478.589) (-467.467) -- 0:00:26
566500 -- (-470.131) (-468.438) (-467.696) [-470.175] * (-469.708) (-471.007) (-475.184) [-467.306] -- 0:00:26
567000 -- (-468.919) (-471.012) [-468.511] (-469.024) * [-467.848] (-472.114) (-470.515) (-469.271) -- 0:00:25
567500 -- [-468.535] (-469.026) (-469.389) (-469.592) * (-470.141) (-471.312) (-468.206) [-470.857] -- 0:00:25
568000 -- (-472.849) (-469.134) [-468.775] (-467.952) * [-469.292] (-469.954) (-475.094) (-468.859) -- 0:00:25
568500 -- [-467.664] (-468.006) (-469.964) (-468.208) * (-470.506) (-468.226) [-468.416] (-468.659) -- 0:00:25
569000 -- (-469.891) [-469.062] (-469.160) (-469.350) * (-468.286) (-467.799) (-468.149) [-468.718] -- 0:00:25
569500 -- (-468.042) [-468.687] (-467.423) (-470.828) * (-469.158) (-470.437) [-468.505] (-468.858) -- 0:00:25
570000 -- [-469.041] (-467.422) (-467.384) (-471.014) * (-468.557) (-470.318) [-469.568] (-470.199) -- 0:00:25
Average standard deviation of split frequencies: 0.010481
570500 -- [-468.756] (-468.592) (-468.401) (-471.516) * (-471.855) [-467.466] (-468.026) (-471.946) -- 0:00:25
571000 -- (-471.695) (-467.848) [-469.843] (-468.284) * (-469.732) (-473.817) [-469.631] (-469.391) -- 0:00:26
571500 -- (-469.261) (-468.668) (-467.159) [-470.941] * (-470.228) (-471.942) (-468.322) [-468.641] -- 0:00:26
572000 -- (-472.905) (-469.979) (-467.133) [-467.599] * (-471.816) (-470.287) (-469.168) [-468.763] -- 0:00:26
572500 -- (-466.878) (-469.340) (-467.467) [-468.281] * (-470.453) (-467.389) [-468.420] (-467.650) -- 0:00:26
573000 -- (-468.640) [-469.396] (-471.932) (-469.889) * (-467.702) (-468.710) (-469.273) [-468.178] -- 0:00:26
573500 -- (-469.211) [-468.234] (-472.485) (-469.869) * (-468.405) (-470.062) [-467.729] (-468.078) -- 0:00:26
574000 -- [-468.048] (-469.708) (-470.157) (-469.308) * (-467.793) (-472.099) (-471.686) [-471.994] -- 0:00:25
574500 -- (-468.159) (-470.420) (-471.895) [-469.687] * (-468.489) (-468.165) [-471.744] (-469.366) -- 0:00:25
575000 -- [-467.724] (-470.496) (-469.982) (-470.934) * (-469.423) (-469.933) (-468.416) [-467.878] -- 0:00:25
Average standard deviation of split frequencies: 0.010281
575500 -- [-467.860] (-470.800) (-470.552) (-473.056) * (-469.944) (-467.715) (-469.183) [-468.381] -- 0:00:25
576000 -- (-474.183) [-468.640] (-471.318) (-471.838) * (-468.003) [-469.752] (-469.432) (-469.070) -- 0:00:25
576500 -- [-468.716] (-474.736) (-469.329) (-469.234) * (-472.933) [-468.708] (-468.446) (-469.648) -- 0:00:25
577000 -- (-469.848) [-469.117] (-469.054) (-468.622) * (-468.683) (-469.517) [-469.750] (-469.389) -- 0:00:25
577500 -- [-471.052] (-470.486) (-476.705) (-471.739) * (-468.476) (-471.010) [-468.583] (-467.994) -- 0:00:25
578000 -- (-472.068) (-468.364) [-467.735] (-471.875) * (-469.276) (-467.616) (-468.095) [-468.833] -- 0:00:25
578500 -- (-477.913) [-469.483] (-472.814) (-468.439) * (-468.858) [-470.398] (-471.093) (-468.384) -- 0:00:25
579000 -- (-472.538) (-469.632) [-468.256] (-467.706) * (-471.578) (-467.929) (-469.378) [-467.805] -- 0:00:25
579500 -- [-469.958] (-471.355) (-468.807) (-468.050) * [-468.048] (-467.717) (-469.861) (-474.695) -- 0:00:25
580000 -- (-471.512) (-470.754) [-468.970] (-468.567) * [-468.931] (-471.549) (-468.293) (-467.637) -- 0:00:25
Average standard deviation of split frequencies: 0.010199
580500 -- (-467.348) (-468.169) [-468.034] (-468.100) * (-467.748) [-477.789] (-467.838) (-470.766) -- 0:00:25
581000 -- (-470.385) [-467.978] (-471.251) (-467.993) * (-468.329) [-469.734] (-470.168) (-468.579) -- 0:00:25
581500 -- (-468.592) (-469.275) [-468.199] (-471.174) * (-471.156) [-469.668] (-469.487) (-471.932) -- 0:00:25
582000 -- (-467.469) (-470.743) (-471.333) [-468.850] * (-468.505) [-470.420] (-468.869) (-470.244) -- 0:00:25
582500 -- (-467.554) (-468.024) (-468.801) [-469.620] * (-468.522) (-468.419) [-470.367] (-471.007) -- 0:00:25
583000 -- (-469.994) (-471.408) [-469.702] (-467.424) * (-471.299) [-468.154] (-467.857) (-471.845) -- 0:00:25
583500 -- (-469.620) [-468.411] (-469.614) (-470.351) * (-469.089) [-469.704] (-467.756) (-469.884) -- 0:00:24
584000 -- (-468.090) (-469.044) (-469.578) [-468.231] * (-468.223) [-468.347] (-469.353) (-470.383) -- 0:00:24
584500 -- (-467.448) [-470.431] (-469.256) (-467.210) * (-470.829) (-468.319) [-469.679] (-469.000) -- 0:00:24
585000 -- (-471.689) [-469.275] (-469.901) (-468.111) * [-471.133] (-469.154) (-467.998) (-471.220) -- 0:00:24
Average standard deviation of split frequencies: 0.010206
585500 -- (-468.894) (-470.666) (-470.693) [-467.869] * [-467.842] (-470.482) (-470.762) (-467.295) -- 0:00:24
586000 -- (-468.342) (-470.033) [-470.682] (-468.862) * [-470.414] (-467.046) (-470.043) (-468.408) -- 0:00:24
586500 -- (-468.365) (-468.264) [-469.384] (-468.537) * (-469.030) (-467.494) [-470.525] (-469.100) -- 0:00:24
587000 -- (-470.153) [-469.271] (-469.630) (-470.233) * [-468.391] (-467.902) (-468.889) (-472.417) -- 0:00:24
587500 -- (-473.189) (-469.802) [-469.040] (-468.267) * [-469.537] (-469.421) (-469.152) (-470.061) -- 0:00:24
588000 -- (-470.407) (-471.549) [-469.398] (-468.904) * (-468.833) [-469.613] (-470.907) (-468.639) -- 0:00:25
588500 -- (-468.944) (-470.497) (-469.475) [-468.008] * (-470.555) (-470.683) [-472.379] (-471.413) -- 0:00:25
589000 -- (-469.056) (-468.675) [-468.964] (-467.502) * (-475.595) (-471.276) [-470.076] (-468.004) -- 0:00:25
589500 -- (-470.016) [-470.566] (-469.664) (-468.237) * (-473.447) (-469.354) [-469.747] (-467.792) -- 0:00:25
590000 -- (-468.463) [-469.135] (-469.203) (-467.879) * (-468.719) (-468.746) (-470.039) [-470.186] -- 0:00:25
Average standard deviation of split frequencies: 0.009926
590500 -- (-469.840) (-467.741) [-469.218] (-467.786) * (-470.694) [-468.529] (-470.199) (-471.076) -- 0:00:24
591000 -- (-469.447) [-470.193] (-466.912) (-472.039) * [-471.109] (-468.936) (-469.319) (-472.629) -- 0:00:24
591500 -- (-467.959) (-469.005) [-468.720] (-468.894) * (-472.921) (-471.133) (-468.179) [-467.427] -- 0:00:24
592000 -- (-471.614) [-468.529] (-470.035) (-468.201) * (-470.007) [-469.625] (-469.610) (-479.769) -- 0:00:24
592500 -- (-470.888) [-468.344] (-470.939) (-471.699) * (-470.197) (-471.993) [-468.629] (-470.337) -- 0:00:24
593000 -- (-468.650) [-470.000] (-472.558) (-468.147) * (-469.723) (-471.557) [-467.749] (-470.990) -- 0:00:24
593500 -- [-468.785] (-470.595) (-470.753) (-470.851) * (-469.161) [-467.566] (-469.289) (-468.212) -- 0:00:24
594000 -- [-470.525] (-467.992) (-472.140) (-472.990) * (-467.774) (-470.185) (-473.293) [-467.321] -- 0:00:24
594500 -- (-468.142) [-468.842] (-472.789) (-470.866) * [-469.270] (-473.368) (-468.948) (-467.578) -- 0:00:24
595000 -- [-470.544] (-468.050) (-470.370) (-468.300) * (-471.473) (-468.146) [-469.334] (-474.386) -- 0:00:24
Average standard deviation of split frequencies: 0.009986
595500 -- (-468.425) [-468.541] (-468.231) (-469.133) * [-467.925] (-469.191) (-468.994) (-468.184) -- 0:00:24
596000 -- [-470.789] (-471.743) (-471.828) (-468.646) * (-467.624) (-468.841) (-468.157) [-468.655] -- 0:00:24
596500 -- (-467.291) (-468.570) (-467.186) [-467.825] * [-470.178] (-468.776) (-469.924) (-468.754) -- 0:00:24
597000 -- [-467.798] (-468.329) (-468.927) (-468.060) * [-470.458] (-471.148) (-468.269) (-468.070) -- 0:00:24
597500 -- (-469.190) [-468.888] (-469.384) (-469.950) * (-471.599) [-467.698] (-467.186) (-468.753) -- 0:00:24
598000 -- (-467.608) [-470.548] (-469.337) (-471.151) * (-472.983) [-470.049] (-469.220) (-473.365) -- 0:00:24
598500 -- (-470.948) (-470.122) (-469.285) [-472.071] * (-469.613) (-469.638) [-468.689] (-470.061) -- 0:00:24
599000 -- (-467.259) [-469.993] (-469.291) (-470.143) * (-469.542) (-469.151) (-467.571) [-468.603] -- 0:00:24
599500 -- (-467.662) (-468.144) [-469.086] (-470.189) * [-467.637] (-468.488) (-469.098) (-473.403) -- 0:00:24
600000 -- (-468.529) (-472.263) [-469.732] (-481.013) * (-467.788) (-469.025) (-470.030) [-468.900] -- 0:00:24
Average standard deviation of split frequencies: 0.010006
600500 -- [-469.027] (-471.206) (-470.844) (-480.174) * (-468.138) (-469.378) (-474.537) [-466.978] -- 0:00:23
601000 -- [-471.341] (-470.118) (-470.709) (-471.426) * (-468.557) (-471.515) (-471.564) [-466.980] -- 0:00:23
601500 -- [-467.689] (-473.838) (-468.905) (-469.748) * [-467.940] (-468.007) (-468.477) (-473.343) -- 0:00:23
602000 -- (-467.019) [-475.329] (-469.588) (-470.442) * [-471.895] (-469.193) (-467.455) (-472.447) -- 0:00:23
602500 -- (-470.699) [-469.560] (-471.767) (-470.376) * (-467.241) [-469.374] (-472.210) (-473.030) -- 0:00:23
603000 -- [-469.178] (-468.163) (-468.499) (-468.098) * (-468.681) (-474.771) [-467.144] (-467.824) -- 0:00:23
603500 -- (-471.310) (-468.919) [-470.905] (-470.058) * (-470.615) (-471.156) [-468.053] (-474.981) -- 0:00:23
604000 -- (-470.247) (-468.718) (-469.777) [-471.846] * (-467.354) (-468.078) (-467.830) [-470.150] -- 0:00:23
604500 -- (-471.326) (-468.001) [-468.855] (-471.919) * (-467.763) (-471.081) [-469.113] (-468.929) -- 0:00:24
605000 -- [-468.159] (-467.755) (-467.996) (-468.646) * [-471.809] (-468.977) (-469.029) (-470.631) -- 0:00:24
Average standard deviation of split frequencies: 0.010307
605500 -- (-468.249) (-469.728) (-468.265) [-467.402] * [-472.260] (-470.721) (-468.195) (-468.463) -- 0:00:24
606000 -- (-469.797) [-471.599] (-468.483) (-468.669) * (-467.636) [-467.161] (-470.324) (-468.899) -- 0:00:24
606500 -- [-468.857] (-468.999) (-471.044) (-468.639) * (-467.592) (-469.388) [-467.812] (-469.210) -- 0:00:24
607000 -- (-468.163) (-468.630) (-473.469) [-468.070] * [-467.280] (-469.710) (-468.620) (-470.418) -- 0:00:23
607500 -- (-467.962) (-473.797) (-469.435) [-467.625] * (-467.923) (-470.802) (-468.579) [-467.483] -- 0:00:23
608000 -- (-469.533) (-474.420) (-469.726) [-469.485] * [-468.716] (-470.974) (-470.166) (-468.820) -- 0:00:23
608500 -- [-468.130] (-469.256) (-469.918) (-471.286) * [-468.073] (-470.613) (-474.650) (-468.058) -- 0:00:23
609000 -- (-471.442) [-469.719] (-467.265) (-471.414) * [-467.865] (-471.847) (-469.584) (-468.051) -- 0:00:23
609500 -- [-470.031] (-469.074) (-470.956) (-468.932) * [-470.137] (-469.765) (-467.055) (-468.349) -- 0:00:23
610000 -- (-467.465) (-475.330) (-476.821) [-469.152] * (-473.345) [-469.214] (-467.117) (-472.204) -- 0:00:23
Average standard deviation of split frequencies: 0.009891
610500 -- (-470.516) [-468.923] (-476.850) (-472.535) * (-469.234) [-467.521] (-467.768) (-468.203) -- 0:00:23
611000 -- (-469.046) (-467.797) [-468.977] (-468.148) * (-468.611) (-469.068) [-467.785] (-468.254) -- 0:00:23
611500 -- (-468.769) (-468.863) [-469.620] (-471.366) * (-467.504) (-469.005) [-469.978] (-467.998) -- 0:00:23
612000 -- (-468.995) [-467.051] (-470.437) (-467.906) * (-468.439) (-472.991) (-467.106) [-470.456] -- 0:00:23
612500 -- [-468.602] (-469.077) (-470.084) (-467.616) * (-471.498) (-473.624) [-467.365] (-471.693) -- 0:00:23
613000 -- [-468.440] (-470.676) (-467.952) (-471.423) * [-471.318] (-470.686) (-468.290) (-467.880) -- 0:00:23
613500 -- [-469.850] (-469.574) (-467.722) (-468.769) * [-469.072] (-470.823) (-469.425) (-467.879) -- 0:00:23
614000 -- [-468.559] (-471.346) (-469.741) (-471.993) * (-470.100) (-469.892) [-469.893] (-469.285) -- 0:00:23
614500 -- (-468.559) [-469.904] (-470.070) (-469.792) * (-469.795) (-471.323) (-467.521) [-468.719] -- 0:00:23
615000 -- (-471.320) [-472.629] (-469.503) (-468.131) * (-470.525) [-467.852] (-469.279) (-468.805) -- 0:00:23
Average standard deviation of split frequencies: 0.009183
615500 -- (-470.180) (-470.308) [-467.185] (-469.269) * (-469.301) (-469.213) (-470.911) [-467.706] -- 0:00:23
616000 -- [-468.817] (-470.412) (-469.898) (-467.863) * (-471.523) (-474.804) (-470.818) [-467.871] -- 0:00:23
616500 -- (-471.259) [-469.615] (-469.128) (-468.514) * (-479.103) (-471.331) (-471.785) [-468.661] -- 0:00:23
617000 -- (-470.115) [-470.580] (-469.994) (-472.437) * [-470.375] (-468.284) (-469.443) (-473.202) -- 0:00:22
617500 -- (-470.472) (-472.705) (-468.406) [-469.391] * [-468.586] (-470.511) (-470.872) (-472.614) -- 0:00:22
618000 -- (-471.373) (-468.744) [-468.007] (-470.300) * [-468.990] (-468.631) (-468.726) (-472.759) -- 0:00:22
618500 -- [-471.124] (-467.980) (-468.868) (-468.003) * (-469.658) (-469.772) [-468.706] (-467.570) -- 0:00:22
619000 -- (-472.250) [-468.649] (-471.288) (-468.212) * [-470.472] (-468.806) (-468.840) (-469.796) -- 0:00:22
619500 -- (-469.925) (-470.616) [-470.257] (-472.315) * (-473.205) (-469.408) (-469.831) [-467.604] -- 0:00:22
620000 -- (-468.538) (-476.658) [-471.648] (-467.717) * (-469.836) (-469.836) (-468.257) [-468.867] -- 0:00:22
Average standard deviation of split frequencies: 0.008545
620500 -- [-471.734] (-471.660) (-467.557) (-467.489) * (-472.389) (-470.550) [-470.649] (-467.811) -- 0:00:22
621000 -- (-471.709) (-473.726) [-472.385] (-469.041) * [-469.111] (-468.644) (-473.607) (-468.574) -- 0:00:22
621500 -- (-469.130) (-468.640) [-467.973] (-468.158) * (-468.318) [-469.660] (-470.864) (-468.575) -- 0:00:23
622000 -- [-468.724] (-468.816) (-470.002) (-470.637) * (-470.090) (-468.308) (-467.324) [-467.462] -- 0:00:23
622500 -- (-467.987) [-467.874] (-467.794) (-467.995) * [-469.534] (-471.333) (-467.356) (-468.703) -- 0:00:23
623000 -- (-470.932) (-472.286) (-470.659) [-469.338] * [-469.030] (-469.172) (-471.587) (-472.633) -- 0:00:22
623500 -- (-468.210) [-468.003] (-470.884) (-469.603) * (-467.456) (-468.097) (-473.988) [-473.000] -- 0:00:22
624000 -- (-476.257) (-471.004) (-469.312) [-467.847] * (-468.362) [-468.494] (-467.820) (-472.404) -- 0:00:22
624500 -- (-476.712) (-467.416) (-468.827) [-468.436] * (-467.548) (-469.276) [-468.165] (-468.714) -- 0:00:22
625000 -- (-469.814) (-466.982) [-470.910] (-467.749) * [-473.134] (-467.982) (-468.206) (-467.851) -- 0:00:22
Average standard deviation of split frequencies: 0.008613
625500 -- (-470.667) (-469.842) [-469.277] (-468.042) * (-470.225) (-471.536) (-467.831) [-469.430] -- 0:00:22
626000 -- (-473.127) (-469.568) [-467.266] (-470.091) * (-474.504) (-470.661) (-468.141) [-469.495] -- 0:00:22
626500 -- (-469.283) (-470.294) [-468.062] (-472.103) * [-468.845] (-470.462) (-470.639) (-470.387) -- 0:00:22
627000 -- (-469.367) (-469.202) [-468.148] (-469.069) * (-471.778) (-467.861) [-468.392] (-469.682) -- 0:00:22
627500 -- (-469.253) (-468.600) (-473.402) [-469.138] * (-467.273) [-468.024] (-469.288) (-470.376) -- 0:00:22
628000 -- [-472.906] (-469.064) (-475.811) (-469.066) * (-469.631) [-469.787] (-471.681) (-468.285) -- 0:00:22
628500 -- (-472.643) (-469.764) (-472.546) [-470.290] * (-471.944) (-469.366) (-470.411) [-469.177] -- 0:00:22
629000 -- (-467.394) (-472.301) (-468.108) [-468.416] * (-470.996) (-468.889) (-469.023) [-468.584] -- 0:00:22
629500 -- [-468.303] (-471.259) (-467.523) (-469.616) * [-470.506] (-468.619) (-469.335) (-469.222) -- 0:00:22
630000 -- (-471.279) (-469.481) [-469.995] (-470.604) * (-467.576) (-469.288) [-469.670] (-470.975) -- 0:00:22
Average standard deviation of split frequencies: 0.007923
630500 -- (-469.528) [-469.394] (-469.356) (-470.311) * (-468.345) (-470.645) [-468.996] (-469.788) -- 0:00:22
631000 -- (-467.967) (-469.564) (-471.206) [-467.162] * [-470.893] (-468.736) (-469.868) (-469.072) -- 0:00:22
631500 -- (-469.572) [-468.129] (-471.794) (-468.175) * (-468.668) [-476.384] (-467.704) (-469.593) -- 0:00:22
632000 -- (-474.252) (-472.698) (-473.445) [-467.242] * (-470.197) (-470.728) [-468.338] (-469.127) -- 0:00:22
632500 -- (-470.749) (-469.185) [-467.823] (-469.938) * (-468.633) [-468.702] (-467.928) (-467.466) -- 0:00:22
633000 -- (-470.367) (-468.938) [-467.875] (-472.093) * (-468.836) [-469.091] (-470.481) (-468.552) -- 0:00:22
633500 -- (-468.770) [-468.827] (-467.717) (-469.090) * [-468.948] (-469.966) (-469.813) (-470.977) -- 0:00:21
634000 -- [-469.958] (-467.539) (-468.884) (-468.667) * [-468.106] (-467.793) (-468.238) (-469.871) -- 0:00:21
634500 -- (-470.945) (-467.590) (-468.840) [-471.475] * (-468.004) (-468.020) [-469.406] (-469.266) -- 0:00:21
635000 -- (-469.096) [-468.478] (-469.139) (-475.025) * (-467.562) [-471.248] (-470.030) (-468.939) -- 0:00:21
Average standard deviation of split frequencies: 0.007906
635500 -- (-468.918) (-469.332) (-469.690) [-468.160] * [-468.768] (-469.833) (-467.885) (-468.066) -- 0:00:21
636000 -- [-469.904] (-472.520) (-467.975) (-469.788) * (-468.486) (-469.275) (-469.219) [-468.749] -- 0:00:21
636500 -- [-469.178] (-472.298) (-468.459) (-469.570) * (-469.054) (-468.094) [-469.867] (-467.695) -- 0:00:21
637000 -- (-470.279) (-467.065) [-468.947] (-469.430) * (-469.212) [-471.638] (-473.997) (-469.558) -- 0:00:21
637500 -- (-468.762) [-467.488] (-469.385) (-467.328) * [-468.425] (-470.492) (-471.306) (-469.795) -- 0:00:21
638000 -- [-470.329] (-468.263) (-470.910) (-468.965) * [-469.693] (-471.337) (-470.709) (-469.608) -- 0:00:21
638500 -- [-469.953] (-470.082) (-470.941) (-467.838) * (-472.678) (-472.685) [-469.474] (-468.304) -- 0:00:22
639000 -- (-470.085) (-470.532) (-470.804) [-467.823] * [-476.013] (-476.700) (-469.811) (-471.937) -- 0:00:22
639500 -- [-467.704] (-470.743) (-468.796) (-470.396) * (-474.766) [-471.843] (-468.810) (-469.335) -- 0:00:21
640000 -- (-469.995) [-468.469] (-468.520) (-467.723) * (-475.707) (-469.291) (-472.597) [-469.837] -- 0:00:21
Average standard deviation of split frequencies: 0.007505
640500 -- (-467.998) (-469.946) [-468.160] (-468.864) * (-468.637) [-476.963] (-470.894) (-475.432) -- 0:00:21
641000 -- (-469.790) (-469.033) [-468.923] (-469.512) * (-472.918) (-470.965) [-470.954] (-470.269) -- 0:00:21
641500 -- [-468.007] (-471.138) (-469.032) (-468.129) * (-471.404) [-467.659] (-469.774) (-468.931) -- 0:00:21
642000 -- (-467.463) (-470.670) (-471.387) [-469.001] * (-468.441) (-467.289) (-469.915) [-468.318] -- 0:00:21
642500 -- (-468.478) (-471.153) [-468.525] (-468.587) * (-468.034) (-467.685) [-468.811] (-470.077) -- 0:00:21
643000 -- (-469.937) (-470.201) [-470.379] (-467.624) * [-469.225] (-475.185) (-468.267) (-470.764) -- 0:00:21
643500 -- (-469.427) (-467.333) (-468.678) [-467.092] * [-468.102] (-468.966) (-468.301) (-469.101) -- 0:00:21
644000 -- (-473.954) (-469.312) [-471.003] (-467.136) * [-467.389] (-468.723) (-468.132) (-468.661) -- 0:00:21
644500 -- (-471.021) [-468.140] (-467.992) (-469.399) * (-470.367) (-468.772) [-470.023] (-471.243) -- 0:00:21
645000 -- (-469.468) [-469.426] (-467.385) (-467.937) * (-471.746) (-468.817) (-467.445) [-473.240] -- 0:00:21
Average standard deviation of split frequencies: 0.006957
645500 -- (-470.796) [-469.632] (-472.782) (-467.021) * (-471.364) (-471.881) (-467.388) [-469.368] -- 0:00:21
646000 -- (-470.506) (-470.660) (-471.245) [-467.619] * [-471.406] (-471.012) (-468.511) (-469.838) -- 0:00:21
646500 -- (-468.046) [-471.387] (-470.014) (-469.717) * [-470.864] (-471.462) (-469.068) (-468.963) -- 0:00:21
647000 -- (-467.897) [-468.936] (-470.593) (-468.990) * (-472.129) (-468.885) [-470.279] (-469.185) -- 0:00:21
647500 -- (-472.545) [-467.838] (-470.489) (-467.603) * (-470.209) (-471.636) (-467.414) [-471.388] -- 0:00:21
648000 -- (-472.289) (-469.365) (-469.298) [-467.247] * [-468.473] (-467.494) (-470.237) (-469.009) -- 0:00:21
648500 -- (-471.266) (-468.973) [-472.236] (-468.675) * (-469.016) [-467.357] (-468.320) (-467.684) -- 0:00:21
649000 -- (-468.148) [-469.322] (-467.023) (-471.282) * (-471.107) (-472.046) [-467.812] (-469.598) -- 0:00:21
649500 -- (-468.018) [-467.766] (-469.463) (-472.696) * [-468.712] (-468.203) (-468.915) (-473.175) -- 0:00:21
650000 -- [-466.890] (-468.573) (-468.096) (-471.709) * (-467.516) [-468.934] (-470.536) (-479.056) -- 0:00:21
Average standard deviation of split frequencies: 0.007100
650500 -- (-468.557) (-470.333) [-470.564] (-471.706) * [-468.486] (-469.312) (-469.758) (-472.851) -- 0:00:20
651000 -- (-468.390) [-467.379] (-475.878) (-467.484) * (-467.949) [-469.666] (-473.609) (-471.436) -- 0:00:20
651500 -- (-469.968) (-469.164) [-469.310] (-468.090) * (-469.891) (-468.980) (-469.998) [-471.711] -- 0:00:20
652000 -- (-468.311) (-467.809) (-473.118) [-469.922] * (-472.603) (-467.801) [-471.546] (-468.981) -- 0:00:20
652500 -- (-467.457) (-468.979) (-470.979) [-469.719] * (-471.080) (-468.861) [-468.742] (-470.143) -- 0:00:20
653000 -- [-470.494] (-468.287) (-469.388) (-471.733) * (-469.866) (-472.472) (-469.192) [-469.610] -- 0:00:20
653500 -- [-467.181] (-469.964) (-470.259) (-468.685) * (-470.321) [-473.390] (-470.347) (-467.366) -- 0:00:20
654000 -- (-468.116) (-474.999) [-469.952] (-468.845) * (-471.079) (-469.627) (-468.759) [-468.199] -- 0:00:20
654500 -- (-470.597) [-469.914] (-468.072) (-471.785) * (-469.635) (-467.445) (-468.827) [-468.788] -- 0:00:20
655000 -- (-469.104) (-470.129) (-467.863) [-472.947] * [-467.598] (-468.697) (-470.113) (-471.461) -- 0:00:20
Average standard deviation of split frequencies: 0.007569
655500 -- [-468.464] (-468.076) (-468.433) (-467.293) * [-467.075] (-468.659) (-471.111) (-472.196) -- 0:00:21
656000 -- (-468.784) (-470.048) (-471.720) [-468.557] * [-469.390] (-471.578) (-471.964) (-469.992) -- 0:00:20
656500 -- (-469.366) [-469.404] (-468.813) (-468.283) * (-467.951) (-467.941) [-469.549] (-469.161) -- 0:00:20
657000 -- [-468.484] (-469.973) (-467.473) (-470.979) * (-470.729) (-470.295) [-470.246] (-468.838) -- 0:00:20
657500 -- [-468.340] (-468.719) (-467.584) (-472.869) * (-472.351) [-469.539] (-467.858) (-469.321) -- 0:00:20
658000 -- [-468.365] (-469.448) (-474.689) (-473.145) * (-468.265) (-471.372) (-472.556) [-470.216] -- 0:00:20
658500 -- [-469.830] (-471.493) (-470.804) (-471.061) * (-469.124) [-468.819] (-469.260) (-470.374) -- 0:00:20
659000 -- (-467.696) (-469.160) [-469.078] (-469.827) * (-468.716) (-470.354) [-468.576] (-471.679) -- 0:00:20
659500 -- (-466.993) [-467.543] (-469.113) (-469.708) * (-469.109) [-468.277] (-468.429) (-473.805) -- 0:00:20
660000 -- (-469.313) (-468.794) [-467.695] (-470.242) * (-471.698) (-467.619) (-471.041) [-467.277] -- 0:00:20
Average standard deviation of split frequencies: 0.007516
660500 -- (-469.774) (-468.602) [-469.017] (-472.111) * (-471.796) [-469.271] (-468.677) (-467.306) -- 0:00:20
661000 -- (-469.731) (-471.746) (-470.638) [-469.667] * (-467.671) [-473.402] (-472.193) (-468.057) -- 0:00:20
661500 -- (-472.325) (-469.288) (-467.271) [-469.197] * (-470.229) (-470.129) (-472.008) [-469.966] -- 0:00:20
662000 -- [-470.818] (-471.277) (-468.631) (-469.772) * (-470.310) (-469.515) [-468.415] (-472.581) -- 0:00:20
662500 -- (-471.688) [-470.360] (-468.779) (-468.336) * (-467.894) (-469.859) (-467.686) [-470.037] -- 0:00:20
663000 -- (-471.412) (-470.386) [-467.611] (-471.910) * (-468.880) (-471.131) [-467.672] (-470.979) -- 0:00:20
663500 -- (-469.683) [-468.749] (-468.241) (-471.653) * (-471.433) (-468.237) (-467.764) [-469.734] -- 0:00:20
664000 -- (-467.988) (-476.483) [-470.748] (-467.908) * [-468.125] (-469.081) (-467.330) (-468.329) -- 0:00:20
664500 -- (-468.548) [-468.180] (-468.692) (-467.898) * (-469.071) (-468.580) [-468.611] (-467.937) -- 0:00:20
665000 -- [-469.690] (-470.338) (-468.050) (-472.943) * (-470.063) [-467.971] (-468.537) (-469.955) -- 0:00:20
Average standard deviation of split frequencies: 0.007963
665500 -- [-471.255] (-468.048) (-471.822) (-472.170) * (-468.103) (-467.491) (-467.894) [-469.304] -- 0:00:20
666000 -- (-474.910) [-467.946] (-473.466) (-469.913) * [-467.513] (-467.499) (-469.874) (-468.830) -- 0:00:20
666500 -- (-472.379) [-472.138] (-467.537) (-467.391) * (-469.238) (-468.200) (-468.213) [-469.439] -- 0:00:20
667000 -- [-473.499] (-470.081) (-472.351) (-472.682) * (-468.400) (-472.839) (-467.722) [-468.145] -- 0:00:19
667500 -- (-467.964) (-469.928) (-468.466) [-471.568] * (-475.658) (-468.781) (-467.693) [-469.575] -- 0:00:19
668000 -- (-469.495) [-468.304] (-470.864) (-469.677) * (-469.844) (-468.212) (-468.419) [-470.901] -- 0:00:19
668500 -- [-468.206] (-469.863) (-471.186) (-469.352) * (-468.404) (-468.993) [-468.018] (-469.371) -- 0:00:19
669000 -- [-467.124] (-470.749) (-468.329) (-468.414) * [-475.943] (-469.533) (-468.226) (-467.906) -- 0:00:19
669500 -- (-468.775) (-471.078) (-467.607) [-469.696] * [-474.177] (-469.914) (-472.225) (-472.563) -- 0:00:19
670000 -- [-472.020] (-468.622) (-468.544) (-467.492) * [-471.624] (-468.231) (-472.917) (-468.864) -- 0:00:19
Average standard deviation of split frequencies: 0.008479
670500 -- (-469.616) (-471.511) [-468.475] (-470.454) * [-468.949] (-472.315) (-469.465) (-468.430) -- 0:00:19
671000 -- (-467.564) [-472.298] (-471.401) (-468.684) * (-470.962) (-467.096) [-467.627] (-471.560) -- 0:00:19
671500 -- (-467.687) (-468.917) [-468.370] (-468.820) * (-471.223) (-469.274) [-469.897] (-468.083) -- 0:00:19
672000 -- (-467.636) (-469.952) (-471.592) [-468.559] * (-469.646) (-469.813) (-472.437) [-467.054] -- 0:00:19
672500 -- (-468.571) [-469.615] (-468.618) (-468.480) * (-468.696) (-471.627) (-469.474) [-469.718] -- 0:00:19
673000 -- (-467.710) (-468.455) [-468.619] (-468.080) * (-468.350) (-468.123) [-467.871] (-470.707) -- 0:00:19
673500 -- [-467.572] (-468.214) (-468.192) (-467.568) * (-467.245) (-468.644) (-470.502) [-472.751] -- 0:00:19
674000 -- [-468.751] (-467.427) (-468.727) (-471.242) * [-468.476] (-470.632) (-467.709) (-467.955) -- 0:00:19
674500 -- (-470.052) (-467.998) [-467.430] (-471.270) * [-467.350] (-471.210) (-471.717) (-473.334) -- 0:00:19
675000 -- [-469.494] (-468.194) (-468.215) (-470.572) * (-469.189) (-469.220) (-468.660) [-467.933] -- 0:00:19
Average standard deviation of split frequencies: 0.008978
675500 -- [-468.408] (-467.523) (-469.296) (-471.446) * (-468.303) (-473.987) [-469.271] (-472.770) -- 0:00:19
676000 -- (-470.599) (-469.856) [-470.866] (-468.423) * [-469.427] (-470.770) (-469.437) (-476.526) -- 0:00:19
676500 -- (-469.549) [-470.747] (-470.755) (-472.658) * (-472.772) [-470.488] (-470.758) (-468.856) -- 0:00:19
677000 -- (-469.734) (-472.534) (-468.844) [-467.894] * (-471.816) (-469.618) (-473.451) [-468.015] -- 0:00:19
677500 -- (-469.067) (-472.287) [-468.222] (-470.123) * (-467.841) (-472.542) (-471.824) [-467.450] -- 0:00:19
678000 -- (-469.723) (-470.400) [-469.677] (-473.350) * (-467.929) [-469.013] (-468.585) (-473.836) -- 0:00:19
678500 -- (-468.592) [-470.441] (-471.141) (-470.868) * [-468.172] (-468.656) (-470.286) (-467.357) -- 0:00:19
679000 -- (-469.588) [-468.736] (-470.845) (-467.745) * (-472.393) [-467.725] (-468.633) (-470.879) -- 0:00:19
679500 -- (-469.491) [-469.748] (-468.604) (-467.757) * (-471.382) [-468.376] (-469.868) (-468.330) -- 0:00:19
680000 -- [-469.202] (-467.599) (-470.042) (-471.087) * (-469.092) (-467.774) (-468.676) [-467.254] -- 0:00:19
Average standard deviation of split frequencies: 0.009090
680500 -- (-469.673) (-469.974) (-472.736) [-467.237] * (-471.891) (-470.001) (-469.322) [-470.616] -- 0:00:19
681000 -- (-469.739) (-470.825) [-470.082] (-467.760) * (-468.049) [-468.470] (-468.413) (-468.957) -- 0:00:19
681500 -- (-467.879) [-470.140] (-469.771) (-467.008) * [-469.945] (-467.675) (-468.786) (-470.017) -- 0:00:19
682000 -- (-467.957) [-468.716] (-471.021) (-469.743) * (-470.757) (-468.909) [-469.717] (-471.675) -- 0:00:19
682500 -- [-467.657] (-470.490) (-469.939) (-472.121) * (-468.563) (-470.438) [-468.653] (-470.855) -- 0:00:19
683000 -- (-471.142) [-475.469] (-469.580) (-466.976) * (-468.116) (-467.966) [-467.646] (-468.598) -- 0:00:19
683500 -- (-470.230) [-468.413] (-471.978) (-471.067) * [-471.675] (-469.146) (-470.664) (-472.097) -- 0:00:18
684000 -- [-469.289] (-468.468) (-473.402) (-469.690) * (-471.173) (-468.219) [-470.457] (-468.406) -- 0:00:18
684500 -- (-469.446) (-470.392) (-469.336) [-469.170] * (-471.807) (-473.174) (-468.619) [-468.800] -- 0:00:18
685000 -- (-468.003) [-468.367] (-467.384) (-468.200) * (-474.617) (-469.800) [-470.270] (-468.162) -- 0:00:18
Average standard deviation of split frequencies: 0.008676
685500 -- (-474.714) (-467.812) (-469.105) [-468.683] * (-471.092) [-469.000] (-467.674) (-468.460) -- 0:00:18
686000 -- (-469.966) (-467.824) (-474.166) [-468.881] * (-467.389) (-468.906) (-471.251) [-467.582] -- 0:00:18
686500 -- (-470.176) (-468.432) (-470.787) [-470.206] * (-471.893) (-467.547) (-468.565) [-468.819] -- 0:00:18
687000 -- (-470.781) [-468.334] (-468.702) (-470.939) * (-468.714) (-470.530) (-469.098) [-470.748] -- 0:00:18
687500 -- (-469.914) [-472.899] (-469.751) (-468.412) * (-467.956) (-470.784) [-470.556] (-467.835) -- 0:00:18
688000 -- (-468.433) [-470.738] (-469.082) (-469.830) * (-468.490) [-468.297] (-467.128) (-468.152) -- 0:00:18
688500 -- (-471.534) [-468.282] (-468.960) (-468.930) * (-468.233) [-471.225] (-467.375) (-468.435) -- 0:00:18
689000 -- [-471.692] (-470.812) (-467.147) (-468.834) * [-469.968] (-476.610) (-469.603) (-470.044) -- 0:00:18
689500 -- (-469.792) (-467.986) [-467.488] (-475.548) * [-468.995] (-468.019) (-468.497) (-467.452) -- 0:00:18
690000 -- (-467.601) (-472.204) (-467.762) [-471.102] * [-470.693] (-470.758) (-468.818) (-470.587) -- 0:00:18
Average standard deviation of split frequencies: 0.009129
690500 -- [-467.749] (-469.045) (-470.310) (-467.962) * [-467.285] (-470.015) (-471.926) (-467.649) -- 0:00:18
691000 -- (-471.815) (-470.457) [-468.827] (-470.410) * (-468.957) (-468.021) (-472.078) [-472.837] -- 0:00:18
691500 -- (-478.911) (-467.907) [-470.173] (-470.471) * (-467.913) (-472.072) [-469.324] (-468.801) -- 0:00:18
692000 -- [-469.430] (-472.509) (-468.220) (-471.429) * (-468.736) (-470.605) (-469.963) [-470.328] -- 0:00:18
692500 -- (-471.512) (-467.756) [-467.093] (-471.021) * (-467.674) (-469.319) [-479.745] (-467.833) -- 0:00:18
693000 -- (-470.792) [-467.364] (-468.125) (-472.943) * (-467.924) (-469.110) (-476.617) [-467.657] -- 0:00:18
693500 -- (-472.724) [-467.471] (-467.351) (-470.999) * [-469.022] (-468.998) (-468.825) (-467.329) -- 0:00:18
694000 -- [-470.193] (-471.210) (-467.115) (-469.638) * (-469.521) [-473.034] (-470.727) (-468.162) -- 0:00:18
694500 -- (-468.782) (-469.586) [-467.017] (-467.614) * (-471.492) (-470.305) [-469.187] (-468.750) -- 0:00:18
695000 -- [-469.787] (-468.241) (-468.327) (-467.478) * (-467.862) (-469.478) [-467.510] (-471.775) -- 0:00:18
Average standard deviation of split frequencies: 0.009355
695500 -- [-469.517] (-471.791) (-468.295) (-469.333) * (-471.654) (-471.314) [-468.141] (-469.535) -- 0:00:18
696000 -- (-468.393) (-472.637) [-467.927] (-470.621) * [-470.490] (-467.624) (-468.414) (-468.749) -- 0:00:18
696500 -- [-468.183] (-468.158) (-475.757) (-471.521) * (-469.879) (-469.668) [-468.811] (-469.233) -- 0:00:18
697000 -- (-468.619) (-467.685) [-471.131] (-468.112) * (-469.408) (-468.836) [-469.386] (-469.972) -- 0:00:18
697500 -- (-471.840) [-468.112] (-474.246) (-468.065) * (-469.431) [-467.823] (-473.004) (-468.517) -- 0:00:18
698000 -- [-470.841] (-470.406) (-468.876) (-467.437) * [-472.817] (-467.551) (-469.445) (-469.152) -- 0:00:18
698500 -- (-475.384) (-470.776) (-468.104) [-468.370] * [-467.732] (-470.779) (-472.518) (-467.613) -- 0:00:18
699000 -- (-469.427) (-469.588) [-467.623] (-468.376) * (-469.763) [-469.571] (-477.866) (-468.272) -- 0:00:18
699500 -- (-467.532) (-469.194) (-473.102) [-467.851] * [-468.467] (-468.247) (-470.093) (-469.322) -- 0:00:18
700000 -- (-469.238) (-467.735) [-468.089] (-469.681) * (-470.089) (-467.727) [-470.233] (-469.162) -- 0:00:18
Average standard deviation of split frequencies: 0.009882
700500 -- (-471.252) (-469.026) [-469.299] (-469.656) * (-468.676) [-469.601] (-471.581) (-468.543) -- 0:00:17
701000 -- (-470.123) [-468.853] (-467.713) (-469.753) * (-468.239) [-468.689] (-470.350) (-471.604) -- 0:00:17
701500 -- (-467.110) (-469.821) (-468.595) [-469.076] * (-471.867) (-470.546) (-468.603) [-473.675] -- 0:00:17
702000 -- (-468.531) (-468.569) [-469.433] (-472.784) * (-471.333) [-468.240] (-469.191) (-468.756) -- 0:00:17
702500 -- [-468.581] (-468.816) (-468.462) (-468.260) * (-469.650) (-471.517) (-472.068) [-472.210] -- 0:00:17
703000 -- (-468.555) [-471.130] (-470.645) (-468.417) * (-468.646) (-468.495) [-472.395] (-467.420) -- 0:00:17
703500 -- [-467.578] (-467.495) (-471.984) (-468.763) * (-470.553) (-467.483) (-468.251) [-468.915] -- 0:00:17
704000 -- (-467.529) (-472.984) (-467.378) [-468.814] * [-466.963] (-470.499) (-470.387) (-470.048) -- 0:00:17
704500 -- (-472.579) (-471.648) [-471.210] (-471.631) * (-472.597) (-471.983) (-470.327) [-469.998] -- 0:00:17
705000 -- [-468.682] (-472.671) (-474.657) (-467.419) * (-472.119) (-470.703) (-470.576) [-469.185] -- 0:00:17
Average standard deviation of split frequencies: 0.009265
705500 -- (-469.675) (-468.606) (-473.335) [-467.284] * (-470.561) (-469.198) (-470.253) [-473.735] -- 0:00:17
706000 -- (-469.265) [-467.761] (-470.599) (-468.579) * (-468.655) (-468.486) (-467.786) [-468.354] -- 0:00:17
706500 -- (-470.182) [-467.245] (-468.984) (-470.114) * (-470.072) [-468.812] (-469.099) (-468.308) -- 0:00:17
707000 -- (-468.901) (-468.859) [-468.434] (-469.944) * [-469.304] (-467.992) (-470.373) (-467.865) -- 0:00:17
707500 -- (-470.133) (-470.886) [-469.195] (-468.757) * [-468.861] (-467.644) (-469.785) (-467.732) -- 0:00:17
708000 -- [-471.371] (-470.854) (-467.989) (-468.188) * (-471.561) (-471.431) [-471.211] (-472.785) -- 0:00:17
708500 -- (-469.796) (-468.851) [-467.326] (-469.553) * (-468.834) [-471.601] (-471.622) (-470.916) -- 0:00:17
709000 -- (-469.280) (-470.902) (-467.720) [-467.585] * (-469.575) (-471.053) (-470.383) [-471.151] -- 0:00:17
709500 -- (-469.279) [-469.335] (-470.885) (-467.569) * [-468.778] (-468.719) (-468.429) (-468.185) -- 0:00:17
710000 -- (-468.856) (-469.129) (-475.136) [-469.683] * (-467.754) (-469.405) (-467.811) [-467.707] -- 0:00:17
Average standard deviation of split frequencies: 0.009287
710500 -- (-473.618) (-468.440) [-476.738] (-469.932) * (-469.282) [-468.583] (-471.768) (-470.668) -- 0:00:17
711000 -- (-470.540) (-472.224) (-475.157) [-469.743] * (-470.367) (-468.425) (-469.746) [-469.477] -- 0:00:17
711500 -- (-472.107) (-467.968) (-477.737) [-468.606] * (-476.403) (-468.267) (-469.554) [-469.769] -- 0:00:17
712000 -- (-470.335) [-470.760] (-471.802) (-469.135) * (-473.237) (-469.275) [-471.186] (-468.219) -- 0:00:17
712500 -- [-468.891] (-469.730) (-472.809) (-469.916) * (-468.781) (-468.594) (-469.732) [-467.617] -- 0:00:17
713000 -- (-468.443) (-467.862) (-470.817) [-470.300] * (-467.013) (-469.051) (-473.024) [-468.333] -- 0:00:17
713500 -- (-469.522) (-468.083) [-470.015] (-469.318) * (-468.956) (-468.231) [-471.139] (-470.449) -- 0:00:17
714000 -- (-472.088) (-470.008) (-467.828) [-472.739] * [-470.024] (-467.645) (-467.994) (-471.959) -- 0:00:17
714500 -- (-469.824) (-469.479) [-471.196] (-471.726) * (-471.845) (-469.872) (-468.356) [-471.918] -- 0:00:17
715000 -- [-472.326] (-469.809) (-473.784) (-470.862) * [-476.068] (-469.606) (-469.764) (-472.650) -- 0:00:17
Average standard deviation of split frequencies: 0.008436
715500 -- [-469.804] (-472.365) (-467.541) (-467.797) * (-471.853) (-470.578) [-469.223] (-470.026) -- 0:00:17
716000 -- (-467.750) (-469.313) (-467.209) [-467.641] * (-467.772) (-468.795) [-469.243] (-470.369) -- 0:00:17
716500 -- (-468.901) (-472.318) (-467.788) [-467.430] * (-471.213) (-470.086) (-468.381) [-467.569] -- 0:00:17
717000 -- [-468.802] (-469.588) (-472.386) (-469.178) * (-469.258) (-471.727) [-470.215] (-469.968) -- 0:00:16
717500 -- [-468.356] (-470.478) (-472.481) (-470.016) * (-467.770) (-467.864) (-469.218) [-472.072] -- 0:00:16
718000 -- [-467.513] (-472.268) (-469.919) (-469.892) * (-468.491) (-469.243) (-467.405) [-469.761] -- 0:00:16
718500 -- (-470.573) [-468.063] (-471.603) (-467.987) * (-469.749) (-467.986) [-468.520] (-470.855) -- 0:00:16
719000 -- (-473.144) (-471.574) [-468.145] (-467.751) * (-468.904) [-468.077] (-468.635) (-469.425) -- 0:00:16
719500 -- [-468.672] (-470.308) (-470.995) (-469.063) * [-467.922] (-469.919) (-471.774) (-470.871) -- 0:00:16
720000 -- (-467.259) (-469.382) [-470.431] (-470.006) * (-468.772) [-470.215] (-468.366) (-469.056) -- 0:00:16
Average standard deviation of split frequencies: 0.007686
720500 -- (-467.593) (-471.007) (-471.439) [-469.828] * (-472.456) (-474.219) [-467.660] (-470.754) -- 0:00:16
721000 -- (-468.458) [-470.015] (-469.672) (-470.798) * (-471.870) [-470.929] (-470.224) (-470.408) -- 0:00:16
721500 -- (-468.362) [-468.326] (-468.226) (-469.194) * [-468.607] (-468.207) (-467.458) (-470.477) -- 0:00:16
722000 -- (-469.062) (-469.157) [-470.534] (-469.498) * (-469.791) [-468.275] (-468.671) (-469.009) -- 0:00:16
722500 -- [-467.593] (-468.177) (-470.261) (-469.316) * (-471.898) (-470.531) (-469.645) [-471.598] -- 0:00:16
723000 -- (-468.715) (-468.206) (-470.726) [-471.458] * (-468.014) [-468.848] (-474.433) (-471.330) -- 0:00:16
723500 -- [-471.904] (-472.752) (-470.705) (-472.118) * [-471.733] (-473.554) (-476.754) (-471.466) -- 0:00:16
724000 -- (-470.158) (-468.823) [-468.434] (-469.040) * (-468.816) (-468.882) (-468.707) [-467.321] -- 0:00:16
724500 -- (-469.417) (-470.398) (-467.536) [-467.299] * [-467.999] (-468.310) (-467.919) (-467.157) -- 0:00:16
725000 -- (-469.423) (-468.102) (-468.067) [-469.259] * (-468.047) (-467.306) [-468.999] (-469.496) -- 0:00:16
Average standard deviation of split frequencies: 0.007629
725500 -- (-467.795) (-468.272) (-469.112) [-471.000] * (-470.769) [-467.170] (-469.656) (-468.437) -- 0:00:16
726000 -- (-468.510) [-467.005] (-470.324) (-469.221) * (-470.775) (-470.982) (-470.111) [-467.428] -- 0:00:16
726500 -- (-468.565) (-471.046) [-468.903] (-467.355) * (-473.599) (-474.091) (-469.376) [-467.882] -- 0:00:16
727000 -- (-468.190) [-468.085] (-467.521) (-468.658) * (-467.982) (-469.279) (-468.824) [-467.928] -- 0:00:16
727500 -- (-471.212) [-472.361] (-468.115) (-468.216) * [-471.149] (-476.889) (-470.194) (-467.966) -- 0:00:16
728000 -- (-467.726) (-468.320) (-472.960) [-470.122] * [-471.235] (-470.477) (-472.565) (-468.531) -- 0:00:16
728500 -- (-469.822) (-469.536) (-469.515) [-467.954] * [-470.922] (-471.173) (-469.501) (-467.718) -- 0:00:16
729000 -- (-467.449) (-468.502) (-469.457) [-468.443] * [-469.997] (-472.168) (-470.042) (-468.058) -- 0:00:16
729500 -- (-468.939) (-472.618) [-470.083] (-470.343) * (-470.612) (-468.034) [-467.177] (-470.095) -- 0:00:16
730000 -- (-468.736) (-469.725) [-468.970] (-471.112) * (-471.989) (-467.703) (-467.286) [-468.654] -- 0:00:16
Average standard deviation of split frequencies: 0.007782
730500 -- (-468.747) [-468.421] (-468.020) (-471.516) * [-470.140] (-469.902) (-468.272) (-467.806) -- 0:00:16
731000 -- (-468.127) (-468.946) (-468.079) [-471.390] * [-469.708] (-468.317) (-468.430) (-474.562) -- 0:00:16
731500 -- (-468.859) (-467.337) [-470.291] (-469.755) * (-467.362) (-470.202) (-468.943) [-472.354] -- 0:00:16
732000 -- (-468.191) (-467.987) [-468.600] (-469.035) * (-468.301) [-472.400] (-472.624) (-471.654) -- 0:00:16
732500 -- (-468.884) (-467.858) (-474.129) [-468.342] * [-468.209] (-470.030) (-470.703) (-472.725) -- 0:00:16
733000 -- (-469.099) (-467.473) [-469.498] (-467.880) * (-468.349) (-467.936) (-468.752) [-469.023] -- 0:00:16
733500 -- (-468.368) (-467.580) [-470.199] (-468.046) * (-470.448) (-468.845) [-468.510] (-469.055) -- 0:00:15
734000 -- (-467.997) (-468.108) [-468.738] (-468.156) * (-469.592) (-467.821) [-471.718] (-468.175) -- 0:00:15
734500 -- [-467.764] (-469.036) (-468.631) (-468.887) * (-471.602) (-468.543) [-468.105] (-468.489) -- 0:00:15
735000 -- (-468.071) (-473.177) (-474.235) [-468.017] * (-471.045) (-467.795) (-467.747) [-468.990] -- 0:00:15
Average standard deviation of split frequencies: 0.007886
735500 -- [-468.225] (-473.787) (-470.194) (-468.707) * (-470.498) [-470.158] (-468.408) (-474.108) -- 0:00:15
736000 -- [-470.855] (-471.686) (-467.512) (-467.772) * (-470.044) (-468.596) (-469.524) [-469.610] -- 0:00:15
736500 -- [-468.184] (-474.794) (-467.544) (-467.325) * (-468.195) (-468.470) [-469.101] (-469.347) -- 0:00:15
737000 -- [-468.443] (-473.008) (-467.674) (-467.761) * [-469.228] (-468.961) (-467.299) (-470.623) -- 0:00:15
737500 -- [-468.334] (-467.396) (-470.644) (-468.536) * (-471.175) (-468.383) [-470.945] (-469.175) -- 0:00:15
738000 -- [-468.919] (-469.373) (-468.171) (-470.442) * (-471.328) (-467.730) [-469.931] (-470.404) -- 0:00:15
738500 -- [-468.689] (-469.326) (-472.906) (-472.446) * (-470.006) [-468.860] (-470.664) (-467.747) -- 0:00:15
739000 -- (-468.844) (-469.955) (-471.293) [-471.299] * (-470.591) [-469.450] (-469.853) (-467.102) -- 0:00:15
739500 -- (-469.369) (-468.269) [-474.404] (-473.536) * (-469.235) [-468.575] (-467.576) (-472.289) -- 0:00:15
740000 -- (-471.468) (-474.128) (-473.010) [-468.402] * (-468.129) (-468.106) (-469.396) [-469.534] -- 0:00:15
Average standard deviation of split frequencies: 0.007996
740500 -- (-468.941) (-470.247) [-467.086] (-468.133) * (-467.927) (-470.204) (-471.252) [-470.844] -- 0:00:15
741000 -- [-471.983] (-468.006) (-467.576) (-469.815) * (-471.767) (-471.400) (-471.461) [-471.938] -- 0:00:15
741500 -- (-469.505) (-468.295) (-469.864) [-468.971] * [-469.301] (-470.362) (-468.337) (-469.633) -- 0:00:15
742000 -- (-469.444) (-471.597) [-471.185] (-468.440) * [-468.662] (-469.533) (-471.595) (-469.495) -- 0:00:15
742500 -- (-467.486) (-469.585) (-468.590) [-468.268] * [-474.633] (-470.836) (-469.347) (-470.438) -- 0:00:15
743000 -- (-469.162) (-468.000) (-469.777) [-467.443] * (-468.785) [-470.021] (-468.295) (-469.316) -- 0:00:15
743500 -- (-472.478) (-473.017) (-469.351) [-469.558] * (-468.758) [-468.087] (-471.300) (-473.517) -- 0:00:15
744000 -- (-470.057) (-469.098) [-470.396] (-476.214) * (-468.268) [-470.276] (-468.118) (-469.170) -- 0:00:15
744500 -- [-468.513] (-468.477) (-479.589) (-470.131) * (-467.370) (-468.040) [-468.916] (-470.931) -- 0:00:15
745000 -- [-474.427] (-468.557) (-477.496) (-471.706) * [-468.821] (-468.768) (-473.045) (-470.917) -- 0:00:15
Average standard deviation of split frequencies: 0.008257
745500 -- (-473.664) (-468.590) (-471.410) [-468.106] * (-468.662) [-470.799] (-467.758) (-473.870) -- 0:00:15
746000 -- [-472.023] (-468.371) (-468.085) (-468.557) * [-471.525] (-468.211) (-467.494) (-476.693) -- 0:00:15
746500 -- (-468.495) (-470.620) [-468.795] (-468.940) * (-468.466) [-469.271] (-467.932) (-469.963) -- 0:00:15
747000 -- [-468.442] (-473.785) (-469.573) (-472.214) * (-469.634) (-470.265) (-467.778) [-469.141] -- 0:00:15
747500 -- [-469.059] (-471.523) (-468.013) (-469.159) * (-469.034) (-468.377) (-468.845) [-469.724] -- 0:00:15
748000 -- (-468.989) (-473.402) (-468.344) [-468.568] * [-468.977] (-467.149) (-467.550) (-467.861) -- 0:00:15
748500 -- (-468.116) [-469.348] (-471.959) (-468.525) * [-472.568] (-468.335) (-471.509) (-473.882) -- 0:00:15
749000 -- (-467.995) (-468.327) (-468.722) [-468.637] * [-467.372] (-469.034) (-470.051) (-467.233) -- 0:00:15
749500 -- (-477.936) [-468.656] (-471.267) (-469.248) * (-470.952) [-469.582] (-468.652) (-466.908) -- 0:00:15
750000 -- (-469.325) (-468.515) [-469.294] (-471.047) * [-469.895] (-469.222) (-469.294) (-468.525) -- 0:00:15
Average standard deviation of split frequencies: 0.008415
750500 -- (-468.970) (-469.951) [-471.506] (-469.735) * (-472.960) (-467.794) [-469.309] (-467.739) -- 0:00:14
751000 -- [-467.855] (-472.094) (-471.274) (-472.902) * (-469.601) [-471.833] (-467.500) (-468.485) -- 0:00:14
751500 -- [-470.748] (-468.552) (-470.433) (-474.153) * (-468.738) (-467.580) (-471.895) [-467.979] -- 0:00:14
752000 -- (-467.705) (-469.982) [-468.641] (-469.764) * [-468.189] (-469.630) (-471.042) (-470.734) -- 0:00:14
752500 -- (-469.225) (-469.885) [-474.167] (-469.537) * (-469.308) [-469.381] (-473.859) (-469.478) -- 0:00:14
753000 -- (-472.489) [-470.840] (-468.550) (-470.583) * [-476.226] (-470.015) (-470.630) (-467.608) -- 0:00:14
753500 -- (-470.036) [-469.888] (-467.288) (-471.223) * (-468.334) [-467.626] (-469.020) (-470.086) -- 0:00:14
754000 -- (-472.722) (-470.049) [-468.686] (-472.411) * [-467.753] (-468.224) (-468.846) (-469.082) -- 0:00:14
754500 -- (-471.719) (-468.907) [-467.920] (-468.291) * [-468.534] (-467.860) (-469.906) (-468.293) -- 0:00:14
755000 -- [-467.463] (-468.797) (-467.233) (-467.793) * (-467.833) [-470.768] (-469.845) (-475.756) -- 0:00:14
Average standard deviation of split frequencies: 0.007981
755500 -- (-471.145) (-468.288) [-469.459] (-469.275) * (-468.722) (-469.925) [-472.573] (-469.087) -- 0:00:14
756000 -- (-469.779) (-469.831) (-469.530) [-468.126] * (-469.112) (-470.533) [-469.989] (-469.357) -- 0:00:14
756500 -- [-468.355] (-472.538) (-469.393) (-467.675) * (-468.803) [-472.589] (-468.474) (-470.236) -- 0:00:14
757000 -- (-470.450) [-469.735] (-470.551) (-468.671) * (-470.666) (-472.372) [-470.457] (-468.145) -- 0:00:14
757500 -- [-470.274] (-467.998) (-473.723) (-468.287) * (-471.052) (-472.028) (-469.683) [-467.649] -- 0:00:14
758000 -- (-468.717) (-470.305) [-469.176] (-469.696) * (-467.750) [-468.402] (-467.678) (-468.226) -- 0:00:14
758500 -- (-469.826) [-469.061] (-474.893) (-468.594) * (-467.131) (-472.072) [-468.675] (-469.157) -- 0:00:14
759000 -- (-470.091) (-470.869) (-468.700) [-473.017] * (-467.452) (-468.249) (-468.096) [-467.359] -- 0:00:14
759500 -- [-473.697] (-470.191) (-468.171) (-473.666) * (-468.548) (-467.675) [-467.996] (-467.845) -- 0:00:14
760000 -- (-470.062) (-470.104) [-471.743] (-472.174) * (-469.462) (-467.872) [-468.055] (-467.402) -- 0:00:14
Average standard deviation of split frequencies: 0.008304
760500 -- (-469.266) [-468.336] (-468.032) (-468.185) * [-470.743] (-469.096) (-469.716) (-469.154) -- 0:00:14
761000 -- [-470.098] (-467.971) (-468.145) (-468.709) * (-469.242) (-467.233) (-468.226) [-467.815] -- 0:00:14
761500 -- (-467.836) (-469.456) (-471.122) [-468.038] * (-470.223) [-469.308] (-470.225) (-469.174) -- 0:00:14
762000 -- [-467.677] (-474.715) (-468.353) (-470.124) * [-469.232] (-472.114) (-469.998) (-469.213) -- 0:00:14
762500 -- [-472.126] (-471.120) (-468.259) (-472.515) * (-469.704) (-474.941) [-469.473] (-469.794) -- 0:00:14
763000 -- (-468.923) [-468.122] (-469.684) (-469.655) * (-471.152) [-471.533] (-469.959) (-468.020) -- 0:00:14
763500 -- (-467.657) (-467.599) (-469.250) [-469.393] * (-469.821) (-468.649) (-469.065) [-468.601] -- 0:00:14
764000 -- (-468.779) (-469.628) [-468.606] (-474.608) * (-470.137) (-467.961) [-469.820] (-467.628) -- 0:00:14
764500 -- (-470.720) [-467.876] (-469.436) (-470.052) * (-471.314) (-472.390) [-469.354] (-468.566) -- 0:00:14
765000 -- [-470.324] (-468.833) (-470.850) (-470.424) * [-468.984] (-471.912) (-468.300) (-475.296) -- 0:00:14
Average standard deviation of split frequencies: 0.008205
765500 -- (-470.437) [-468.981] (-470.020) (-468.315) * [-467.898] (-468.960) (-473.414) (-470.312) -- 0:00:14
766000 -- (-474.139) (-467.941) (-468.962) [-472.270] * (-469.192) (-470.078) [-469.933] (-469.650) -- 0:00:14
766500 -- (-468.389) (-469.396) (-468.874) [-469.355] * (-468.415) (-472.567) [-469.827] (-471.962) -- 0:00:14
767000 -- [-471.918] (-469.287) (-471.559) (-469.438) * (-469.463) [-471.021] (-468.254) (-469.967) -- 0:00:13
767500 -- (-468.222) (-470.097) [-470.024] (-468.678) * [-470.524] (-472.112) (-470.179) (-468.222) -- 0:00:13
768000 -- (-469.101) (-476.192) (-468.216) [-468.388] * (-468.946) [-470.448] (-468.272) (-468.346) -- 0:00:13
768500 -- (-475.804) (-468.687) (-468.299) [-467.236] * (-469.098) (-471.347) (-467.730) [-468.597] -- 0:00:13
769000 -- (-469.658) (-467.206) [-468.302] (-468.040) * (-470.083) (-470.661) [-468.926] (-470.233) -- 0:00:13
769500 -- (-470.100) [-469.142] (-468.697) (-467.419) * (-470.414) (-472.512) (-469.312) [-469.737] -- 0:00:13
770000 -- [-467.920] (-468.910) (-468.342) (-471.133) * [-468.995] (-468.804) (-467.745) (-471.034) -- 0:00:13
Average standard deviation of split frequencies: 0.008604
770500 -- (-468.317) (-473.076) (-470.318) [-467.719] * (-471.539) (-472.280) (-468.431) [-470.882] -- 0:00:13
771000 -- (-468.573) (-468.400) [-468.707] (-468.562) * (-470.589) (-470.596) (-470.702) [-471.374] -- 0:00:13
771500 -- (-470.703) (-470.317) (-469.275) [-471.053] * [-467.995] (-472.198) (-467.751) (-476.202) -- 0:00:13
772000 -- (-468.523) [-472.329] (-468.671) (-468.767) * [-468.147] (-471.020) (-471.632) (-475.549) -- 0:00:13
772500 -- (-467.773) (-469.536) (-468.182) [-468.388] * (-468.592) (-467.951) (-468.671) [-470.817] -- 0:00:13
773000 -- (-469.517) (-469.901) (-471.335) [-469.784] * (-468.639) [-468.891] (-474.252) (-468.207) -- 0:00:13
773500 -- (-470.657) [-472.981] (-467.480) (-471.426) * [-469.483] (-470.724) (-470.797) (-469.560) -- 0:00:13
774000 -- (-470.308) (-474.845) [-472.569] (-473.372) * (-469.562) (-468.510) (-472.518) [-468.746] -- 0:00:13
774500 -- (-470.784) [-475.013] (-471.145) (-470.513) * (-472.265) (-468.220) [-473.201] (-470.694) -- 0:00:13
775000 -- (-473.287) (-469.183) [-468.727] (-467.998) * (-470.380) (-468.105) [-470.823] (-469.186) -- 0:00:13
Average standard deviation of split frequencies: 0.008748
775500 -- (-469.635) (-472.719) (-467.277) [-468.254] * [-467.598] (-470.673) (-468.994) (-469.097) -- 0:00:13
776000 -- (-467.621) (-471.816) (-467.920) [-468.195] * [-467.925] (-469.279) (-467.861) (-468.958) -- 0:00:13
776500 -- (-469.230) (-470.460) [-467.631] (-469.655) * [-469.253] (-470.878) (-468.410) (-471.438) -- 0:00:13
777000 -- [-468.647] (-469.663) (-468.123) (-469.355) * [-471.575] (-470.681) (-471.615) (-470.056) -- 0:00:13
777500 -- [-468.430] (-471.068) (-467.695) (-469.057) * (-467.122) (-474.784) [-470.780] (-470.140) -- 0:00:13
778000 -- (-468.213) (-470.809) [-472.134] (-469.798) * [-467.594] (-470.643) (-469.191) (-469.627) -- 0:00:13
778500 -- [-468.575] (-468.048) (-469.376) (-470.165) * (-468.719) [-471.997] (-469.514) (-467.397) -- 0:00:13
779000 -- (-468.631) [-468.891] (-472.430) (-468.399) * (-468.318) (-472.106) (-468.724) [-467.845] -- 0:00:13
779500 -- (-468.076) [-470.729] (-468.088) (-469.433) * (-468.679) (-470.308) [-469.457] (-468.335) -- 0:00:13
780000 -- (-469.852) (-470.490) [-470.472] (-472.459) * (-468.648) (-468.745) [-468.486] (-475.383) -- 0:00:13
Average standard deviation of split frequencies: 0.008494
780500 -- [-471.114] (-470.156) (-472.373) (-472.142) * [-469.206] (-469.981) (-468.322) (-467.738) -- 0:00:13
781000 -- (-471.456) (-471.633) [-471.916] (-470.687) * [-468.444] (-470.122) (-470.391) (-468.253) -- 0:00:13
781500 -- [-470.342] (-468.635) (-470.544) (-469.892) * (-468.297) (-468.903) [-469.482] (-468.325) -- 0:00:13
782000 -- (-470.387) (-469.757) [-468.079] (-468.600) * (-469.071) (-470.803) [-473.620] (-467.836) -- 0:00:13
782500 -- (-468.094) [-470.330] (-473.118) (-469.421) * [-468.434] (-469.694) (-469.767) (-468.764) -- 0:00:13
783000 -- [-469.065] (-468.741) (-470.744) (-468.764) * [-468.725] (-470.656) (-467.605) (-468.810) -- 0:00:13
783500 -- [-467.420] (-468.485) (-468.801) (-469.887) * (-468.801) (-473.466) (-467.826) [-469.844] -- 0:00:12
784000 -- (-469.941) (-468.102) (-469.511) [-469.306] * (-472.282) (-467.244) [-468.293] (-469.835) -- 0:00:12
784500 -- (-469.608) [-467.940] (-473.984) (-473.658) * [-469.246] (-468.462) (-468.617) (-474.494) -- 0:00:12
785000 -- (-471.910) (-471.015) [-468.157] (-468.929) * (-469.682) [-468.300] (-468.919) (-471.255) -- 0:00:12
Average standard deviation of split frequencies: 0.008397
785500 -- (-468.146) (-469.041) (-472.542) [-468.664] * [-468.591] (-468.163) (-469.436) (-468.655) -- 0:00:12
786000 -- (-467.648) (-468.683) [-472.586] (-468.271) * (-469.409) (-468.849) [-474.830] (-469.840) -- 0:00:12
786500 -- (-469.645) [-468.599] (-472.292) (-470.131) * [-471.056] (-469.510) (-468.257) (-467.039) -- 0:00:12
787000 -- (-468.340) (-468.174) (-468.973) [-470.311] * (-469.771) (-474.613) (-471.235) [-467.981] -- 0:00:12
787500 -- (-467.141) (-467.166) (-470.036) [-468.016] * (-468.993) (-470.569) [-469.243] (-469.860) -- 0:00:12
788000 -- (-468.358) (-470.774) (-472.440) [-471.107] * [-469.667] (-468.650) (-468.473) (-467.629) -- 0:00:12
788500 -- (-474.174) [-472.258] (-468.374) (-469.997) * (-469.559) (-473.767) (-470.880) [-468.707] -- 0:00:12
789000 -- [-470.841] (-472.391) (-470.485) (-472.517) * [-468.547] (-467.720) (-468.965) (-468.652) -- 0:00:12
789500 -- (-468.628) [-467.308] (-468.187) (-470.672) * (-469.137) (-469.228) (-470.101) [-469.918] -- 0:00:12
790000 -- [-470.600] (-471.779) (-466.956) (-468.689) * (-468.869) (-469.949) (-470.507) [-468.773] -- 0:00:12
Average standard deviation of split frequencies: 0.008546
790500 -- (-468.213) (-469.893) [-467.094] (-469.753) * (-467.539) [-468.650] (-469.818) (-468.610) -- 0:00:12
791000 -- (-469.215) [-470.603] (-469.974) (-469.021) * (-468.692) [-468.125] (-471.610) (-471.484) -- 0:00:12
791500 -- (-469.755) [-470.425] (-469.079) (-469.385) * (-468.323) [-469.305] (-469.176) (-469.728) -- 0:00:12
792000 -- (-467.489) [-471.683] (-470.620) (-468.358) * (-473.016) (-471.016) (-472.315) [-472.651] -- 0:00:12
792500 -- (-468.573) [-469.345] (-468.169) (-468.381) * [-468.613] (-469.157) (-471.061) (-469.389) -- 0:00:12
793000 -- [-473.373] (-469.277) (-467.259) (-471.736) * (-467.904) (-468.780) (-471.456) [-467.742] -- 0:00:12
793500 -- [-471.848] (-468.418) (-470.244) (-475.493) * [-468.095] (-473.092) (-467.732) (-467.612) -- 0:00:12
794000 -- (-474.184) (-469.527) [-468.870] (-470.136) * (-470.920) (-469.351) [-470.328] (-470.027) -- 0:00:12
794500 -- (-470.896) (-469.536) [-468.244] (-468.515) * (-467.334) [-470.963] (-467.691) (-469.854) -- 0:00:12
795000 -- (-470.438) (-468.739) [-467.654] (-468.136) * (-469.392) (-473.075) (-468.931) [-467.768] -- 0:00:12
Average standard deviation of split frequencies: 0.008133
795500 -- (-469.556) (-467.868) (-474.134) [-467.812] * (-474.001) [-473.147] (-468.420) (-468.522) -- 0:00:12
796000 -- [-468.410] (-467.003) (-474.006) (-468.356) * (-469.473) [-472.637] (-473.486) (-469.381) -- 0:00:12
796500 -- (-473.818) (-468.164) [-469.144] (-468.416) * [-468.590] (-470.488) (-470.420) (-468.111) -- 0:00:12
797000 -- (-468.110) (-469.995) [-468.162] (-471.616) * (-468.770) (-470.478) [-470.265] (-468.472) -- 0:00:12
797500 -- (-468.835) (-467.577) (-469.352) [-468.391] * (-469.556) (-472.814) [-469.252] (-467.649) -- 0:00:12
798000 -- [-468.195] (-468.629) (-468.262) (-472.439) * [-467.934] (-468.274) (-469.211) (-468.199) -- 0:00:12
798500 -- (-468.595) (-471.359) (-470.248) [-467.676] * (-468.636) (-472.721) (-468.116) [-468.447] -- 0:00:12
799000 -- (-469.250) (-475.743) [-470.935] (-468.325) * [-467.464] (-471.741) (-473.283) (-467.790) -- 0:00:12
799500 -- [-468.158] (-472.996) (-470.894) (-467.390) * (-468.272) (-474.884) (-475.045) [-469.446] -- 0:00:12
800000 -- (-471.840) (-469.403) (-471.522) [-467.731] * [-468.431] (-471.106) (-469.502) (-470.078) -- 0:00:12
Average standard deviation of split frequencies: 0.007772
800500 -- (-476.604) [-469.096] (-468.402) (-468.128) * [-467.986] (-473.281) (-470.397) (-470.083) -- 0:00:11
801000 -- [-467.511] (-473.244) (-467.397) (-468.152) * [-472.413] (-470.149) (-468.460) (-469.313) -- 0:00:11
801500 -- (-467.626) (-474.305) [-468.737] (-466.969) * (-476.726) [-469.983] (-469.014) (-470.385) -- 0:00:11
802000 -- (-467.230) (-469.172) (-471.459) [-469.901] * (-470.194) [-468.214] (-469.636) (-471.154) -- 0:00:11
802500 -- [-468.128] (-468.967) (-468.016) (-468.650) * (-470.185) [-467.108] (-468.919) (-468.920) -- 0:00:11
803000 -- (-471.336) (-470.821) [-468.017] (-471.235) * (-473.919) (-468.120) [-470.035] (-469.455) -- 0:00:11
803500 -- (-473.374) (-471.895) (-467.865) [-468.625] * (-475.612) (-469.367) (-472.145) [-469.734] -- 0:00:11
804000 -- (-470.980) (-475.036) [-467.723] (-467.279) * [-470.071] (-469.129) (-467.746) (-470.582) -- 0:00:11
804500 -- (-468.355) (-468.466) [-467.551] (-470.013) * [-469.226] (-469.927) (-470.313) (-468.933) -- 0:00:11
805000 -- (-470.664) (-467.446) [-469.184] (-467.542) * [-472.846] (-469.572) (-471.259) (-471.304) -- 0:00:11
Average standard deviation of split frequencies: 0.007447
805500 -- (-469.501) (-469.306) (-467.978) [-468.121] * [-468.686] (-469.787) (-470.585) (-468.029) -- 0:00:11
806000 -- [-468.935] (-469.622) (-469.003) (-469.075) * (-471.070) (-467.985) [-469.026] (-469.533) -- 0:00:11
806500 -- (-469.530) (-468.906) (-468.780) [-468.000] * (-472.954) (-468.034) [-470.550] (-467.779) -- 0:00:11
807000 -- (-467.488) [-473.701] (-467.983) (-469.716) * (-470.619) (-469.652) [-469.564] (-467.569) -- 0:00:11
807500 -- (-474.696) (-470.969) [-469.177] (-469.151) * [-467.509] (-471.039) (-467.420) (-469.385) -- 0:00:11
808000 -- (-470.677) [-468.537] (-470.301) (-468.845) * (-469.316) (-467.441) [-468.184] (-468.485) -- 0:00:11
808500 -- (-467.989) (-470.855) [-469.897] (-468.403) * [-471.950] (-468.052) (-468.184) (-470.959) -- 0:00:11
809000 -- (-470.762) (-471.203) [-467.772] (-472.763) * (-469.961) (-467.950) (-471.524) [-473.031] -- 0:00:11
809500 -- [-469.860] (-468.510) (-467.232) (-470.869) * (-468.706) (-468.810) (-473.192) [-469.488] -- 0:00:11
810000 -- (-469.540) (-469.324) [-467.055] (-468.906) * (-469.779) (-467.549) (-472.339) [-471.452] -- 0:00:11
Average standard deviation of split frequencies: 0.007715
810500 -- (-469.504) (-468.660) (-467.391) [-468.191] * (-468.544) [-468.589] (-469.989) (-471.903) -- 0:00:11
811000 -- (-469.970) (-468.693) (-469.246) [-467.360] * (-473.706) [-473.375] (-470.003) (-475.878) -- 0:00:11
811500 -- [-469.449] (-468.110) (-468.657) (-467.574) * [-468.125] (-474.748) (-467.985) (-469.543) -- 0:00:11
812000 -- (-468.937) (-468.426) [-470.991] (-467.051) * (-469.106) (-468.445) (-468.071) [-470.134] -- 0:00:11
812500 -- (-471.772) (-471.621) (-470.300) [-467.155] * (-469.172) (-470.507) (-472.528) [-469.357] -- 0:00:11
813000 -- [-467.758] (-471.432) (-470.472) (-470.692) * (-467.079) (-470.559) (-471.931) [-469.334] -- 0:00:11
813500 -- [-467.623] (-467.477) (-469.149) (-469.399) * (-467.975) (-470.714) (-469.472) [-468.813] -- 0:00:11
814000 -- [-468.198] (-468.051) (-467.221) (-469.102) * (-467.626) (-471.692) [-468.357] (-470.660) -- 0:00:11
814500 -- (-469.521) (-467.684) [-470.776] (-471.225) * (-468.352) (-467.789) [-468.976] (-469.125) -- 0:00:11
815000 -- [-470.402] (-467.448) (-469.117) (-469.982) * (-468.716) (-471.173) (-468.272) [-469.178] -- 0:00:11
Average standard deviation of split frequencies: 0.007164
815500 -- (-467.553) (-469.982) (-468.479) [-470.886] * (-471.947) (-469.436) [-468.648] (-467.691) -- 0:00:11
816000 -- (-467.478) (-469.572) (-468.493) [-468.730] * (-468.606) [-468.713] (-471.713) (-470.911) -- 0:00:11
816500 -- [-467.791] (-468.620) (-471.242) (-468.433) * (-468.834) (-469.803) [-467.807] (-468.068) -- 0:00:11
817000 -- (-468.953) (-468.092) [-471.276] (-468.248) * (-471.179) [-469.101] (-467.577) (-468.705) -- 0:00:10
817500 -- (-471.250) (-467.647) [-467.027] (-468.391) * (-469.547) (-472.015) (-470.873) [-469.893] -- 0:00:10
818000 -- [-468.420] (-467.646) (-470.751) (-471.619) * (-468.961) (-472.501) [-467.544] (-468.099) -- 0:00:10
818500 -- (-468.714) (-468.971) (-469.752) [-471.071] * [-470.680] (-469.389) (-470.007) (-472.600) -- 0:00:10
819000 -- [-468.329] (-471.299) (-470.717) (-471.121) * (-470.061) (-468.546) [-470.070] (-468.973) -- 0:00:10
819500 -- (-470.718) [-470.422] (-468.211) (-470.987) * (-468.434) [-470.122] (-468.439) (-472.247) -- 0:00:10
820000 -- (-471.375) (-467.553) [-468.760] (-469.377) * (-468.781) (-471.339) (-468.427) [-468.973] -- 0:00:10
Average standard deviation of split frequencies: 0.007008
820500 -- (-470.457) [-471.912] (-469.196) (-468.074) * [-472.299] (-468.286) (-472.748) (-472.228) -- 0:00:10
821000 -- (-470.005) (-468.043) (-472.138) [-471.881] * (-473.165) [-469.110] (-470.410) (-472.598) -- 0:00:10
821500 -- (-468.590) [-467.987] (-468.420) (-470.310) * (-472.508) [-467.339] (-468.268) (-470.765) -- 0:00:10
822000 -- (-467.829) (-470.360) [-469.654] (-471.884) * [-470.318] (-468.330) (-467.610) (-470.362) -- 0:00:10
822500 -- [-470.343] (-468.976) (-469.350) (-474.339) * (-468.167) (-468.326) [-470.766] (-471.017) -- 0:00:10
823000 -- (-467.653) [-470.562] (-468.279) (-472.230) * [-468.838] (-467.366) (-470.968) (-471.703) -- 0:00:10
823500 -- (-467.904) (-471.589) (-471.054) [-468.758] * (-470.349) (-470.218) (-472.766) [-468.614] -- 0:00:10
824000 -- (-473.191) (-469.299) [-470.550] (-469.426) * (-468.688) (-472.820) (-468.398) [-469.444] -- 0:00:10
824500 -- [-471.343] (-469.883) (-468.446) (-469.721) * (-468.684) (-467.510) (-467.965) [-468.639] -- 0:00:10
825000 -- (-473.986) (-468.701) [-470.112] (-470.553) * (-467.980) [-470.111] (-468.200) (-470.493) -- 0:00:10
Average standard deviation of split frequencies: 0.007039
825500 -- [-470.061] (-471.396) (-469.083) (-469.557) * (-467.673) (-474.564) (-467.908) [-468.584] -- 0:00:10
826000 -- (-469.084) (-471.757) [-467.671] (-469.680) * (-468.862) [-467.717] (-473.147) (-468.328) -- 0:00:10
826500 -- (-468.859) [-468.285] (-471.188) (-471.833) * (-468.889) (-468.899) (-470.061) [-469.685] -- 0:00:10
827000 -- (-469.522) (-470.963) (-473.987) [-468.846] * (-470.075) [-469.218] (-467.825) (-470.435) -- 0:00:10
827500 -- [-468.202] (-471.009) (-469.688) (-467.270) * [-469.361] (-470.528) (-468.107) (-467.034) -- 0:00:10
828000 -- (-468.996) (-468.778) [-468.337] (-468.448) * (-470.771) [-468.520] (-468.000) (-468.556) -- 0:00:10
828500 -- [-468.189] (-470.050) (-469.526) (-471.208) * (-470.237) (-467.716) (-469.797) [-468.855] -- 0:00:10
829000 -- [-468.337] (-469.588) (-468.922) (-475.641) * [-471.941] (-474.514) (-469.475) (-470.693) -- 0:00:10
829500 -- (-467.280) (-468.893) [-467.057] (-471.729) * (-470.105) (-470.127) [-470.421] (-469.178) -- 0:00:10
830000 -- (-467.989) (-468.240) (-468.351) [-471.363] * [-467.405] (-469.730) (-475.009) (-467.261) -- 0:00:10
Average standard deviation of split frequencies: 0.007378
830500 -- [-472.895] (-469.497) (-467.373) (-468.001) * [-468.158] (-467.134) (-472.955) (-467.129) -- 0:00:10
831000 -- (-470.530) (-470.504) [-468.689] (-470.653) * (-475.668) (-466.952) (-472.140) [-467.102] -- 0:00:10
831500 -- (-471.291) (-468.471) (-469.435) [-468.201] * (-473.524) [-468.061] (-469.883) (-471.043) -- 0:00:10
832000 -- [-468.075] (-468.085) (-471.592) (-468.802) * (-470.536) [-468.751] (-468.031) (-469.632) -- 0:00:10
832500 -- [-469.683] (-475.123) (-470.387) (-469.767) * (-471.573) (-468.450) (-469.894) [-471.822] -- 0:00:10
833000 -- (-470.861) (-471.902) (-467.712) [-472.529] * (-470.862) [-467.714] (-468.631) (-471.934) -- 0:00:10
833500 -- [-474.464] (-472.118) (-467.874) (-469.304) * (-467.362) (-468.923) (-472.207) [-471.448] -- 0:00:09
834000 -- (-469.576) (-469.720) (-467.572) [-468.311] * (-468.691) [-469.590] (-469.298) (-469.506) -- 0:00:09
834500 -- (-468.179) (-470.522) [-467.560] (-468.823) * (-470.386) (-470.593) [-471.317] (-468.560) -- 0:00:09
835000 -- (-467.621) (-469.830) (-468.144) [-468.616] * (-468.833) (-467.847) [-473.422] (-467.632) -- 0:00:09
Average standard deviation of split frequencies: 0.007330
835500 -- (-470.475) [-469.331] (-468.786) (-468.603) * [-471.590] (-467.624) (-467.518) (-469.646) -- 0:00:09
836000 -- [-468.542] (-468.462) (-468.398) (-468.605) * (-470.759) (-472.198) [-468.420] (-468.589) -- 0:00:09
836500 -- (-468.291) (-468.881) (-467.593) [-469.735] * (-468.143) (-467.038) [-468.462] (-472.279) -- 0:00:09
837000 -- (-468.466) [-467.830] (-469.723) (-479.498) * (-469.410) [-469.337] (-470.269) (-469.758) -- 0:00:09
837500 -- (-472.032) [-469.370] (-467.559) (-469.616) * (-473.042) [-468.335] (-469.556) (-470.628) -- 0:00:09
838000 -- [-475.936] (-468.824) (-467.733) (-472.237) * (-470.767) (-467.014) [-471.899] (-470.405) -- 0:00:09
838500 -- (-468.055) (-468.960) (-469.169) [-473.410] * (-473.232) (-469.071) [-470.113] (-471.105) -- 0:00:09
839000 -- [-469.365] (-468.909) (-469.288) (-476.953) * (-471.867) (-467.293) [-467.539] (-472.151) -- 0:00:09
839500 -- [-470.267] (-468.538) (-469.464) (-476.173) * (-469.083) (-468.522) [-468.187] (-469.692) -- 0:00:09
840000 -- [-469.207] (-469.697) (-468.824) (-476.664) * (-468.700) [-470.240] (-468.722) (-469.469) -- 0:00:09
Average standard deviation of split frequencies: 0.006879
840500 -- (-468.103) (-472.040) (-472.344) [-467.909] * (-469.279) (-467.977) (-471.759) [-467.903] -- 0:00:09
841000 -- (-470.681) (-469.562) (-470.659) [-468.916] * (-467.905) (-471.170) (-467.651) [-468.675] -- 0:00:09
841500 -- (-475.095) [-469.907] (-470.035) (-470.538) * (-469.543) (-469.479) (-469.011) [-470.364] -- 0:00:09
842000 -- (-470.606) (-468.441) (-467.808) [-470.157] * (-475.290) (-468.272) [-467.390] (-470.845) -- 0:00:09
842500 -- (-469.237) [-470.336] (-472.870) (-472.133) * (-468.779) [-470.355] (-468.162) (-471.222) -- 0:00:09
843000 -- (-467.726) (-467.496) (-475.711) [-472.371] * [-469.178] (-475.435) (-468.020) (-471.504) -- 0:00:09
843500 -- (-468.799) [-467.316] (-475.189) (-473.901) * [-467.365] (-470.310) (-469.074) (-468.913) -- 0:00:09
844000 -- [-468.113] (-468.063) (-473.149) (-472.932) * (-471.881) [-470.668] (-469.895) (-468.744) -- 0:00:09
844500 -- (-468.650) [-469.866] (-471.228) (-468.271) * [-467.491] (-471.211) (-467.725) (-469.487) -- 0:00:09
845000 -- (-469.461) [-470.873] (-471.775) (-469.001) * (-469.268) (-471.418) (-468.399) [-468.177] -- 0:00:09
Average standard deviation of split frequencies: 0.006538
845500 -- (-468.438) (-472.662) (-469.778) [-468.949] * (-473.509) (-477.047) (-470.611) [-467.722] -- 0:00:09
846000 -- (-470.693) [-471.458] (-470.173) (-470.947) * [-468.446] (-472.604) (-471.898) (-469.025) -- 0:00:09
846500 -- (-473.042) [-470.600] (-467.024) (-468.729) * [-469.397] (-468.860) (-471.193) (-468.439) -- 0:00:09
847000 -- [-470.135] (-471.647) (-468.089) (-469.474) * (-469.532) (-467.442) [-467.903] (-470.093) -- 0:00:09
847500 -- (-470.627) [-469.870] (-474.708) (-469.425) * (-470.834) (-467.654) [-469.647] (-468.872) -- 0:00:09
848000 -- [-469.224] (-470.829) (-470.402) (-468.747) * [-468.512] (-471.400) (-467.816) (-469.325) -- 0:00:09
848500 -- (-469.834) (-469.327) (-468.927) [-468.878] * [-468.170] (-471.590) (-471.860) (-468.676) -- 0:00:09
849000 -- (-471.789) [-468.963] (-470.171) (-468.523) * (-469.994) [-469.928] (-469.468) (-469.923) -- 0:00:09
849500 -- (-471.763) (-472.099) [-468.609] (-468.225) * [-467.270] (-469.782) (-468.411) (-470.099) -- 0:00:09
850000 -- (-470.045) [-467.829] (-468.733) (-468.440) * [-469.197] (-470.770) (-467.844) (-468.362) -- 0:00:09
Average standard deviation of split frequencies: 0.006244
850500 -- (-468.851) (-468.666) (-467.449) [-468.714] * (-470.175) (-472.732) (-468.938) [-468.593] -- 0:00:08
851000 -- (-470.550) [-468.271] (-467.594) (-468.899) * [-467.895] (-467.330) (-472.024) (-470.198) -- 0:00:08
851500 -- [-468.784] (-472.608) (-472.394) (-468.999) * (-470.846) (-467.623) (-474.432) [-468.195] -- 0:00:08
852000 -- [-469.534] (-470.006) (-472.702) (-469.445) * (-467.465) [-471.595] (-467.743) (-468.689) -- 0:00:08
852500 -- [-468.347] (-470.200) (-468.285) (-469.802) * (-467.496) (-468.358) [-467.892] (-470.287) -- 0:00:08
853000 -- [-468.083] (-471.116) (-468.487) (-468.932) * (-471.399) (-468.738) (-467.917) [-467.416] -- 0:00:08
853500 -- (-473.986) (-469.862) (-467.592) [-469.334] * (-468.690) [-467.506] (-471.962) (-468.102) -- 0:00:08
854000 -- (-471.111) [-468.244] (-471.149) (-469.527) * (-467.706) (-472.749) (-472.847) [-470.309] -- 0:00:08
854500 -- (-472.241) (-471.806) [-471.071] (-467.719) * (-469.329) (-467.510) [-469.471] (-468.942) -- 0:00:08
855000 -- (-473.250) (-471.910) (-470.368) [-470.572] * (-469.977) [-468.254] (-469.453) (-467.918) -- 0:00:08
Average standard deviation of split frequencies: 0.006278
855500 -- (-471.076) (-468.785) [-470.597] (-468.234) * (-467.281) (-468.322) (-469.100) [-468.094] -- 0:00:08
856000 -- (-468.826) (-471.719) (-469.902) [-472.246] * (-468.770) (-467.598) (-470.849) [-469.614] -- 0:00:08
856500 -- [-469.896] (-469.045) (-469.500) (-470.090) * [-468.809] (-468.753) (-469.377) (-468.313) -- 0:00:08
857000 -- [-467.580] (-467.789) (-468.706) (-469.682) * [-467.770] (-469.313) (-470.329) (-467.684) -- 0:00:08
857500 -- [-467.107] (-469.184) (-472.588) (-474.445) * [-469.363] (-467.552) (-474.380) (-468.130) -- 0:00:08
858000 -- [-467.259] (-467.787) (-472.276) (-468.550) * (-467.172) (-470.909) (-470.358) [-468.943] -- 0:00:08
858500 -- [-469.024] (-470.078) (-469.593) (-469.007) * [-467.499] (-472.786) (-470.434) (-468.627) -- 0:00:08
859000 -- (-468.278) (-467.521) (-468.012) [-469.515] * [-467.961] (-467.656) (-471.164) (-468.816) -- 0:00:08
859500 -- (-468.758) [-468.054] (-469.893) (-467.019) * [-468.406] (-470.147) (-468.575) (-468.239) -- 0:00:08
860000 -- [-468.118] (-469.221) (-469.309) (-468.410) * (-468.770) [-469.416] (-468.268) (-473.197) -- 0:00:08
Average standard deviation of split frequencies: 0.006171
860500 -- (-468.118) (-470.438) (-471.544) [-471.284] * (-469.371) (-468.260) (-468.595) [-467.672] -- 0:00:08
861000 -- (-468.236) [-469.385] (-471.644) (-467.828) * (-468.011) (-468.091) (-472.282) [-468.657] -- 0:00:08
861500 -- (-472.181) [-468.358] (-469.989) (-469.533) * (-470.092) [-475.461] (-468.832) (-469.853) -- 0:00:08
862000 -- (-471.420) [-468.346] (-468.983) (-469.156) * (-470.086) (-471.557) [-469.098] (-470.759) -- 0:00:08
862500 -- (-470.053) [-470.041] (-470.170) (-474.090) * [-467.917] (-468.377) (-471.563) (-469.235) -- 0:00:08
863000 -- (-469.303) (-468.221) [-468.967] (-470.805) * [-467.987] (-468.648) (-467.994) (-468.887) -- 0:00:08
863500 -- (-469.352) (-468.045) (-469.840) [-469.753] * [-469.522] (-467.869) (-468.208) (-468.110) -- 0:00:08
864000 -- (-471.655) (-468.482) (-468.030) [-470.345] * (-470.437) (-468.644) (-468.070) [-470.983] -- 0:00:08
864500 -- (-470.494) [-467.098] (-469.820) (-467.853) * (-468.278) [-468.579] (-469.488) (-470.056) -- 0:00:08
865000 -- (-470.114) [-468.007] (-470.916) (-471.252) * (-468.024) (-468.852) [-469.910] (-471.041) -- 0:00:08
Average standard deviation of split frequencies: 0.006314
865500 -- (-470.259) (-470.803) [-468.085] (-470.858) * [-467.985] (-471.241) (-470.153) (-469.242) -- 0:00:08
866000 -- (-471.161) [-470.877] (-468.048) (-469.209) * [-467.643] (-468.740) (-471.514) (-469.450) -- 0:00:08
866500 -- (-468.835) [-471.393] (-469.387) (-471.476) * (-470.558) [-467.198] (-470.052) (-469.762) -- 0:00:08
867000 -- (-471.094) (-473.807) [-469.278] (-468.356) * (-472.488) (-469.787) (-472.372) [-470.654] -- 0:00:07
867500 -- (-473.305) [-467.494] (-468.861) (-469.246) * (-471.577) [-468.283] (-471.279) (-469.771) -- 0:00:07
868000 -- (-472.086) (-467.067) [-471.529] (-468.699) * (-471.268) (-467.809) [-467.510] (-468.200) -- 0:00:07
868500 -- [-467.939] (-469.131) (-473.404) (-468.579) * (-472.783) [-468.339] (-471.125) (-468.440) -- 0:00:07
869000 -- (-469.051) [-468.736] (-472.228) (-467.970) * (-476.293) (-468.758) [-468.489] (-471.694) -- 0:00:07
869500 -- (-468.708) (-470.875) [-471.091] (-470.992) * (-469.700) (-467.925) [-468.475] (-469.952) -- 0:00:07
870000 -- (-469.446) (-468.931) [-467.662] (-471.105) * (-467.139) [-469.306] (-468.258) (-468.207) -- 0:00:07
Average standard deviation of split frequencies: 0.006281
870500 -- [-472.686] (-469.394) (-468.987) (-471.598) * [-468.167] (-468.884) (-470.251) (-470.446) -- 0:00:07
871000 -- [-470.562] (-472.023) (-472.305) (-471.210) * [-467.851] (-471.067) (-473.609) (-476.256) -- 0:00:07
871500 -- (-469.545) [-470.172] (-468.576) (-469.433) * [-469.445] (-468.258) (-469.089) (-469.276) -- 0:00:07
872000 -- (-478.067) (-470.032) [-470.216] (-468.985) * (-471.929) (-468.945) [-471.607] (-468.158) -- 0:00:07
872500 -- (-470.536) (-468.473) (-467.457) [-468.056] * (-471.281) [-470.393] (-467.999) (-475.430) -- 0:00:07
873000 -- (-468.501) [-469.932] (-472.030) (-474.511) * (-469.584) (-472.054) [-468.530] (-472.148) -- 0:00:07
873500 -- (-470.402) (-469.631) [-468.039] (-469.596) * (-468.542) (-470.630) (-472.146) [-468.423] -- 0:00:07
874000 -- (-475.059) [-469.193] (-469.465) (-470.575) * (-468.597) (-468.497) (-469.639) [-469.341] -- 0:00:07
874500 -- (-468.247) (-467.800) (-471.852) [-469.414] * [-469.026] (-467.970) (-473.158) (-472.505) -- 0:00:07
875000 -- [-468.340] (-468.192) (-471.165) (-472.149) * [-471.276] (-468.562) (-471.351) (-468.398) -- 0:00:07
Average standard deviation of split frequencies: 0.006063
875500 -- (-471.843) [-467.648] (-469.479) (-469.890) * (-471.062) (-470.852) [-467.991] (-468.429) -- 0:00:07
876000 -- (-470.813) [-469.739] (-469.891) (-467.326) * (-470.589) [-469.641] (-469.475) (-467.707) -- 0:00:07
876500 -- (-472.202) (-469.405) (-469.536) [-469.776] * (-470.479) [-468.552] (-469.643) (-468.599) -- 0:00:07
877000 -- (-469.309) (-467.817) (-470.263) [-469.982] * [-469.715] (-470.429) (-469.842) (-473.311) -- 0:00:07
877500 -- (-469.389) [-468.283] (-467.908) (-468.821) * (-468.464) (-469.119) [-469.713] (-469.556) -- 0:00:07
878000 -- (-468.795) [-472.943] (-468.311) (-468.200) * (-469.285) [-469.759] (-469.812) (-469.833) -- 0:00:07
878500 -- (-469.015) (-474.307) (-469.309) [-475.360] * (-468.902) [-468.503] (-470.664) (-469.987) -- 0:00:07
879000 -- (-474.602) (-467.770) [-469.146] (-475.560) * (-470.921) [-468.334] (-470.249) (-470.887) -- 0:00:07
879500 -- (-473.693) [-468.420] (-466.958) (-470.928) * (-467.264) (-467.546) (-467.716) [-470.885] -- 0:00:07
880000 -- [-470.013] (-467.991) (-468.827) (-470.880) * (-468.865) (-468.785) [-471.072] (-468.724) -- 0:00:07
Average standard deviation of split frequencies: 0.006174
880500 -- (-468.089) (-468.051) (-467.612) [-469.638] * (-468.724) [-470.904] (-469.070) (-467.540) -- 0:00:07
881000 -- (-471.489) (-468.199) (-467.869) [-469.943] * (-468.365) (-474.239) [-467.756] (-467.522) -- 0:00:07
881500 -- (-470.087) [-467.620] (-469.129) (-468.011) * [-469.074] (-471.206) (-469.604) (-468.418) -- 0:00:07
882000 -- [-469.022] (-467.049) (-467.000) (-467.768) * [-468.545] (-468.503) (-471.189) (-467.887) -- 0:00:07
882500 -- (-467.584) (-467.266) [-468.682] (-468.067) * (-470.343) (-469.143) (-475.070) [-471.775] -- 0:00:07
883000 -- [-468.183] (-467.682) (-478.711) (-467.655) * [-469.778] (-469.322) (-470.179) (-468.049) -- 0:00:07
883500 -- [-467.755] (-472.960) (-475.703) (-468.588) * [-467.840] (-470.084) (-472.229) (-468.141) -- 0:00:06
884000 -- (-472.873) [-471.125] (-469.647) (-472.033) * (-469.714) (-468.811) [-469.210] (-468.946) -- 0:00:06
884500 -- (-476.957) (-474.363) (-468.269) [-467.491] * [-468.878] (-469.527) (-468.246) (-470.703) -- 0:00:06
885000 -- (-472.344) (-473.741) (-469.213) [-469.837] * (-468.593) (-469.829) (-467.439) [-469.995] -- 0:00:06
Average standard deviation of split frequencies: 0.005817
885500 -- (-472.618) (-480.165) [-470.343] (-469.635) * (-469.188) (-467.423) (-469.502) [-468.280] -- 0:00:06
886000 -- (-469.145) (-468.750) (-468.395) [-469.134] * [-470.234] (-467.444) (-468.710) (-467.631) -- 0:00:06
886500 -- (-470.752) (-473.544) (-470.184) [-470.215] * (-471.382) (-468.883) [-468.548] (-468.718) -- 0:00:06
887000 -- (-467.182) (-469.097) (-472.746) [-468.656] * (-472.872) (-468.578) (-471.181) [-469.877] -- 0:00:06
887500 -- (-467.451) (-467.857) (-470.246) [-468.207] * (-468.516) (-468.044) (-470.438) [-470.464] -- 0:00:06
888000 -- (-468.830) [-469.130] (-470.163) (-468.581) * (-468.287) [-470.285] (-469.415) (-470.766) -- 0:00:06
888500 -- [-470.642] (-467.651) (-469.061) (-467.481) * (-467.871) (-473.446) [-467.969] (-470.606) -- 0:00:06
889000 -- (-467.740) [-467.119] (-469.129) (-467.481) * (-472.088) (-467.435) [-468.178] (-468.899) -- 0:00:06
889500 -- (-469.450) (-469.907) [-469.967] (-469.440) * (-467.824) (-468.845) (-472.201) [-468.996] -- 0:00:06
890000 -- (-469.067) (-469.817) [-468.955] (-471.957) * (-469.044) (-468.270) (-467.289) [-468.323] -- 0:00:06
Average standard deviation of split frequencies: 0.005963
890500 -- (-471.040) [-469.791] (-470.313) (-467.246) * (-470.032) (-470.767) [-468.821] (-468.283) -- 0:00:06
891000 -- [-468.029] (-469.308) (-468.746) (-467.246) * (-471.624) (-467.620) (-469.594) [-470.363] -- 0:00:06
891500 -- (-470.304) (-469.151) [-469.002] (-471.298) * (-470.002) (-467.456) (-469.364) [-470.217] -- 0:00:06
892000 -- [-467.307] (-473.155) (-472.319) (-470.065) * (-468.460) [-466.979] (-471.079) (-467.389) -- 0:00:06
892500 -- (-467.709) [-468.909] (-473.364) (-468.459) * [-468.547] (-467.805) (-470.720) (-469.054) -- 0:00:06
893000 -- (-468.920) (-468.388) [-470.711] (-468.489) * [-468.872] (-467.203) (-470.319) (-469.645) -- 0:00:06
893500 -- [-468.337] (-471.231) (-470.893) (-468.544) * (-468.259) (-467.390) [-468.835] (-471.264) -- 0:00:06
894000 -- (-468.461) [-468.777] (-467.168) (-467.996) * (-471.694) [-467.973] (-469.094) (-468.632) -- 0:00:06
894500 -- (-473.080) (-468.498) [-469.036] (-472.289) * (-467.555) (-471.401) [-468.153] (-469.277) -- 0:00:06
895000 -- [-469.004] (-468.530) (-468.156) (-467.913) * (-472.334) (-473.020) (-468.632) [-472.322] -- 0:00:06
Average standard deviation of split frequencies: 0.005577
895500 -- (-469.483) (-469.288) (-468.220) [-467.972] * (-472.287) (-469.208) [-467.854] (-473.348) -- 0:00:06
896000 -- (-469.437) (-474.931) (-469.500) [-467.445] * [-468.972] (-468.693) (-470.162) (-469.345) -- 0:00:06
896500 -- (-473.144) (-470.627) [-468.744] (-467.052) * (-470.816) [-469.922] (-468.412) (-470.272) -- 0:00:06
897000 -- (-468.396) (-471.864) (-467.538) [-467.181] * (-469.918) (-469.602) [-468.514] (-470.672) -- 0:00:06
897500 -- (-469.697) (-472.571) [-469.733] (-470.441) * (-467.469) (-472.592) [-468.417] (-471.532) -- 0:00:06
898000 -- [-470.948] (-467.743) (-470.575) (-471.067) * [-467.447] (-472.637) (-470.692) (-470.025) -- 0:00:06
898500 -- [-467.896] (-468.504) (-468.459) (-470.304) * [-470.039] (-470.400) (-470.064) (-474.050) -- 0:00:06
899000 -- (-468.656) [-467.877] (-468.473) (-468.609) * (-472.144) (-474.069) [-469.855] (-475.992) -- 0:00:06
899500 -- (-468.354) (-468.695) [-468.593] (-468.708) * (-478.036) (-468.846) (-470.592) [-468.152] -- 0:00:06
900000 -- (-470.138) (-468.006) (-468.137) [-469.015] * [-468.846] (-470.900) (-467.969) (-469.936) -- 0:00:06
Average standard deviation of split frequencies: 0.005443
900500 -- (-471.464) [-468.790] (-471.442) (-469.431) * [-467.868] (-468.162) (-468.103) (-470.490) -- 0:00:05
901000 -- (-467.626) [-468.606] (-469.637) (-471.069) * (-469.427) (-470.801) [-468.727] (-469.751) -- 0:00:05
901500 -- (-469.723) [-468.954] (-469.658) (-469.703) * (-467.601) (-469.855) [-469.683] (-468.630) -- 0:00:05
902000 -- (-468.120) (-473.680) [-470.608] (-469.237) * (-469.025) [-469.371] (-469.359) (-468.425) -- 0:00:05
902500 -- [-468.845] (-470.444) (-467.540) (-468.832) * (-468.220) (-469.881) (-468.739) [-468.167] -- 0:00:05
903000 -- (-471.859) (-469.007) [-469.049] (-471.380) * (-469.754) (-468.808) (-470.256) [-469.219] -- 0:00:05
903500 -- (-468.557) [-467.519] (-468.150) (-469.402) * (-470.944) (-470.609) (-470.346) [-474.207] -- 0:00:05
904000 -- [-469.635] (-469.211) (-468.254) (-467.447) * (-469.164) [-468.513] (-468.410) (-469.753) -- 0:00:05
904500 -- [-469.891] (-469.343) (-468.494) (-468.295) * (-468.210) (-467.855) (-469.842) [-468.729] -- 0:00:05
905000 -- (-468.671) (-468.768) [-470.597] (-467.783) * [-468.768] (-472.617) (-467.771) (-467.811) -- 0:00:05
Average standard deviation of split frequencies: 0.004718
905500 -- (-473.520) [-472.712] (-468.990) (-468.016) * (-468.749) (-470.287) [-469.455] (-469.767) -- 0:00:05
906000 -- (-468.798) [-469.385] (-468.890) (-469.735) * (-467.678) (-470.707) (-468.104) [-469.727] -- 0:00:05
906500 -- (-468.037) (-470.032) (-472.141) [-467.337] * [-468.526] (-470.674) (-472.671) (-469.783) -- 0:00:05
907000 -- (-469.508) [-468.272] (-471.537) (-469.648) * (-467.922) (-470.448) (-475.152) [-470.449] -- 0:00:05
907500 -- [-467.717] (-468.266) (-469.724) (-469.545) * [-468.144] (-470.535) (-468.128) (-468.660) -- 0:00:05
908000 -- (-473.500) [-467.408] (-470.066) (-469.390) * (-470.634) (-471.919) [-468.973] (-469.348) -- 0:00:05
908500 -- (-468.518) [-468.658] (-470.501) (-468.059) * (-468.935) [-470.587] (-469.690) (-474.261) -- 0:00:05
909000 -- [-468.228] (-472.036) (-469.648) (-468.026) * (-470.061) (-467.376) [-469.187] (-469.057) -- 0:00:05
909500 -- (-470.786) (-470.230) [-469.696] (-469.774) * (-468.689) [-467.612] (-471.612) (-468.440) -- 0:00:05
910000 -- (-472.162) (-471.810) (-469.959) [-470.374] * (-469.851) [-468.263] (-470.341) (-467.223) -- 0:00:05
Average standard deviation of split frequencies: 0.004693
910500 -- (-470.301) [-469.308] (-472.827) (-470.625) * [-470.515] (-468.649) (-471.094) (-469.944) -- 0:00:05
911000 -- (-470.190) (-472.031) [-471.826] (-467.822) * (-470.468) (-470.249) (-469.657) [-470.051] -- 0:00:05
911500 -- (-468.268) (-472.512) [-473.565] (-470.282) * [-468.579] (-468.130) (-468.738) (-468.045) -- 0:00:05
912000 -- (-469.589) (-472.890) (-471.829) [-469.865] * (-468.008) (-473.568) [-468.006] (-468.213) -- 0:00:05
912500 -- (-470.126) (-468.647) [-470.735] (-472.124) * (-468.528) [-471.644] (-468.111) (-474.950) -- 0:00:05
913000 -- (-469.290) (-468.592) [-468.463] (-472.208) * [-470.084] (-470.222) (-469.876) (-473.995) -- 0:00:05
913500 -- (-468.292) (-469.149) [-472.160] (-471.730) * (-469.189) (-469.273) (-468.807) [-468.408] -- 0:00:05
914000 -- (-470.516) (-470.903) (-470.546) [-469.046] * [-469.072] (-470.562) (-467.924) (-468.219) -- 0:00:05
914500 -- (-469.513) (-471.172) [-469.204] (-471.436) * (-468.109) (-468.333) [-470.098] (-467.775) -- 0:00:05
915000 -- (-468.577) (-468.559) (-470.300) [-471.261] * [-471.348] (-470.142) (-469.115) (-468.103) -- 0:00:05
Average standard deviation of split frequencies: 0.004529
915500 -- (-468.006) (-468.362) (-468.190) [-469.274] * (-469.168) (-467.987) [-468.133] (-468.448) -- 0:00:05
916000 -- (-467.725) (-470.124) [-470.396] (-468.169) * (-470.763) [-469.593] (-469.167) (-467.396) -- 0:00:05
916500 -- (-469.628) (-469.752) (-468.349) [-468.416] * (-470.443) [-473.971] (-467.985) (-472.479) -- 0:00:05
917000 -- [-469.621] (-469.000) (-467.483) (-469.004) * (-468.462) [-472.009] (-469.479) (-468.647) -- 0:00:04
917500 -- (-469.986) [-466.879] (-469.302) (-467.916) * (-470.377) [-469.632] (-469.557) (-468.644) -- 0:00:04
918000 -- (-469.060) [-467.140] (-467.480) (-472.082) * (-471.013) (-469.018) (-468.539) [-467.882] -- 0:00:04
918500 -- [-468.983] (-467.821) (-470.798) (-470.948) * [-469.502] (-468.299) (-469.260) (-469.826) -- 0:00:04
919000 -- (-469.421) (-468.709) (-467.682) [-468.774] * [-469.687] (-472.110) (-469.400) (-470.608) -- 0:00:04
919500 -- (-468.086) (-473.881) (-467.773) [-468.369] * (-470.292) [-470.120] (-467.313) (-470.133) -- 0:00:04
920000 -- (-472.959) (-473.800) [-468.013] (-468.420) * (-467.707) (-468.895) [-469.864] (-468.339) -- 0:00:04
Average standard deviation of split frequencies: 0.004608
920500 -- (-469.788) (-469.634) [-470.164] (-468.901) * [-476.400] (-467.888) (-469.578) (-469.023) -- 0:00:04
921000 -- (-469.184) (-471.567) [-470.535] (-472.595) * [-467.893] (-469.844) (-469.702) (-470.322) -- 0:00:04
921500 -- (-469.331) (-468.493) [-468.855] (-471.697) * (-469.244) [-471.472] (-469.482) (-468.954) -- 0:00:04
922000 -- [-468.227] (-469.268) (-470.429) (-472.338) * [-467.751] (-469.261) (-468.225) (-469.114) -- 0:00:04
922500 -- (-470.234) [-468.742] (-467.580) (-470.107) * (-469.093) [-467.704] (-468.687) (-469.490) -- 0:00:04
923000 -- (-470.055) (-468.233) [-470.860] (-469.264) * (-470.236) (-468.674) [-469.798] (-472.097) -- 0:00:04
923500 -- (-470.718) (-468.286) [-467.627] (-468.681) * (-476.884) (-468.783) [-468.178] (-467.982) -- 0:00:04
924000 -- (-468.831) (-475.016) [-471.097] (-471.215) * (-469.662) (-469.363) [-470.618] (-469.785) -- 0:00:04
924500 -- (-469.549) (-469.791) (-473.791) [-468.947] * (-471.274) (-470.291) [-468.430] (-467.738) -- 0:00:04
925000 -- [-469.457] (-467.867) (-469.533) (-469.891) * (-470.158) (-472.136) (-468.549) [-467.452] -- 0:00:04
Average standard deviation of split frequencies: 0.004616
925500 -- (-472.231) (-468.506) [-469.047] (-467.474) * (-470.807) (-469.748) [-468.479] (-468.603) -- 0:00:04
926000 -- (-471.795) (-471.532) (-472.953) [-479.480] * (-468.419) (-471.892) (-467.284) [-467.849] -- 0:00:04
926500 -- [-467.779] (-471.190) (-467.803) (-468.362) * [-469.036] (-470.263) (-470.025) (-471.387) -- 0:00:04
927000 -- (-469.702) (-469.906) (-468.582) [-468.944] * [-471.082] (-471.008) (-472.742) (-467.763) -- 0:00:04
927500 -- (-470.779) (-470.515) [-469.819] (-468.931) * (-468.601) (-468.588) (-469.596) [-469.951] -- 0:00:04
928000 -- (-469.240) (-469.914) (-471.848) [-468.605] * (-470.746) [-468.203] (-471.347) (-468.673) -- 0:00:04
928500 -- [-469.575] (-469.079) (-469.222) (-468.177) * (-468.542) (-470.393) (-469.225) [-470.913] -- 0:00:04
929000 -- (-468.507) (-469.277) [-467.608] (-468.186) * (-467.955) [-469.839] (-471.010) (-469.667) -- 0:00:04
929500 -- (-470.059) [-468.199] (-468.129) (-468.323) * (-467.541) (-471.150) (-469.821) [-469.155] -- 0:00:04
930000 -- (-468.963) (-468.302) [-471.741] (-470.415) * [-470.423] (-469.354) (-471.029) (-474.477) -- 0:00:04
Average standard deviation of split frequencies: 0.004896
930500 -- (-468.744) [-469.846] (-469.877) (-469.462) * (-469.006) [-469.965] (-474.954) (-472.940) -- 0:00:04
931000 -- (-473.566) [-468.608] (-469.260) (-469.708) * (-469.151) (-475.982) [-467.701] (-470.497) -- 0:00:04
931500 -- (-472.995) (-468.537) (-471.068) [-468.933] * (-468.405) (-473.827) [-469.670] (-468.533) -- 0:00:04
932000 -- [-470.099] (-468.060) (-469.418) (-469.481) * [-467.944] (-467.758) (-469.317) (-471.811) -- 0:00:04
932500 -- [-467.888] (-470.046) (-468.299) (-473.369) * (-469.685) (-468.274) (-468.605) [-468.534] -- 0:00:04
933000 -- [-469.786] (-467.609) (-470.756) (-472.989) * (-467.956) [-470.574] (-468.934) (-469.718) -- 0:00:04
933500 -- (-472.426) [-468.728] (-470.564) (-471.474) * (-467.906) [-469.783] (-468.780) (-471.461) -- 0:00:03
934000 -- (-468.660) (-469.719) [-471.007] (-469.821) * (-468.805) (-468.086) (-468.928) [-470.261] -- 0:00:03
934500 -- (-469.451) [-469.819] (-471.665) (-471.745) * [-468.026] (-471.357) (-468.981) (-468.539) -- 0:00:03
935000 -- (-475.568) (-468.702) (-470.462) [-471.386] * (-470.717) [-469.788] (-470.618) (-469.362) -- 0:00:03
Average standard deviation of split frequencies: 0.004633
935500 -- (-475.404) [-470.686] (-470.537) (-468.991) * (-469.054) [-468.881] (-468.847) (-469.888) -- 0:00:03
936000 -- (-468.795) (-471.170) (-470.848) [-468.449] * (-469.212) (-472.716) (-467.172) [-467.634] -- 0:00:03
936500 -- [-473.726] (-475.445) (-469.624) (-469.017) * (-468.478) [-470.206] (-467.800) (-468.256) -- 0:00:03
937000 -- (-468.926) (-468.647) [-468.820] (-471.016) * (-471.442) [-469.290] (-468.289) (-469.650) -- 0:00:03
937500 -- (-472.066) [-469.861] (-470.389) (-467.840) * (-467.908) [-470.598] (-471.282) (-470.796) -- 0:00:03
938000 -- (-472.829) (-468.147) (-471.475) [-469.619] * [-469.325] (-468.996) (-468.271) (-468.908) -- 0:00:03
938500 -- (-471.925) [-472.486] (-472.865) (-468.281) * (-471.358) (-473.584) [-469.140] (-469.598) -- 0:00:03
939000 -- (-469.512) [-468.144] (-468.031) (-468.686) * (-473.371) (-471.831) [-468.472] (-471.385) -- 0:00:03
939500 -- (-470.070) (-469.645) [-469.466] (-467.959) * [-468.979] (-468.331) (-472.389) (-471.553) -- 0:00:03
940000 -- (-471.770) (-468.514) (-470.041) [-470.394] * (-468.453) (-469.931) (-468.594) [-472.490] -- 0:00:03
Average standard deviation of split frequencies: 0.004677
940500 -- (-470.149) (-471.475) (-470.343) [-471.275] * [-467.987] (-469.564) (-469.690) (-469.633) -- 0:00:03
941000 -- (-470.413) [-468.964] (-469.447) (-470.572) * (-467.994) [-470.469] (-468.794) (-469.447) -- 0:00:03
941500 -- (-469.229) (-471.600) (-468.857) [-469.925] * (-471.967) (-471.901) [-469.563] (-468.544) -- 0:00:03
942000 -- (-476.835) (-469.058) (-469.597) [-467.957] * (-470.969) (-470.252) [-470.454] (-469.665) -- 0:00:03
942500 -- (-471.683) (-467.805) [-469.880] (-467.645) * (-470.620) (-473.328) [-472.705] (-469.361) -- 0:00:03
943000 -- [-467.816] (-468.697) (-467.454) (-468.999) * (-474.113) (-469.193) [-470.069] (-475.942) -- 0:00:03
943500 -- (-467.634) (-473.005) (-470.628) [-468.934] * (-470.544) [-467.645] (-471.252) (-475.814) -- 0:00:03
944000 -- (-470.070) [-469.987] (-468.879) (-468.401) * (-471.817) [-469.533] (-470.917) (-470.813) -- 0:00:03
944500 -- [-469.096] (-473.739) (-470.746) (-467.704) * [-469.380] (-472.683) (-468.620) (-469.347) -- 0:00:03
945000 -- (-470.327) (-473.797) [-469.789] (-468.754) * (-470.378) [-469.734] (-470.775) (-472.108) -- 0:00:03
Average standard deviation of split frequencies: 0.004817
945500 -- (-468.085) [-467.739] (-467.912) (-469.736) * (-469.479) [-467.449] (-469.944) (-470.906) -- 0:00:03
946000 -- (-469.635) [-467.853] (-468.846) (-468.846) * (-467.919) (-467.609) [-468.275] (-471.385) -- 0:00:03
946500 -- [-469.774] (-469.194) (-467.858) (-467.875) * [-470.398] (-471.137) (-468.655) (-467.446) -- 0:00:03
947000 -- (-468.941) (-470.370) (-469.877) [-468.571] * (-469.332) (-469.198) [-468.563] (-468.273) -- 0:00:03
947500 -- (-469.730) (-470.212) [-469.033] (-470.116) * (-471.024) (-469.966) [-467.747] (-469.653) -- 0:00:03
948000 -- (-467.652) (-467.346) [-469.276] (-470.527) * (-471.008) (-470.584) [-473.068] (-469.817) -- 0:00:03
948500 -- [-468.387] (-467.978) (-468.239) (-472.521) * (-469.394) (-468.442) [-468.022] (-470.189) -- 0:00:03
949000 -- (-467.412) (-469.823) [-469.155] (-470.512) * (-467.542) (-468.401) [-468.202] (-468.704) -- 0:00:03
949500 -- [-467.963] (-467.932) (-467.227) (-467.343) * (-467.603) (-467.962) (-468.689) [-467.651] -- 0:00:03
950000 -- [-468.110] (-467.841) (-471.496) (-468.148) * [-469.966] (-474.683) (-469.600) (-469.271) -- 0:00:03
Average standard deviation of split frequencies: 0.004562
950500 -- (-469.695) (-471.688) (-468.708) [-469.511] * [-468.153] (-477.025) (-471.579) (-469.727) -- 0:00:02
951000 -- (-468.272) (-469.075) (-470.351) [-468.460] * (-467.767) [-472.499] (-468.909) (-469.432) -- 0:00:02
951500 -- (-467.897) [-468.749] (-473.410) (-468.476) * (-467.856) (-468.753) [-467.714] (-467.132) -- 0:00:02
952000 -- [-468.016] (-468.712) (-469.647) (-467.941) * [-467.988] (-469.932) (-467.540) (-470.247) -- 0:00:02
952500 -- (-469.457) (-468.000) (-468.637) [-468.162] * [-467.906] (-467.073) (-468.253) (-469.557) -- 0:00:02
953000 -- (-468.043) (-471.454) [-467.521] (-471.081) * (-468.698) [-467.060] (-467.645) (-470.284) -- 0:00:02
953500 -- (-471.559) [-468.412] (-467.274) (-469.213) * (-472.029) (-469.213) (-469.367) [-470.169] -- 0:00:02
954000 -- (-467.720) [-468.745] (-467.490) (-469.887) * (-470.532) (-470.503) (-470.108) [-468.466] -- 0:00:02
954500 -- [-468.069] (-468.601) (-468.712) (-471.471) * (-470.953) (-470.754) [-468.313] (-467.568) -- 0:00:02
955000 -- [-467.467] (-469.750) (-468.720) (-471.860) * (-467.906) [-468.709] (-467.958) (-468.234) -- 0:00:02
Average standard deviation of split frequencies: 0.004767
955500 -- (-470.296) [-469.693] (-469.695) (-468.582) * (-467.434) (-471.109) [-468.503] (-471.216) -- 0:00:02
956000 -- [-471.062] (-469.378) (-474.129) (-469.663) * (-467.630) [-469.225] (-470.126) (-470.324) -- 0:00:02
956500 -- (-471.412) (-470.669) (-470.629) [-473.156] * (-468.535) (-469.371) (-470.497) [-467.996] -- 0:00:02
957000 -- (-473.551) (-468.763) (-468.739) [-470.955] * (-467.891) (-468.596) (-470.308) [-468.494] -- 0:00:02
957500 -- (-470.085) (-469.009) [-472.149] (-471.016) * (-468.226) [-471.197] (-467.661) (-468.789) -- 0:00:02
958000 -- (-468.971) (-470.373) [-471.381] (-469.333) * (-468.911) [-470.222] (-469.561) (-469.668) -- 0:00:02
958500 -- [-468.599] (-470.265) (-468.629) (-469.341) * (-466.986) (-469.644) [-468.505] (-471.003) -- 0:00:02
959000 -- (-468.944) (-472.204) [-468.350] (-474.662) * [-468.698] (-471.827) (-468.458) (-470.639) -- 0:00:02
959500 -- [-470.108] (-469.902) (-468.628) (-470.740) * [-469.703] (-472.993) (-468.420) (-469.259) -- 0:00:02
960000 -- [-469.737] (-468.447) (-467.592) (-472.196) * (-468.523) (-472.876) (-468.367) [-468.376] -- 0:00:02
Average standard deviation of split frequencies: 0.004547
960500 -- (-469.325) (-468.054) (-467.359) [-469.673] * (-469.210) (-478.953) (-471.351) [-470.106] -- 0:00:02
961000 -- (-468.984) (-470.544) [-470.492] (-470.505) * [-468.426] (-474.180) (-470.055) (-471.222) -- 0:00:02
961500 -- [-470.071] (-469.070) (-469.546) (-473.223) * (-472.320) [-468.014] (-467.813) (-470.723) -- 0:00:02
962000 -- (-468.299) (-468.724) [-468.607] (-467.848) * (-468.881) (-468.030) (-472.665) [-472.980] -- 0:00:02
962500 -- (-470.391) (-468.727) (-472.541) [-469.327] * (-467.986) (-467.444) [-470.833] (-470.337) -- 0:00:02
963000 -- (-473.968) (-467.719) [-469.902] (-468.755) * [-468.167] (-470.729) (-470.417) (-467.898) -- 0:00:02
963500 -- (-473.201) (-467.395) (-469.491) [-469.831] * (-470.351) [-467.708] (-467.392) (-467.752) -- 0:00:02
964000 -- [-473.111] (-468.540) (-471.116) (-473.424) * (-468.891) [-470.102] (-469.714) (-467.693) -- 0:00:02
964500 -- (-469.633) (-467.886) (-472.562) [-469.021] * (-467.579) (-468.416) (-470.804) [-470.487] -- 0:00:02
965000 -- (-469.168) (-468.807) [-470.433] (-469.199) * [-467.804] (-470.941) (-468.636) (-471.773) -- 0:00:02
Average standard deviation of split frequencies: 0.004555
965500 -- (-468.004) [-471.000] (-470.456) (-469.612) * (-469.537) (-471.519) [-468.627] (-470.341) -- 0:00:02
966000 -- (-468.855) (-469.857) [-475.096] (-469.403) * [-468.144] (-469.178) (-469.659) (-470.310) -- 0:00:02
966500 -- [-468.164] (-469.230) (-473.964) (-469.532) * (-470.085) [-468.005] (-471.069) (-469.880) -- 0:00:02
967000 -- [-470.117] (-470.458) (-473.292) (-472.884) * (-470.967) (-472.182) [-470.734] (-470.237) -- 0:00:01
967500 -- [-468.591] (-471.715) (-468.094) (-468.041) * (-468.815) [-470.552] (-470.044) (-470.961) -- 0:00:01
968000 -- (-470.811) [-475.052] (-469.858) (-467.603) * (-469.599) (-470.167) [-470.583] (-467.833) -- 0:00:01
968500 -- (-478.231) (-476.080) (-474.727) [-469.374] * (-467.426) (-469.613) (-470.851) [-467.859] -- 0:00:01
969000 -- (-468.590) (-468.608) (-473.548) [-467.991] * (-473.213) (-468.641) (-469.059) [-469.417] -- 0:00:01
969500 -- (-472.875) (-469.776) [-470.616] (-470.128) * [-473.712] (-471.373) (-470.112) (-470.328) -- 0:00:01
970000 -- (-468.902) (-472.331) (-474.810) [-468.111] * (-469.869) [-467.245] (-472.788) (-469.253) -- 0:00:01
Average standard deviation of split frequencies: 0.004468
970500 -- (-468.149) [-470.975] (-471.006) (-468.026) * (-469.063) (-469.766) [-468.875] (-469.301) -- 0:00:01
971000 -- [-471.697] (-468.347) (-468.978) (-469.122) * [-474.337] (-470.408) (-468.539) (-469.586) -- 0:00:01
971500 -- (-469.605) (-467.737) [-468.255] (-471.804) * [-473.014] (-469.436) (-468.056) (-469.728) -- 0:00:01
972000 -- (-469.074) (-467.245) [-471.680] (-468.301) * (-470.673) [-469.159] (-468.457) (-469.267) -- 0:00:01
972500 -- (-467.558) [-467.943] (-467.418) (-468.301) * (-471.076) [-470.124] (-469.937) (-467.887) -- 0:00:01
973000 -- (-473.672) (-469.002) [-468.802] (-467.503) * (-470.301) [-467.966] (-467.575) (-470.779) -- 0:00:01
973500 -- (-474.749) (-469.154) [-472.297] (-468.664) * (-472.361) (-469.351) [-468.274] (-469.157) -- 0:00:01
974000 -- (-472.582) [-467.194] (-470.972) (-471.779) * [-467.180] (-469.751) (-468.704) (-469.533) -- 0:00:01
974500 -- (-468.618) (-467.087) (-471.149) [-469.457] * [-467.450] (-468.872) (-467.615) (-468.915) -- 0:00:01
975000 -- (-468.799) [-470.037] (-469.548) (-469.136) * (-467.172) (-468.288) (-468.994) [-468.964] -- 0:00:01
Average standard deviation of split frequencies: 0.004701
975500 -- (-467.800) (-467.555) [-467.642] (-467.686) * (-472.865) [-470.334] (-468.436) (-472.119) -- 0:00:01
976000 -- [-468.293] (-469.359) (-468.920) (-468.554) * (-475.833) [-470.454] (-471.439) (-469.064) -- 0:00:01
976500 -- [-468.910] (-468.183) (-470.604) (-471.577) * (-470.591) [-471.996] (-467.519) (-469.151) -- 0:00:01
977000 -- (-471.699) (-469.545) [-469.052] (-469.138) * (-468.620) [-467.957] (-468.193) (-470.656) -- 0:00:01
977500 -- (-470.195) (-469.867) (-472.212) [-468.787] * (-469.236) [-469.254] (-472.139) (-468.175) -- 0:00:01
978000 -- (-473.297) (-471.920) [-469.521] (-469.429) * (-469.375) [-468.884] (-468.025) (-470.432) -- 0:00:01
978500 -- (-473.308) (-471.608) [-468.762] (-467.683) * (-470.570) (-466.856) (-468.396) [-470.599] -- 0:00:01
979000 -- (-469.186) [-469.409] (-467.784) (-469.032) * (-469.973) [-467.437] (-468.950) (-469.306) -- 0:00:01
979500 -- (-468.839) (-467.408) [-467.919] (-467.772) * (-469.437) [-469.118] (-470.552) (-469.789) -- 0:00:01
980000 -- (-468.302) [-470.213] (-468.983) (-467.891) * (-469.588) (-468.894) [-467.867] (-469.869) -- 0:00:01
Average standard deviation of split frequencies: 0.004326
980500 -- (-470.889) (-467.949) (-469.619) [-468.385] * [-469.191] (-469.743) (-468.077) (-469.071) -- 0:00:01
981000 -- (-468.569) (-470.256) (-468.589) [-468.466] * (-468.978) [-471.041] (-467.553) (-471.257) -- 0:00:01
981500 -- (-473.022) (-472.585) (-471.218) [-471.560] * (-469.759) (-470.542) (-469.391) [-468.834] -- 0:00:01
982000 -- (-470.625) [-471.431] (-472.835) (-470.900) * (-473.042) (-470.603) [-470.648] (-470.423) -- 0:00:01
982500 -- (-472.203) (-471.928) [-467.634] (-473.325) * (-469.618) (-469.830) [-469.301] (-467.462) -- 0:00:01
983000 -- (-467.396) (-468.979) [-468.257] (-470.524) * (-475.094) (-472.003) (-473.205) [-468.476] -- 0:00:01
983500 -- [-468.673] (-468.399) (-470.691) (-469.028) * (-467.420) (-470.981) (-469.377) [-468.997] -- 0:00:00
984000 -- [-468.499] (-472.201) (-467.512) (-473.290) * (-468.938) [-468.632] (-475.666) (-472.803) -- 0:00:00
984500 -- (-466.937) (-468.958) (-467.462) [-471.456] * (-468.557) [-468.612] (-474.108) (-473.773) -- 0:00:00
985000 -- (-466.937) (-469.103) [-474.219] (-467.827) * (-467.713) [-468.875] (-471.873) (-469.834) -- 0:00:00
Average standard deviation of split frequencies: 0.004303
985500 -- [-468.266] (-472.047) (-469.587) (-468.075) * (-469.705) [-468.766] (-469.309) (-469.038) -- 0:00:00
986000 -- (-471.785) (-469.115) (-473.035) [-467.636] * (-475.215) (-468.639) [-471.628] (-476.068) -- 0:00:00
986500 -- (-470.859) (-468.193) [-471.771] (-470.403) * (-471.578) [-467.749] (-470.757) (-476.090) -- 0:00:00
987000 -- (-477.328) (-468.007) [-469.438] (-472.604) * (-471.057) [-467.842] (-468.637) (-469.463) -- 0:00:00
987500 -- (-467.826) (-469.697) [-468.252] (-469.027) * (-475.560) [-467.817] (-469.252) (-469.508) -- 0:00:00
988000 -- (-468.237) (-472.243) (-469.427) [-469.154] * (-473.042) [-468.044] (-467.691) (-469.612) -- 0:00:00
988500 -- [-469.148] (-468.547) (-471.466) (-468.534) * (-472.411) (-469.382) [-468.540] (-471.211) -- 0:00:00
989000 -- (-469.842) (-471.951) [-469.046] (-470.202) * (-469.233) [-469.635] (-468.540) (-470.646) -- 0:00:00
989500 -- (-468.926) (-471.517) (-470.329) [-470.092] * (-468.223) [-469.908] (-469.202) (-470.587) -- 0:00:00
990000 -- (-470.004) (-468.911) (-471.423) [-469.501] * (-468.190) [-472.856] (-469.168) (-470.065) -- 0:00:00
Average standard deviation of split frequencies: 0.004314
990500 -- (-471.257) [-468.621] (-473.391) (-470.457) * [-471.286] (-469.833) (-467.662) (-468.098) -- 0:00:00
991000 -- (-471.400) (-470.473) (-469.543) [-468.376] * [-471.155] (-472.701) (-470.495) (-473.794) -- 0:00:00
991500 -- (-469.254) (-467.764) (-470.641) [-468.841] * (-469.798) (-471.646) (-471.072) [-468.333] -- 0:00:00
992000 -- [-469.363] (-469.565) (-474.163) (-470.646) * (-469.353) (-469.854) [-473.027] (-471.714) -- 0:00:00
992500 -- (-468.348) (-469.448) (-471.267) [-469.121] * (-470.569) (-469.796) (-469.747) [-469.146] -- 0:00:00
993000 -- (-468.059) (-469.327) [-467.110] (-468.408) * (-467.337) (-468.900) (-468.052) [-467.943] -- 0:00:00
993500 -- (-469.566) (-468.235) (-469.654) [-470.030] * (-467.432) (-469.419) [-469.177] (-471.395) -- 0:00:00
994000 -- (-471.246) (-468.345) (-472.566) [-471.342] * (-469.286) (-472.067) (-469.230) [-468.652] -- 0:00:00
994500 -- (-468.812) (-470.421) [-467.448] (-472.299) * [-469.927] (-469.521) (-474.109) (-468.429) -- 0:00:00
995000 -- (-470.612) (-470.783) [-467.547] (-467.449) * (-472.754) [-467.981] (-470.818) (-468.372) -- 0:00:00
Average standard deviation of split frequencies: 0.004165
995500 -- [-467.858] (-471.951) (-468.477) (-468.126) * (-468.847) (-469.744) (-470.610) [-468.644] -- 0:00:00
996000 -- (-469.863) [-470.832] (-469.360) (-469.803) * (-471.007) (-469.078) [-470.204] (-470.437) -- 0:00:00
996500 -- (-472.235) (-471.574) [-468.567] (-470.542) * [-468.796] (-473.234) (-468.025) (-468.887) -- 0:00:00
997000 -- [-467.058] (-476.543) (-471.229) (-470.682) * (-470.401) (-468.387) [-467.870] (-467.935) -- 0:00:00
997500 -- [-467.672] (-467.656) (-472.056) (-471.106) * [-468.008] (-468.877) (-469.227) (-469.833) -- 0:00:00
998000 -- (-467.185) (-468.006) [-469.891] (-470.965) * [-470.513] (-467.759) (-468.935) (-471.755) -- 0:00:00
998500 -- (-468.332) [-467.927] (-467.986) (-472.180) * (-470.057) [-467.306] (-468.626) (-469.235) -- 0:00:00
999000 -- [-468.881] (-468.824) (-469.210) (-471.593) * (-467.444) [-468.197] (-468.371) (-470.471) -- 0:00:00
999500 -- (-468.626) [-467.319] (-467.685) (-470.852) * (-467.607) [-469.189] (-468.499) (-472.723) -- 0:00:00
1000000 -- (-470.858) (-468.411) (-467.794) [-468.312] * (-469.770) [-469.631] (-468.148) (-471.629) -- 0:00:00
Average standard deviation of split frequencies: 0.004240
Analysis completed in 60 seconds
Analysis used 58.29 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -466.82
Likelihood of best state for "cold" chain of run 2 was -466.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
37.7 % ( 28 %) Dirichlet(Pi{all})
37.2 % ( 21 %) Slider(Pi{all})
78.4 % ( 58 %) Multiplier(Alpha{1,2})
77.5 % ( 53 %) Multiplier(Alpha{3})
25.3 % ( 19 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
37.8 % ( 30 %) Dirichlet(Pi{all})
36.9 % ( 34 %) Slider(Pi{all})
78.3 % ( 57 %) Multiplier(Alpha{1,2})
77.7 % ( 46 %) Multiplier(Alpha{3})
26.3 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.5 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167459 0.82 0.66
3 | 166139 166658 0.84
4 | 166291 167098 166355
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166629 0.82 0.67
3 | 166847 166491 0.84
4 | 166605 166943 166485
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -468.45
| 1 |
| |
| 22 2 1 1 1|
| 2 2 1 2 1 2 2 |
|1 1 1 2* 1 1 2 * 2 |
| 1 11222 2 2 2 1 2 |
| 2 11 1 1 1 1 21 2 2 |
| 11 1 2 1 22 2 1 1 1 1 22|
| 112 2 11 1 111 2* 12 1* 12 1 2121 |
|2221 1 2 2 2 12 2 12 1 |
| 2 |
| 2 2 1 2 12 |
| 2 2 2 1 |
| 22 1 1 2 |
| 1 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -470.16
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -468.56 -472.54
2 -468.56 -473.01
--------------------------------------
TOTAL -468.56 -472.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889632 0.092964 0.375249 1.527400 0.858246 1288.83 1368.78 1.000
r(A<->C){all} 0.167578 0.020116 0.000203 0.460621 0.128932 214.11 237.14 1.007
r(A<->G){all} 0.166835 0.021129 0.000056 0.459919 0.127423 161.00 200.52 1.001
r(A<->T){all} 0.173453 0.021744 0.000122 0.474918 0.134752 201.54 233.16 1.004
r(C<->G){all} 0.165503 0.019072 0.000015 0.436211 0.133180 236.09 314.96 1.006
r(C<->T){all} 0.157954 0.018170 0.000070 0.426540 0.124090 293.49 318.34 1.001
r(G<->T){all} 0.168676 0.020191 0.000068 0.456560 0.131500 196.91 219.23 1.005
pi(A){all} 0.236229 0.000526 0.192468 0.280872 0.236064 1222.30 1304.13 1.000
pi(C){all} 0.264594 0.000562 0.220506 0.312474 0.263857 946.14 1171.52 1.000
pi(G){all} 0.294877 0.000595 0.245303 0.340872 0.294593 1344.23 1370.53 1.000
pi(T){all} 0.204299 0.000465 0.162946 0.246024 0.204197 1342.37 1351.84 1.000
alpha{1,2} 0.420074 0.243507 0.000204 1.421974 0.245043 1322.60 1358.87 1.000
alpha{3} 0.442315 0.208727 0.000158 1.388597 0.299092 1135.12 1169.08 1.000
pinvar{all} 0.995142 0.000039 0.984661 0.999998 0.996992 907.33 1176.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- .*.*..
9 -- ..*..*
10 -- ..****
11 -- .**.**
12 -- ...*.*
13 -- .***.*
14 -- .**...
15 -- ..*.*.
16 -- .*..*.
17 -- ...**.
18 -- .*...*
19 -- ..**..
20 -- .****.
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 461 0.153564 0.000471 0.153231 0.153897 2
8 455 0.151566 0.006124 0.147235 0.155896 2
9 454 0.151233 0.000942 0.150566 0.151899 2
10 453 0.150899 0.008009 0.145237 0.156562 2
11 447 0.148901 0.005182 0.145237 0.152565 2
12 446 0.148568 0.000942 0.147901 0.149234 2
13 442 0.147235 0.006595 0.142572 0.151899 2
14 430 0.143238 0.006595 0.138574 0.147901 2
15 428 0.142572 0.000942 0.141905 0.143238 2
16 418 0.139241 0.003769 0.136576 0.141905 2
17 406 0.135243 0.000000 0.135243 0.135243 2
18 406 0.135243 0.000942 0.134577 0.135909 2
19 403 0.134244 0.010835 0.126582 0.141905 2
20 397 0.132245 0.008009 0.126582 0.137908 2
21 393 0.130913 0.004240 0.127915 0.133911 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097368 0.009797 0.000055 0.294063 0.066475 1.000 2
length{all}[2] 0.098747 0.010372 0.000009 0.298168 0.067403 1.001 2
length{all}[3] 0.097384 0.009651 0.000004 0.295450 0.064866 1.000 2
length{all}[4] 0.100294 0.010442 0.000028 0.304725 0.069834 1.000 2
length{all}[5] 0.098107 0.009098 0.000003 0.293270 0.069682 1.000 2
length{all}[6] 0.098115 0.009612 0.000016 0.289896 0.070236 1.000 2
length{all}[7] 0.105480 0.011361 0.000098 0.332835 0.070988 0.998 2
length{all}[8] 0.099282 0.011162 0.000302 0.286533 0.066956 0.998 2
length{all}[9] 0.098825 0.009861 0.000066 0.287910 0.068097 1.008 2
length{all}[10] 0.100404 0.008824 0.000406 0.297671 0.074755 0.999 2
length{all}[11] 0.096766 0.008358 0.000073 0.292256 0.071247 1.001 2
length{all}[12] 0.091095 0.009268 0.000057 0.270808 0.059505 1.002 2
length{all}[13] 0.096832 0.010253 0.000020 0.274716 0.064561 1.006 2
length{all}[14] 0.094946 0.010282 0.000126 0.304362 0.065664 0.999 2
length{all}[15] 0.105423 0.010582 0.000031 0.329088 0.074851 0.998 2
length{all}[16] 0.093366 0.008755 0.000168 0.272654 0.060707 0.999 2
length{all}[17] 0.098329 0.008540 0.000482 0.288397 0.070137 0.998 2
length{all}[18] 0.102603 0.010488 0.000133 0.321542 0.070349 0.999 2
length{all}[19] 0.101216 0.010046 0.000093 0.298999 0.065805 0.998 2
length{all}[20] 0.105210 0.009287 0.000037 0.315149 0.074061 1.000 2
length{all}[21] 0.095326 0.008428 0.000044 0.268535 0.067334 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004240
Maximum standard deviation of split frequencies = 0.010835
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 339
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 113 / 113 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 113 / 113 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101202 0.010304 0.013930 0.069424 0.094149 0.010632 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -486.125578
Iterating by ming2
Initial: fx= 486.125578
x= 0.10120 0.01030 0.01393 0.06942 0.09415 0.01063 0.30000 1.30000
1 h-m-p 0.0000 0.0001 272.4109 ++ 479.291157 m 0.0001 13 | 1/8
2 h-m-p 0.0007 0.0453 32.8554 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 248.7694 ++ 479.109902 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0547 27.2888 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 222.0864 ++ 477.655242 m 0.0000 74 | 3/8
6 h-m-p 0.0003 0.0699 21.1110 ----------.. | 3/8
7 h-m-p 0.0000 0.0005 191.8463 +++ 459.146672 m 0.0005 105 | 4/8
8 h-m-p 0.0046 0.0910 17.0052 ------------.. | 4/8
9 h-m-p 0.0000 0.0002 157.8261 +++ 453.556793 m 0.0002 138 | 5/8
10 h-m-p 0.0018 0.1280 13.6690 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 111.9883 ++ 452.754226 m 0.0001 170 | 6/8
12 h-m-p 0.8304 8.0000 0.0000 ++ 452.754226 m 8.0000 181 | 6/8
13 h-m-p 0.0654 8.0000 0.0001 ++++ 452.754226 m 8.0000 196 | 6/8
14 h-m-p 0.0209 8.0000 0.0295 -----Y 452.754226 0 0.0000 214 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 +++++ 452.754226 m 8.0000 230 | 6/8
16 h-m-p 0.0160 8.0000 0.0421 +++++ 452.754224 m 8.0000 246 | 6/8
17 h-m-p 0.3988 1.9940 0.3725 ---------------.. | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 452.754224 m 8.0000 288 | 6/8
19 h-m-p 0.0010 0.4853 6.4126 ++++Y 452.754210 0 0.1771 305 | 6/8
20 h-m-p 1.6000 8.0000 0.1572 Y 452.754210 0 0.9800 316 | 6/8
21 h-m-p 1.6000 8.0000 0.0078 Y 452.754210 0 0.9781 329 | 6/8
22 h-m-p 1.6000 8.0000 0.0001 ++ 452.754210 m 8.0000 342 | 6/8
23 h-m-p 0.0808 8.0000 0.0092 ++Y 452.754210 0 2.0902 357 | 6/8
24 h-m-p 1.6000 8.0000 0.0011 ++ 452.754210 m 8.0000 370 | 6/8
25 h-m-p 0.0321 6.1351 0.2810 -------C 452.754210 0 0.0000 390 | 6/8
26 h-m-p 0.0160 8.0000 0.8520 +++++ 452.754176 m 8.0000 406 | 6/8
27 h-m-p 0.0705 0.3524 24.1581 --------------.. | 6/8
28 h-m-p 0.0160 8.0000 0.0000 +++++ 452.754176 m 8.0000 445 | 6/8
29 h-m-p 0.0221 8.0000 0.0049 -------C 452.754176 0 0.0000 465 | 6/8
30 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
31 h-m-p 0.0160 8.0000 0.0000 +++++ 452.754176 m 8.0000 505 | 6/8
32 h-m-p 0.0160 8.0000 0.8135 +++++ 452.754150 m 8.0000 521 | 6/8
33 h-m-p 1.6000 8.0000 0.7443 ++ 452.754144 m 8.0000 534 | 6/8
34 h-m-p 0.9778 8.0000 6.0895 ++ 452.754128 m 8.0000 547 | 6/8
35 h-m-p 1.6000 8.0000 13.4145 ++ 452.754118 m 8.0000 558 | 6/8
36 h-m-p 1.2915 8.0000 83.0916 ++ 452.754108 m 8.0000 569 | 6/8
37 h-m-p 0.5054 2.5270 67.8755 ++ 452.754108 m 2.5270 580 | 6/8
38 h-m-p 0.0000 0.0000 34.1137
h-m-p: 0.00000000e+00 0.00000000e+00 3.41136793e+01 452.754108
.. | 6/8
39 h-m-p 0.0160 8.0000 0.0000 -------N 452.754108 0 0.0000 606
Out..
lnL = -452.754108
607 lfun, 607 eigenQcodon, 3642 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.055014 0.091266 0.103864 0.036556 0.020615 0.085481 133.220158 0.589865 0.191619
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.199599
np = 9
lnL0 = -494.768833
Iterating by ming2
Initial: fx= 494.768833
x= 0.05501 0.09127 0.10386 0.03656 0.02062 0.08548 133.22016 0.58986 0.19162
1 h-m-p 0.0000 0.0002 250.8605 +++ 482.211967 m 0.0002 15 | 1/9
2 h-m-p 0.0003 0.0013 91.6789 ++ 473.308864 m 0.0013 27 | 2/9
3 h-m-p 0.0000 0.0001 1662.8235 ++ 466.547256 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 1497.5273 ++ 466.373857 m 0.0000 51 | 4/9
5 h-m-p 0.0001 0.0053 14.5525 ---------.. | 4/9
6 h-m-p 0.0000 0.0003 183.8084 +++ 455.762022 m 0.0003 83 | 5/9
7 h-m-p 0.0160 0.2175 2.8577 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 157.5205 ++ 454.332473 m 0.0001 118 | 6/9
9 h-m-p 0.0008 0.0755 7.8440 -----------.. | 6/9
10 h-m-p 0.0000 0.0001 111.7871 ++ 452.754254 m 0.0001 151 | 7/9
11 h-m-p 1.6000 8.0000 0.0000 ++ 452.754254 m 8.0000 163 | 6/9
12 h-m-p 0.0160 8.0000 0.0078 +++++ 452.754244 m 8.0000 180 | 6/9
13 h-m-p 0.1723 1.4822 0.3637 ++ 452.754196 m 1.4822 195 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 +Y 452.754196 0 6.4000 211 | 7/9
15 h-m-p 0.1349 8.0000 0.0002 ----Y 452.754196 0 0.0001 229
Out..
lnL = -452.754196
230 lfun, 690 eigenQcodon, 2760 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.013435 0.038477 0.108597 0.010373 0.059790 0.045741 133.281431 0.805866 0.178266 0.309660 1098.072655
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000944
np = 11
lnL0 = -469.911161
Iterating by ming2
Initial: fx= 469.911161
x= 0.01343 0.03848 0.10860 0.01037 0.05979 0.04574 133.28143 0.80587 0.17827 0.30966 951.42857
1 h-m-p 0.0000 0.0003 86.5355 +++ 467.643497 m 0.0003 17 | 1/11
2 h-m-p 0.0019 0.0932 10.9285 +++ 458.065179 m 0.0932 32 | 2/11
3 h-m-p 0.0001 0.0003 399.2331 ++ 456.395629 m 0.0003 46 | 3/11
4 h-m-p 0.0000 0.0002 1234.5808 ++ 455.568418 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0000 2599651.6747 ++ 455.246865 m 0.0000 74 | 5/11
6 h-m-p 0.0005 0.0060 596.0728 ++ 452.754130 m 0.0060 88 | 6/11
7 h-m-p 1.6000 8.0000 0.0001 ++ 452.754130 m 8.0000 102 | 6/11
8 h-m-p 0.0160 8.0000 0.1411 +++++ 452.754117 m 8.0000 124 | 6/11
9 h-m-p 1.3444 8.0000 0.8396 ++ 452.754108 m 8.0000 143 | 6/11
10 h-m-p 1.6000 8.0000 0.0347 ++ 452.754108 m 8.0000 162 | 6/11
11 h-m-p 0.2097 7.4436 1.3223 +++ 452.754108 m 7.4436 182 | 6/11
12 h-m-p 1.3530 6.7649 3.5130 -----Y 452.754108 0 0.0002 201 | 6/11
13 h-m-p 0.5655 2.8276 0.0002 N 452.754108 0 0.5655 215 | 6/11
14 h-m-p 1.6000 8.0000 0.0000 --C 452.754108 0 0.0250 236
Out..
lnL = -452.754108
237 lfun, 948 eigenQcodon, 4266 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -452.751543 S = -452.751537 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059438 0.058911 0.066056 0.034458 0.086328 0.109877 133.283115 0.380451 1.582381
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.295921
np = 9
lnL0 = -498.287164
Iterating by ming2
Initial: fx= 498.287164
x= 0.05944 0.05891 0.06606 0.03446 0.08633 0.10988 133.28312 0.38045 1.58238
1 h-m-p 0.0000 0.0003 257.4690 +++ 476.639371 m 0.0003 15 | 1/9
2 h-m-p 0.0042 0.1435 17.8663 ------------.. | 1/9
3 h-m-p 0.0000 0.0002 244.3251 +++ 462.905539 m 0.0002 50 | 2/9
4 h-m-p 0.0031 0.2227 16.1671 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 224.6099 ++ 462.662154 m 0.0000 84 | 3/9
6 h-m-p 0.0006 0.3065 14.2983 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 193.6030 ++ 460.372940 m 0.0001 117 | 4/9
8 h-m-p 0.0009 0.4058 10.8550 -----------.. | 4/9
9 h-m-p 0.0000 0.0002 157.8975 +++ 455.616468 m 0.0002 151 | 5/9
10 h-m-p 0.0026 0.6248 7.9782 ------------.. | 5/9
11 h-m-p 0.0000 0.0002 112.8484 +++ 452.754300 m 0.0002 186 | 6/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 452.754300 m 8.0000 198 | 6/9
13 h-m-p 0.0160 8.0000 0.0016 +++++ 452.754300 m 8.0000 216 | 6/9
14 h-m-p 0.0160 8.0000 0.7932 +++++ 452.754295 m 8.0000 234 | 6/9
15 h-m-p 1.6000 8.0000 0.3456 ++ 452.754294 m 8.0000 249 | 6/9
16 h-m-p 0.7523 8.0000 3.6748 ++ 452.754293 m 8.0000 264 | 6/9
17 h-m-p 1.6000 8.0000 5.6134 ++ 452.754293 m 8.0000 276 | 6/9
18 h-m-p 1.6000 8.0000 0.5057 -------Y 452.754293 0 0.0000 295 | 6/9
19 h-m-p 1.1131 8.0000 0.0000 N 452.754293 0 1.1131 310 | 6/9
20 h-m-p 0.0649 8.0000 0.0002 --------------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0000 ------------Y 452.754293 0 0.0000 364
Out..
lnL = -452.754293
365 lfun, 4015 eigenQcodon, 21900 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054303 0.052292 0.061045 0.012979 0.088864 0.089711 133.241512 0.900000 1.001444 1.935128 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.002120
np = 11
lnL0 = -463.588548
Iterating by ming2
Initial: fx= 463.588548
x= 0.05430 0.05229 0.06104 0.01298 0.08886 0.08971 133.24151 0.90000 1.00144 1.93513 951.42857
1 h-m-p 0.0000 0.0012 88.5431 +++YYCYCYCCC 456.444619 8 0.0010 32 | 0/11
2 h-m-p 0.0002 0.0008 15.4151 ++ 456.273151 m 0.0008 46 | 1/11
3 h-m-p 0.0004 0.0043 25.6917 ++ 454.466386 m 0.0043 60 | 2/11
4 h-m-p 0.0017 0.0084 4.2095 ++ 454.129629 m 0.0084 74 | 3/11
5 h-m-p 0.0005 0.0024 9.6014 ++ 453.038029 m 0.0024 88 | 4/11
6 h-m-p 0.0003 0.0014 3.3360 ++ 452.968443 m 0.0014 102 | 5/11
7 h-m-p 0.0365 6.6556 0.1026 --------------.. | 5/11
8 h-m-p 0.0000 0.0000 86.4618 ++ 452.754114 m 0.0000 148 | 6/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 452.754114 m 8.0000 162 | 6/11
10 h-m-p 0.0160 8.0000 0.0002 +++++ 452.754114 m 8.0000 184 | 6/11
11 h-m-p 0.0160 8.0000 0.1363 +++++ 452.754109 m 8.0000 206 | 6/11
12 h-m-p 1.6000 8.0000 0.0463 ++ 452.754108 m 8.0000 225 | 6/11
13 h-m-p 0.0992 0.4962 0.5969 ++ 452.754108 m 0.4962 244
QuantileBeta(0.15, 0.00494, 0.50544) = 1.919278e-161 2000 rounds
| 6/11
14 h-m-p 0.0000 0.0000 0.8188
h-m-p: 1.88517807e-18 9.42589033e-18 8.18834186e-01 452.754108
..
QuantileBeta(0.15, 0.00494, 0.50544) = 1.919278e-161 2000 rounds
| 6/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 452.754108 m 8.0000 282
QuantileBeta(0.15, 0.00494, 0.50544) = 1.920460e-161 2000 rounds
| 6/11
16 h-m-p 0.0160 8.0000 0.0463 +++++ 452.754108 m 8.0000 304 | 6/11
17 h-m-p 1.6000 8.0000 0.0221 ++ 452.754108 m 8.0000 323 | 6/11
18 h-m-p 0.3299 1.6495 0.2050 ++ 452.754108 m 1.6495 342 | 7/11
19 h-m-p 0.0160 8.0000 0.4851 +++++ 452.754107 m 8.0000 364 | 7/11
20 h-m-p 0.0564 8.0000 68.7895 ++++ 452.754105 m 8.0000 384 | 7/11
21 h-m-p 0.4956 2.4780 112.6444 ++ 452.754105 m 2.4780 398 | 7/11
22 h-m-p 0.0000 0.0000 190.1757
h-m-p: 0.00000000e+00 0.00000000e+00 1.90175739e+02 452.754105
.. | 7/11
23 h-m-p 0.0160 8.0000 0.0000 Y 452.754105 0 0.0160 423 | 8/11
24 h-m-p 1.6000 8.0000 0.0000 ---Y 452.754105 0 0.0063 444
Out..
lnL = -452.754105
445 lfun, 5340 eigenQcodon, 29370 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -452.751545 S = -452.751537 -0.000004
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:17
did 20 / 48 patterns 0:17
did 30 / 48 patterns 0:17
did 40 / 48 patterns 0:17
did 48 / 48 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.02 sec, SCORE=100, Nseq=6, Len=113
NC_011896_1_WP_010907484_1_41_MLBR_RS00210 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
NC_002677_1_NP_301159_1_31_ML0044 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ
**************************************************
NC_011896_1_WP_010907484_1_41_MLBR_RS00210 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
NC_002677_1_NP_301159_1_31_ML0044 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220 WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL
**************************************************
NC_011896_1_WP_010907484_1_41_MLBR_RS00210 SALSCSIGEPPPT
NC_002677_1_NP_301159_1_31_ML0044 SALSCSIGEPPPT
NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560 SALSCSIGEPPPT
NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995 SALSCSIGEPPPT
NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210 SALSCSIGEPPPT
NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220 SALSCSIGEPPPT
*************
>NC_011896_1_WP_010907484_1_41_MLBR_RS00210 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT >NC_002677_1_NP_301159_1_31_ML0044 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT >NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT >NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT >NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT >NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220 ATGGATTTGGATCCAACGCAAGCTCAGACAATGGCTCTGCTGGGGCAATT TCAGTCTGCTCTGGACGAGCAGTGTAACCGAATGACTGACGGAGTGTTCA AGGCTTCGGATCAAGAAAAGACCGTCGAAGTAACGATCAACGGCTATCAG TGGCTCACCGGTATCCGTATCGAAAGTGGCGCTTTGCGGGAGTTTGGCCA CGCAGTAGTCGCCGATAGGATCAACGAAGCCTTGCAGAACGCGCAGGGCG TGGCAACCGCTTACAACGAAGTCTCGGGTGAGCAGCTCGCCGCAAGGTTG TCCGCCCTTTCTTGCTCAATCGGCGAACCGCCGCCGACT
>NC_011896_1_WP_010907484_1_41_MLBR_RS00210 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT >NC_002677_1_NP_301159_1_31_ML0044 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT >NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT >NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT >NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT >NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220 MDLDPTQAQTMALLGQFQSALDEQCNRMTDGVFKASDQEKTVEVTINGYQ WLTGIRIESGALREFGHAVVADRINEALQNAQGVATAYNEVSGEQLAARL SALSCSIGEPPPT
#NEXUS
[ID: 0839200284]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907484_1_41_MLBR_RS00210
NC_002677_1_NP_301159_1_31_ML0044
NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560
NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995
NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210
NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907484_1_41_MLBR_RS00210,
2 NC_002677_1_NP_301159_1_31_ML0044,
3 NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560,
4 NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995,
5 NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210,
6 NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06647464,2:0.06740321,3:0.06486634,4:0.0698343,5:0.0696817,6:0.07023604);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06647464,2:0.06740321,3:0.06486634,4:0.0698343,5:0.0696817,6:0.07023604);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -468.56 -472.54
2 -468.56 -473.01
--------------------------------------
TOTAL -468.56 -472.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0044/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.889632 0.092964 0.375249 1.527400 0.858246 1288.83 1368.78 1.000
r(A<->C){all} 0.167578 0.020116 0.000203 0.460621 0.128932 214.11 237.14 1.007
r(A<->G){all} 0.166835 0.021129 0.000056 0.459919 0.127423 161.00 200.52 1.001
r(A<->T){all} 0.173453 0.021744 0.000122 0.474918 0.134752 201.54 233.16 1.004
r(C<->G){all} 0.165503 0.019072 0.000015 0.436211 0.133180 236.09 314.96 1.006
r(C<->T){all} 0.157954 0.018170 0.000070 0.426540 0.124090 293.49 318.34 1.001
r(G<->T){all} 0.168676 0.020191 0.000068 0.456560 0.131500 196.91 219.23 1.005
pi(A){all} 0.236229 0.000526 0.192468 0.280872 0.236064 1222.30 1304.13 1.000
pi(C){all} 0.264594 0.000562 0.220506 0.312474 0.263857 946.14 1171.52 1.000
pi(G){all} 0.294877 0.000595 0.245303 0.340872 0.294593 1344.23 1370.53 1.000
pi(T){all} 0.204299 0.000465 0.162946 0.246024 0.204197 1342.37 1351.84 1.000
alpha{1,2} 0.420074 0.243507 0.000204 1.421974 0.245043 1322.60 1358.87 1.000
alpha{3} 0.442315 0.208727 0.000158 1.388597 0.299092 1135.12 1169.08 1.000
pinvar{all} 0.995142 0.000039 0.984661 0.999998 0.996992 907.33 1176.20 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0044/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 113
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 1 1 1 1 1 1
CTG 3 3 3 3 3 3 | CCG 3 3 3 3 3 3 | CAG 7 7 7 7 7 7 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 5 5 5 5 5 5 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 6 6 6 6 6 6 | Asp GAT 4 4 4 4 4 4 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 3 | GCC 4 4 4 4 4 4 | GAC 2 2 2 2 2 2 | GGC 5 5 5 5 5 5
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 6 6 6 6 6 6 | GGA 1 1 1 1 1 1
GTG 2 2 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907484_1_41_MLBR_RS00210
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
#2: NC_002677_1_NP_301159_1_31_ML0044
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
#3: NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
#4: NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
#5: NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
#6: NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 6
TTC 6 | TCC 6 | TAC 6 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 6 | CGC 0
CTA 0 | CCA 6 | Gln Q CAA 18 | CGA 6
CTG 18 | CCG 18 | CAG 42 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 30 | ACC 18 | AAC 30 | AGC 0
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 12 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 36 | Asp D GAT 24 | Gly G GGT 12
GTC 18 | GCC 24 | GAC 12 | GGC 30
GTA 12 | GCA 18 | Glu E GAA 36 | GGA 6
GTG 12 | GCG 6 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15929 C:0.21239 A:0.23009 G:0.39823
position 2: T:0.24779 C:0.28319 A:0.30973 G:0.15929
position 3: T:0.20354 C:0.30088 A:0.16814 G:0.32743
Average T:0.20354 C:0.26549 A:0.23599 G:0.29499
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -452.754108 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.220158 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907484_1_41_MLBR_RS00210: 0.000004, NC_002677_1_NP_301159_1_31_ML0044: 0.000004, NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560: 0.000004, NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995: 0.000004, NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210: 0.000004, NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.22016
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 226.6 112.4 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -452.754196 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.281431 0.000010 0.090716
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907484_1_41_MLBR_RS00210: 0.000004, NC_002677_1_NP_301159_1_31_ML0044: 0.000004, NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560: 0.000004, NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995: 0.000004, NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210: 0.000004, NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.28143
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.09072 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 226.6 112.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -452.754108 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.283115 0.000023 0.005603 0.999980 951.432852
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907484_1_41_MLBR_RS00210: 0.000004, NC_002677_1_NP_301159_1_31_ML0044: 0.000004, NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560: 0.000004, NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995: 0.000004, NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210: 0.000004, NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.28312
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00002 0.00560 0.99437
w: 0.99998 1.00000 951.43285
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
7..2 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
7..3 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
7..4 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
7..5 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
7..6 0.000 226.6 112.4 946.0860 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907484_1_41_MLBR_RS00210)
Pr(w>1) post mean +- SE for w
1 M 0.994** 946.086
2 D 0.994** 946.086
3 L 0.994** 946.086
4 D 0.994** 946.086
5 P 0.994** 946.086
6 T 0.994** 946.086
7 Q 0.994** 946.086
8 A 0.994** 946.086
9 Q 0.994** 946.086
10 T 0.994** 946.086
11 M 0.994** 946.086
12 A 0.994** 946.086
13 L 0.994** 946.086
14 L 0.994** 946.086
15 G 0.994** 946.086
16 Q 0.994** 946.086
17 F 0.994** 946.086
18 Q 0.994** 946.086
19 S 0.994** 946.086
20 A 0.994** 946.086
21 L 0.994** 946.086
22 D 0.994** 946.086
23 E 0.994** 946.086
24 Q 0.994** 946.086
25 C 0.994** 946.086
26 N 0.994** 946.086
27 R 0.994** 946.086
28 M 0.994** 946.086
29 T 0.994** 946.086
30 D 0.994** 946.086
31 G 0.994** 946.086
32 V 0.994** 946.086
33 F 0.994** 946.086
34 K 0.994** 946.086
35 A 0.994** 946.086
36 S 0.994** 946.086
37 D 0.994** 946.086
38 Q 0.994** 946.086
39 E 0.994** 946.086
40 K 0.994** 946.086
41 T 0.994** 946.086
42 V 0.994** 946.086
43 E 0.994** 946.086
44 V 0.994** 946.086
45 T 0.994** 946.086
46 I 0.994** 946.086
47 N 0.994** 946.086
48 G 0.994** 946.086
49 Y 0.994** 946.086
50 Q 0.994** 946.086
51 W 0.994** 946.086
52 L 0.994** 946.086
53 T 0.994** 946.086
54 G 0.994** 946.086
55 I 0.994** 946.086
56 R 0.994** 946.086
57 I 0.994** 946.086
58 E 0.994** 946.086
59 S 0.994** 946.086
60 G 0.994** 946.086
61 A 0.994** 946.086
62 L 0.994** 946.086
63 R 0.994** 946.086
64 E 0.994** 946.086
65 F 0.994** 946.086
66 G 0.994** 946.086
67 H 0.994** 946.086
68 A 0.994** 946.086
69 V 0.994** 946.086
70 V 0.994** 946.086
71 A 0.994** 946.086
72 D 0.994** 946.086
73 R 0.994** 946.086
74 I 0.994** 946.086
75 N 0.994** 946.086
76 E 0.994** 946.086
77 A 0.994** 946.086
78 L 0.994** 946.086
79 Q 0.994** 946.086
80 N 0.994** 946.086
81 A 0.994** 946.086
82 Q 0.994** 946.086
83 G 0.994** 946.086
84 V 0.994** 946.086
85 A 0.994** 946.086
86 T 0.994** 946.086
87 A 0.994** 946.086
88 Y 0.994** 946.086
89 N 0.994** 946.086
90 E 0.994** 946.086
91 V 0.994** 946.086
92 S 0.994** 946.086
93 G 0.994** 946.086
94 E 0.994** 946.086
95 Q 0.994** 946.086
96 L 0.994** 946.086
97 A 0.994** 946.086
98 A 0.994** 946.086
99 R 0.994** 946.086
100 L 0.994** 946.086
101 S 0.994** 946.086
102 A 0.994** 946.086
103 L 0.994** 946.086
104 S 0.994** 946.086
105 C 0.994** 946.086
106 S 0.994** 946.086
107 I 0.994** 946.086
108 G 0.994** 946.086
109 E 0.994** 946.086
110 P 0.994** 946.086
111 P 0.994** 946.086
112 P 0.994** 946.086
113 T 0.994** 946.086
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907484_1_41_MLBR_RS00210)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -452.754293 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 133.241512 22.812731 81.939400
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907484_1_41_MLBR_RS00210: 0.000004, NC_002677_1_NP_301159_1_31_ML0044: 0.000004, NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560: 0.000004, NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995: 0.000004, NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210: 0.000004, NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 133.24151
Parameters in M7 (beta):
p = 22.81273 q = 81.93940
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.15493 0.17626 0.18966 0.20073 0.21094 0.22107 0.23176 0.24395 0.25959 0.28677
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
7..2 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
7..3 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
7..4 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
7..5 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
7..6 0.000 226.6 112.4 0.2176 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -452.754105 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 964.292665 0.000010 40.775041 15.133765 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907484_1_41_MLBR_RS00210: 0.000004, NC_002677_1_NP_301159_1_31_ML0044: 0.000004, NZ_LVXE01000042_1_WP_010907484_1_1864_A3216_RS10560: 0.000004, NZ_LYPH01000048_1_WP_010907484_1_1884_A8144_RS08995: 0.000004, NZ_CP029543_1_WP_010907484_1_39_DIJ64_RS00210: 0.000004, NZ_AP014567_1_WP_010907484_1_41_JK2ML_RS00220: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 964.29267
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 40.77504 q = 15.13376
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.62784 0.66771 0.69076 0.70875 0.72455 0.73949 0.75455 0.77083 0.79045 0.82138 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
7..2 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
7..3 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
7..4 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
7..5 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
7..6 0.000 226.0 113.0 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907484_1_41_MLBR_RS00210)
Pr(w>1) post mean +- SE for w
1 M 1.000** 998.990
2 D 1.000** 998.990
3 L 1.000** 998.990
4 D 1.000** 998.990
5 P 1.000** 998.990
6 T 1.000** 998.990
7 Q 1.000** 998.990
8 A 1.000** 998.990
9 Q 1.000** 998.990
10 T 1.000** 998.990
11 M 1.000** 998.990
12 A 1.000** 998.990
13 L 1.000** 998.990
14 L 1.000** 998.990
15 G 1.000** 998.990
16 Q 1.000** 998.990
17 F 1.000** 998.990
18 Q 1.000** 998.990
19 S 1.000** 998.990
20 A 1.000** 998.990
21 L 1.000** 998.990
22 D 1.000** 998.990
23 E 1.000** 998.990
24 Q 1.000** 998.990
25 C 1.000** 998.990
26 N 1.000** 998.990
27 R 1.000** 998.990
28 M 1.000** 998.990
29 T 1.000** 998.990
30 D 1.000** 998.990
31 G 1.000** 998.990
32 V 1.000** 998.990
33 F 1.000** 998.990
34 K 1.000** 998.990
35 A 1.000** 998.990
36 S 1.000** 998.990
37 D 1.000** 998.990
38 Q 1.000** 998.990
39 E 1.000** 998.990
40 K 1.000** 998.990
41 T 1.000** 998.990
42 V 1.000** 998.990
43 E 1.000** 998.990
44 V 1.000** 998.990
45 T 1.000** 998.990
46 I 1.000** 998.990
47 N 1.000** 998.990
48 G 1.000** 998.990
49 Y 1.000** 998.990
50 Q 1.000** 998.990
51 W 1.000** 998.990
52 L 1.000** 998.990
53 T 1.000** 998.990
54 G 1.000** 998.990
55 I 1.000** 998.990
56 R 1.000** 998.990
57 I 1.000** 998.990
58 E 1.000** 998.990
59 S 1.000** 998.990
60 G 1.000** 998.990
61 A 1.000** 998.990
62 L 1.000** 998.990
63 R 1.000** 998.990
64 E 1.000** 998.990
65 F 1.000** 998.990
66 G 1.000** 998.990
67 H 1.000** 998.990
68 A 1.000** 998.990
69 V 1.000** 998.990
70 V 1.000** 998.990
71 A 1.000** 998.990
72 D 1.000** 998.990
73 R 1.000** 998.990
74 I 1.000** 998.990
75 N 1.000** 998.990
76 E 1.000** 998.990
77 A 1.000** 998.990
78 L 1.000** 998.990
79 Q 1.000** 998.990
80 N 1.000** 998.990
81 A 1.000** 998.990
82 Q 1.000** 998.990
83 G 1.000** 998.990
84 V 1.000** 998.990
85 A 1.000** 998.990
86 T 1.000** 998.990
87 A 1.000** 998.990
88 Y 1.000** 998.990
89 N 1.000** 998.990
90 E 1.000** 998.990
91 V 1.000** 998.990
92 S 1.000** 998.990
93 G 1.000** 998.990
94 E 1.000** 998.990
95 Q 1.000** 998.990
96 L 1.000** 998.990
97 A 1.000** 998.990
98 A 1.000** 998.990
99 R 1.000** 998.990
100 L 1.000** 998.990
101 S 1.000** 998.990
102 A 1.000** 998.990
103 L 1.000** 998.990
104 S 1.000** 998.990
105 C 1.000** 998.990
106 S 1.000** 998.990
107 I 1.000** 998.990
108 G 1.000** 998.990
109 E 1.000** 998.990
110 P 1.000** 998.990
111 P 1.000** 998.990
112 P 1.000** 998.990
113 T 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907484_1_41_MLBR_RS00210)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17
Model 1: NearlyNeutral -452.754196 Model 2: PositiveSelection -452.754108 Model 0: one-ratio -452.754108 Model 7: beta -452.754293 Model 8: beta&w>1 -452.754105 Model 0 vs 1 1.7600000001039007E-4 Model 2 vs 1 1.7600000001039007E-4 Model 8 vs 7 3.760000000738728E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
