--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:13:50 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/ilvA/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1741.90 -1745.58 2 -1741.91 -1744.91 -------------------------------------- TOTAL -1741.91 -1745.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892609 0.090621 0.376092 1.499346 0.862304 1501.00 1501.00 1.000 r(A<->C){all} 0.167465 0.019251 0.000325 0.451616 0.131001 133.54 176.27 1.002 r(A<->G){all} 0.172965 0.020550 0.000075 0.449949 0.138593 171.71 215.68 1.001 r(A<->T){all} 0.166291 0.019788 0.000123 0.447315 0.127109 210.93 237.24 1.001 r(C<->G){all} 0.176521 0.018964 0.000032 0.441579 0.144619 198.58 233.72 1.005 r(C<->T){all} 0.154995 0.017359 0.000007 0.425802 0.119639 247.19 277.72 1.002 r(G<->T){all} 0.161763 0.018743 0.000017 0.438707 0.123377 283.58 296.99 1.005 pi(A){all} 0.182981 0.000114 0.163109 0.204994 0.182883 1234.20 1279.10 1.000 pi(C){all} 0.294045 0.000153 0.269543 0.317642 0.294062 916.83 1065.35 1.000 pi(G){all} 0.320808 0.000165 0.296321 0.345925 0.320760 1329.11 1364.75 1.001 pi(T){all} 0.202166 0.000123 0.180595 0.223715 0.201950 982.27 1169.76 1.000 alpha{1,2} 0.434463 0.230023 0.000237 1.389144 0.275668 977.70 985.94 1.000 alpha{3} 0.446450 0.227939 0.000151 1.404990 0.290641 1407.38 1450.14 1.000 pinvar{all} 0.998887 0.000002 0.996507 0.999999 0.999290 958.09 982.71 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1669.175483 Model 2: PositiveSelection -1669.175641 Model 0: one-ratio -1669.175702 Model 7: beta -1669.175483 Model 8: beta&w>1 -1669.175483 Model 0 vs 1 4.380000000310247E-4 Model 2 vs 1 3.160000001116714E-4 Model 8 vs 7 0.0
>C1 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C2 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C3 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C4 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C5 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C6 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=427 C1 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C2 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C3 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C4 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C5 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C6 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY ************************************************** C1 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C2 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C3 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C4 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C5 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C6 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR ************************************************** C1 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C2 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C3 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C4 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C5 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C6 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ************************************************** C1 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C2 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C3 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C4 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C5 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C6 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG ************************************************** C1 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C2 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C3 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C4 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C5 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C6 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN ************************************************** C1 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C2 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C3 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C4 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C5 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C6 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV ************************************************** C1 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C2 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C3 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C4 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C5 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C6 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP ************************************************** C1 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C2 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C3 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C4 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C5 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C6 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV ************************************************** C1 LLARMQGTEMHVETLQPGSPAYRYLLL C2 LLARMQGTEMHVETLQPGSPAYRYLLL C3 LLARMQGTEMHVETLQPGSPAYRYLLL C4 LLARMQGTEMHVETLQPGSPAYRYLLL C5 LLARMQGTEMHVETLQPGSPAYRYLLL C6 LLARMQGTEMHVETLQPGSPAYRYLLL *************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 427 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 427 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12810] Library Relaxation: Multi_proc [96] Relaxation Summary: [12810]--->[12810] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.541 Mb, Max= 31.012 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C2 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C3 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C4 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C5 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY C6 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY ************************************************** C1 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C2 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C3 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C4 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C5 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR C6 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR ************************************************** C1 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C2 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C3 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C4 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C5 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI C6 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ************************************************** C1 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C2 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C3 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C4 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C5 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG C6 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG ************************************************** C1 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C2 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C3 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C4 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C5 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN C6 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN ************************************************** C1 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C2 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C3 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C4 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C5 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV C6 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV ************************************************** C1 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C2 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C3 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C4 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C5 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP C6 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP ************************************************** C1 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C2 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C3 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C4 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C5 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV C6 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV ************************************************** C1 LLARMQGTEMHVETLQPGSPAYRYLLL C2 LLARMQGTEMHVETLQPGSPAYRYLLL C3 LLARMQGTEMHVETLQPGSPAYRYLLL C4 LLARMQGTEMHVETLQPGSPAYRYLLL C5 LLARMQGTEMHVETLQPGSPAYRYLLL C6 LLARMQGTEMHVETLQPGSPAYRYLLL *************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT C2 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT C3 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT C4 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT C5 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT C6 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT ************************************************** C1 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC C2 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC C3 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC C4 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC C5 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC C6 TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC ************************************************** C1 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC C2 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC C3 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC C4 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC C5 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC C6 CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC ************************************************** C1 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC C2 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC C3 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC C4 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC C5 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC C6 CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC ************************************************** C1 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG C2 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG C3 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG C4 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG C5 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG C6 CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG ************************************************** C1 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG C2 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG C3 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG C4 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG C5 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG C6 TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG ************************************************** C1 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA C2 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA C3 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA C4 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA C5 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA C6 TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA ************************************************** C1 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG C2 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG C3 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG C4 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG C5 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG C6 AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG ************************************************** C1 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT C2 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT C3 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT C4 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT C5 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT C6 TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT ************************************************** C1 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT C2 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT C3 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT C4 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT C5 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT C6 GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT ************************************************** C1 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG C2 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG C3 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG C4 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG C5 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG C6 CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG ************************************************** C1 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC C2 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC C3 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC C4 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC C5 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC C6 AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ************************************************** C1 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT C2 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT C3 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT C4 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT C5 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT C6 ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT ************************************************** C1 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC C2 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC C3 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC C4 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC C5 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC C6 CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC ************************************************** C1 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC C2 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC C3 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC C4 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC C5 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC C6 CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC ************************************************** C1 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT C2 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT C3 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT C4 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT C5 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT C6 CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT ************************************************** C1 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC C2 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC C3 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC C4 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC C5 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC C6 GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC ************************************************** C1 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA C2 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA C3 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA C4 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA C5 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA C6 TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA ************************************************** C1 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT C2 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT C3 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT C4 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT C5 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT C6 GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT ************************************************** C1 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC C2 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC C3 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC C4 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC C5 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC C6 GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC ************************************************** C1 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC C2 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC C3 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC C4 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC C5 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC C6 GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC ************************************************** C1 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA C2 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA C3 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA C4 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA C5 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA C6 CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA ************************************************** C1 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG C2 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG C3 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG C4 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG C5 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG C6 CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG ************************************************** C1 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC C2 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC C3 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC C4 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC C5 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC C6 GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC ************************************************** C1 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC C2 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC C3 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC C4 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC C5 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC C6 CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC ************************************************** C1 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT C2 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT C3 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT C4 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT C5 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT C6 AGGTTCGCCGGCCTACCGCTACCTGTTGCTT ******************************* >C1 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C2 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C3 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C4 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C5 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C6 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >C1 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C2 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C3 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C4 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C5 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >C6 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1281 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579792337 Setting output file names to "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 936634641 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0787061544 Seed = 1944010047 Swapseed = 1579792337 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2866.938973 -- -24.965149 Chain 2 -- -2866.938973 -- -24.965149 Chain 3 -- -2866.938973 -- -24.965149 Chain 4 -- -2866.939410 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2866.939244 -- -24.965149 Chain 2 -- -2866.939244 -- -24.965149 Chain 3 -- -2866.939244 -- -24.965149 Chain 4 -- -2866.939410 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2866.939] (-2866.939) (-2866.939) (-2866.939) * [-2866.939] (-2866.939) (-2866.939) (-2866.939) 500 -- [-1752.826] (-1772.152) (-1766.378) (-1772.358) * (-1779.040) (-1763.466) [-1764.217] (-1747.642) -- 0:00:00 1000 -- [-1749.617] (-1772.335) (-1773.650) (-1749.022) * (-1751.010) (-1753.309) [-1750.681] (-1752.777) -- 0:00:00 1500 -- (-1749.024) (-1755.866) (-1767.276) [-1749.948] * (-1748.122) [-1744.426] (-1752.609) (-1756.644) -- 0:00:00 2000 -- [-1751.285] (-1751.309) (-1760.043) (-1752.567) * (-1753.112) [-1754.325] (-1749.888) (-1750.780) -- 0:00:00 2500 -- (-1753.749) [-1753.120] (-1758.140) (-1751.394) * (-1748.871) (-1753.110) (-1750.079) [-1750.245] -- 0:00:00 3000 -- (-1748.907) (-1749.199) (-1748.260) [-1748.739] * [-1749.649] (-1749.495) (-1753.496) (-1758.307) -- 0:00:00 3500 -- [-1755.203] (-1758.077) (-1751.911) (-1750.484) * (-1751.198) (-1756.347) [-1749.141] (-1750.628) -- 0:00:00 4000 -- [-1751.167] (-1754.317) (-1755.818) (-1751.677) * (-1746.528) [-1748.859] (-1762.638) (-1750.420) -- 0:00:00 4500 -- (-1751.922) (-1749.877) [-1751.477] (-1748.782) * (-1750.793) (-1749.696) (-1754.806) [-1756.560] -- 0:00:00 5000 -- (-1749.483) (-1750.716) [-1753.117] (-1753.302) * [-1745.224] (-1752.702) (-1758.102) (-1748.725) -- 0:00:00 Average standard deviation of split frequencies: 0.089791 5500 -- (-1749.988) (-1750.439) (-1751.889) [-1746.850] * (-1750.983) (-1746.804) [-1745.433] (-1752.893) -- 0:00:00 6000 -- [-1748.919] (-1752.978) (-1757.027) (-1746.004) * (-1754.300) (-1754.766) [-1747.125] (-1756.381) -- 0:00:00 6500 -- [-1750.311] (-1751.691) (-1753.173) (-1759.145) * [-1755.798] (-1750.867) (-1753.603) (-1751.859) -- 0:00:00 7000 -- [-1751.959] (-1756.002) (-1751.796) (-1755.981) * [-1750.966] (-1748.680) (-1750.838) (-1761.395) -- 0:00:00 7500 -- (-1754.129) (-1753.309) (-1755.737) [-1750.211] * (-1759.064) (-1756.533) [-1756.833] (-1751.952) -- 0:00:00 8000 -- [-1752.530] (-1752.713) (-1751.135) (-1748.785) * (-1751.902) (-1754.131) [-1757.065] (-1754.130) -- 0:00:00 8500 -- (-1757.481) (-1751.762) [-1745.642] (-1745.581) * (-1747.129) (-1746.988) (-1753.742) [-1750.823] -- 0:01:56 9000 -- (-1750.268) (-1751.583) (-1751.604) [-1749.107] * (-1745.797) (-1748.661) (-1757.186) [-1751.300] -- 0:01:50 9500 -- (-1751.374) (-1751.110) (-1755.612) [-1754.361] * (-1751.311) (-1749.089) [-1748.865] (-1749.200) -- 0:01:44 10000 -- (-1751.782) [-1753.266] (-1752.844) (-1760.912) * [-1753.636] (-1755.001) (-1749.650) (-1753.449) -- 0:01:39 Average standard deviation of split frequencies: 0.073657 10500 -- (-1751.510) [-1749.817] (-1751.853) (-1753.296) * (-1749.683) [-1744.889] (-1755.869) (-1748.140) -- 0:01:34 11000 -- (-1755.596) (-1751.515) (-1747.337) [-1748.366] * (-1755.759) [-1747.472] (-1749.519) (-1760.690) -- 0:01:29 11500 -- (-1754.308) (-1749.481) (-1752.094) [-1756.603] * (-1750.875) [-1754.449] (-1750.653) (-1756.918) -- 0:01:25 12000 -- [-1747.786] (-1749.779) (-1756.722) (-1759.661) * (-1759.082) (-1758.638) (-1753.312) [-1755.851] -- 0:01:22 12500 -- (-1751.678) [-1751.645] (-1769.889) (-1744.319) * (-1749.745) [-1750.857] (-1746.283) (-1752.924) -- 0:01:19 13000 -- (-1761.354) (-1754.411) [-1741.291] (-1741.987) * (-1761.916) [-1753.462] (-1758.816) (-1763.607) -- 0:01:15 13500 -- [-1751.799] (-1753.908) (-1742.154) (-1743.002) * [-1751.069] (-1750.255) (-1751.818) (-1755.446) -- 0:01:13 14000 -- (-1754.942) (-1754.547) (-1741.868) [-1743.310] * (-1748.666) [-1752.829] (-1750.150) (-1753.580) -- 0:01:10 14500 -- (-1751.735) [-1754.488] (-1741.367) (-1742.249) * (-1749.090) [-1747.744] (-1751.969) (-1744.665) -- 0:01:07 15000 -- (-1753.233) [-1752.830] (-1743.553) (-1741.381) * [-1747.796] (-1760.087) (-1755.074) (-1746.005) -- 0:01:05 Average standard deviation of split frequencies: 0.076603 15500 -- [-1745.309] (-1748.627) (-1747.551) (-1742.643) * [-1744.517] (-1751.431) (-1753.960) (-1746.714) -- 0:01:03 16000 -- (-1745.997) [-1750.031] (-1746.582) (-1744.859) * (-1744.767) [-1750.932] (-1750.882) (-1744.303) -- 0:01:01 16500 -- (-1752.221) (-1753.094) [-1743.524] (-1749.383) * (-1744.942) (-1749.740) (-1750.534) [-1743.873] -- 0:00:59 17000 -- (-1759.696) [-1747.720] (-1744.480) (-1748.352) * (-1743.527) (-1754.857) [-1749.278] (-1744.960) -- 0:00:57 17500 -- [-1749.406] (-1753.968) (-1748.697) (-1748.559) * [-1743.624] (-1750.248) (-1744.554) (-1745.606) -- 0:00:56 18000 -- (-1757.194) [-1750.004] (-1745.221) (-1750.803) * (-1745.210) [-1747.887] (-1752.029) (-1744.098) -- 0:00:54 18500 -- (-1756.521) (-1752.722) (-1748.140) [-1745.546] * (-1748.910) (-1761.021) (-1748.128) [-1743.764] -- 0:00:53 19000 -- (-1748.988) (-1750.689) [-1741.968] (-1741.036) * [-1747.301] (-1754.015) (-1756.776) (-1743.705) -- 0:00:51 19500 -- (-1751.912) [-1755.454] (-1742.676) (-1741.742) * (-1742.656) [-1761.626] (-1746.830) (-1742.925) -- 0:00:50 20000 -- (-1750.346) [-1750.235] (-1741.370) (-1741.512) * (-1746.185) (-1747.155) (-1749.252) [-1742.198] -- 0:00:49 Average standard deviation of split frequencies: 0.058826 20500 -- (-1755.067) (-1748.601) [-1740.587] (-1745.965) * (-1741.844) [-1747.459] (-1755.372) (-1741.170) -- 0:00:47 21000 -- (-1753.383) (-1746.379) [-1740.557] (-1744.892) * (-1743.506) [-1750.718] (-1749.437) (-1742.210) -- 0:00:46 21500 -- (-1754.820) (-1744.902) (-1740.915) [-1742.151] * [-1742.881] (-1749.747) (-1745.913) (-1742.126) -- 0:00:45 22000 -- (-1754.754) (-1742.519) [-1740.812] (-1742.270) * (-1744.809) [-1752.187] (-1749.222) (-1741.187) -- 0:01:28 22500 -- (-1759.809) [-1741.573] (-1740.625) (-1743.503) * [-1741.574] (-1748.185) (-1754.162) (-1741.501) -- 0:01:26 23000 -- (-1750.190) (-1741.886) [-1743.119] (-1742.186) * (-1743.107) [-1751.516] (-1754.763) (-1740.746) -- 0:01:24 23500 -- [-1754.964] (-1740.602) (-1742.489) (-1742.023) * (-1741.881) (-1748.752) (-1746.650) [-1740.759] -- 0:01:23 24000 -- (-1756.869) (-1740.261) (-1741.485) [-1743.552] * (-1740.656) (-1754.587) (-1750.887) [-1743.763] -- 0:01:21 24500 -- (-1752.945) (-1744.052) (-1741.329) [-1743.169] * (-1740.777) (-1753.869) [-1746.855] (-1748.075) -- 0:01:19 25000 -- (-1752.148) (-1741.302) [-1741.599] (-1745.137) * [-1741.573] (-1744.822) (-1753.984) (-1747.359) -- 0:01:18 Average standard deviation of split frequencies: 0.034614 25500 -- (-1752.196) (-1740.558) [-1744.849] (-1744.250) * (-1742.567) [-1755.027] (-1752.425) (-1746.911) -- 0:01:16 26000 -- [-1754.913] (-1740.683) (-1744.300) (-1742.621) * (-1742.510) (-1755.637) [-1753.001] (-1747.153) -- 0:01:14 26500 -- (-1752.491) (-1740.958) [-1743.520] (-1743.735) * [-1742.338] (-1752.354) (-1760.999) (-1745.995) -- 0:01:13 27000 -- (-1752.333) (-1742.721) (-1743.983) [-1743.260] * (-1743.030) [-1748.329] (-1755.430) (-1744.499) -- 0:01:12 27500 -- [-1749.253] (-1740.310) (-1743.498) (-1742.804) * (-1741.928) (-1754.434) (-1755.611) [-1742.069] -- 0:01:10 28000 -- (-1743.461) (-1743.115) (-1744.057) [-1742.555] * [-1743.598] (-1747.204) (-1745.298) (-1742.912) -- 0:01:09 28500 -- [-1743.107] (-1741.793) (-1743.971) (-1745.995) * [-1743.518] (-1753.818) (-1756.762) (-1741.946) -- 0:01:08 29000 -- [-1744.763] (-1741.462) (-1744.160) (-1742.837) * (-1743.063) (-1755.083) (-1752.919) [-1742.370] -- 0:01:06 29500 -- (-1744.370) (-1741.743) [-1742.415] (-1742.532) * (-1741.351) (-1751.958) (-1757.469) [-1742.771] -- 0:01:05 30000 -- (-1743.388) (-1744.834) (-1742.503) [-1743.620] * (-1742.048) (-1761.195) [-1751.501] (-1745.483) -- 0:01:04 Average standard deviation of split frequencies: 0.033980 30500 -- [-1741.852] (-1741.874) (-1742.369) (-1745.760) * [-1742.970] (-1750.369) (-1755.096) (-1743.519) -- 0:01:03 31000 -- (-1740.674) [-1741.208] (-1742.279) (-1742.551) * (-1742.505) (-1752.852) (-1750.743) [-1744.086] -- 0:01:02 31500 -- (-1741.091) [-1742.985] (-1740.958) (-1744.008) * (-1740.991) [-1759.915] (-1753.816) (-1742.654) -- 0:01:01 32000 -- (-1740.728) (-1741.662) (-1744.996) [-1746.663] * [-1741.808] (-1752.355) (-1751.809) (-1743.210) -- 0:01:00 32500 -- [-1740.397] (-1741.881) (-1744.525) (-1741.633) * (-1741.607) (-1755.482) [-1751.918] (-1743.233) -- 0:00:59 33000 -- (-1744.072) (-1745.369) [-1740.695] (-1743.888) * (-1742.648) (-1755.683) [-1755.877] (-1744.664) -- 0:00:58 33500 -- (-1741.417) (-1745.904) [-1740.727] (-1743.370) * (-1742.090) [-1752.908] (-1748.197) (-1745.013) -- 0:00:57 34000 -- (-1741.885) (-1742.493) (-1742.406) [-1740.907] * [-1742.811] (-1753.768) (-1754.144) (-1743.875) -- 0:00:56 34500 -- (-1742.498) (-1740.933) (-1741.593) [-1740.916] * (-1744.374) (-1751.330) [-1750.209] (-1743.308) -- 0:00:55 35000 -- (-1742.662) [-1743.774] (-1741.998) (-1742.260) * (-1743.197) [-1761.474] (-1753.103) (-1743.263) -- 0:00:55 Average standard deviation of split frequencies: 0.026189 35500 -- (-1741.729) (-1742.657) (-1741.998) [-1741.647] * (-1746.088) (-1747.733) [-1751.018] (-1742.727) -- 0:00:54 36000 -- (-1741.144) [-1741.045] (-1740.881) (-1742.859) * [-1746.657] (-1745.414) (-1747.747) (-1743.094) -- 0:00:53 36500 -- (-1741.556) (-1741.045) (-1744.612) [-1742.369] * (-1741.490) [-1745.026] (-1760.536) (-1745.277) -- 0:00:52 37000 -- (-1742.257) (-1744.641) [-1744.163] (-1742.171) * (-1741.872) (-1743.170) [-1749.791] (-1748.684) -- 0:01:18 37500 -- (-1742.818) (-1744.641) [-1742.838] (-1741.892) * (-1741.487) [-1741.142] (-1754.764) (-1749.082) -- 0:01:17 38000 -- (-1742.727) (-1741.974) (-1745.127) [-1742.604] * (-1742.696) [-1740.991] (-1770.382) (-1743.398) -- 0:01:15 38500 -- (-1744.636) (-1742.756) [-1743.627] (-1741.915) * (-1742.764) (-1741.001) (-1751.467) [-1743.341] -- 0:01:14 39000 -- (-1746.532) (-1742.321) (-1744.460) [-1742.818] * (-1743.809) (-1743.962) (-1744.148) [-1743.307] -- 0:01:13 39500 -- (-1744.241) [-1742.856] (-1745.912) (-1742.175) * (-1744.212) (-1742.191) [-1741.343] (-1743.246) -- 0:01:12 40000 -- (-1743.909) [-1742.438] (-1742.617) (-1743.676) * (-1743.898) (-1743.974) [-1741.207] (-1743.246) -- 0:01:12 Average standard deviation of split frequencies: 0.026234 40500 -- (-1741.145) (-1741.550) (-1740.595) [-1742.522] * (-1743.105) (-1741.182) [-1743.175] (-1741.411) -- 0:01:11 41000 -- (-1741.327) (-1741.247) [-1742.111] (-1741.853) * [-1743.343] (-1741.226) (-1741.797) (-1743.065) -- 0:01:10 41500 -- (-1741.964) (-1741.042) (-1742.110) [-1740.919] * (-1744.657) (-1742.701) (-1742.117) [-1743.728] -- 0:01:09 42000 -- (-1744.453) (-1742.150) (-1742.300) [-1740.920] * [-1741.653] (-1741.168) (-1742.156) (-1746.338) -- 0:01:08 42500 -- (-1746.931) [-1743.077] (-1742.967) (-1742.075) * (-1742.443) [-1741.176] (-1743.316) (-1742.689) -- 0:01:07 43000 -- (-1743.024) [-1743.439] (-1741.704) (-1744.716) * [-1742.682] (-1740.603) (-1742.068) (-1742.051) -- 0:01:06 43500 -- [-1740.908] (-1740.553) (-1741.738) (-1740.409) * (-1746.406) (-1741.200) [-1742.068] (-1746.873) -- 0:01:05 44000 -- (-1741.349) (-1742.789) (-1742.387) [-1741.524] * (-1745.111) (-1741.049) [-1741.301] (-1745.394) -- 0:01:05 44500 -- [-1743.301] (-1741.839) (-1742.177) (-1740.848) * (-1744.761) (-1741.513) (-1741.317) [-1745.697] -- 0:01:04 45000 -- (-1742.294) (-1744.740) [-1741.421] (-1740.803) * (-1742.261) [-1742.381] (-1741.544) (-1748.290) -- 0:01:03 Average standard deviation of split frequencies: 0.030256 45500 -- (-1743.232) [-1744.426] (-1745.037) (-1744.524) * [-1742.860] (-1742.161) (-1741.557) (-1748.552) -- 0:01:02 46000 -- (-1742.602) (-1741.343) (-1744.865) [-1743.011] * (-1745.056) [-1741.246] (-1742.392) (-1750.384) -- 0:01:02 46500 -- [-1741.077] (-1742.895) (-1744.116) (-1742.992) * (-1743.155) (-1741.047) [-1740.969] (-1745.887) -- 0:01:01 47000 -- (-1741.044) (-1741.904) [-1743.955] (-1742.699) * (-1742.826) (-1741.366) [-1741.234] (-1743.138) -- 0:01:00 47500 -- (-1741.876) (-1742.048) (-1745.830) [-1741.054] * (-1744.450) (-1740.600) (-1741.782) [-1740.331] -- 0:01:00 48000 -- [-1741.554] (-1746.129) (-1747.253) (-1741.675) * (-1744.382) (-1743.530) [-1742.228] (-1740.735) -- 0:00:59 48500 -- (-1741.559) (-1746.555) (-1746.601) [-1745.014] * (-1744.667) (-1743.851) (-1743.414) [-1744.582] -- 0:00:58 49000 -- [-1742.205] (-1744.055) (-1746.241) (-1743.254) * (-1746.341) (-1746.116) (-1742.620) [-1741.679] -- 0:00:58 49500 -- (-1744.576) (-1743.467) [-1741.417] (-1743.844) * (-1742.865) (-1745.041) [-1742.356] (-1741.371) -- 0:00:57 50000 -- (-1743.305) (-1742.223) [-1742.401] (-1741.756) * (-1742.079) (-1744.492) (-1741.820) [-1743.631] -- 0:00:57 Average standard deviation of split frequencies: 0.031830 50500 -- [-1744.933] (-1740.455) (-1741.865) (-1746.876) * (-1742.909) (-1741.884) (-1742.911) [-1742.352] -- 0:00:56 51000 -- (-1742.061) (-1740.685) [-1741.839] (-1744.212) * [-1743.315] (-1742.005) (-1743.365) (-1742.031) -- 0:00:55 51500 -- (-1742.061) (-1740.912) [-1741.768] (-1742.498) * (-1743.100) (-1744.101) (-1741.952) [-1742.038] -- 0:01:13 52000 -- (-1741.545) (-1742.054) [-1741.880] (-1741.936) * (-1742.878) [-1742.519] (-1743.473) (-1742.235) -- 0:01:12 52500 -- (-1741.842) [-1740.548] (-1741.298) (-1742.226) * [-1742.477] (-1745.300) (-1743.811) (-1741.960) -- 0:01:12 53000 -- (-1741.953) (-1743.613) (-1741.351) [-1741.917] * (-1743.188) (-1746.616) (-1740.826) [-1741.501] -- 0:01:11 53500 -- (-1744.731) (-1743.448) [-1743.729] (-1743.035) * (-1744.439) (-1744.423) [-1742.264] (-1740.740) -- 0:01:10 54000 -- (-1743.778) (-1746.279) [-1741.518] (-1741.699) * (-1743.640) (-1741.363) (-1743.517) [-1740.943] -- 0:01:10 54500 -- (-1744.448) (-1746.464) (-1742.215) [-1742.857] * (-1749.679) [-1741.031] (-1742.925) (-1740.963) -- 0:01:09 55000 -- (-1746.313) [-1742.494] (-1741.633) (-1746.720) * (-1748.558) [-1741.003] (-1742.253) (-1741.757) -- 0:01:08 Average standard deviation of split frequencies: 0.028355 55500 -- (-1743.468) (-1743.587) [-1745.013] (-1746.722) * (-1740.919) (-1741.406) (-1741.314) [-1742.876] -- 0:01:08 56000 -- [-1742.499] (-1745.420) (-1743.754) (-1746.564) * (-1742.761) [-1745.843] (-1742.694) (-1742.876) -- 0:01:07 56500 -- [-1743.250] (-1745.266) (-1744.002) (-1743.540) * (-1746.479) (-1742.317) (-1743.455) [-1744.842] -- 0:01:06 57000 -- (-1743.554) [-1743.754] (-1743.385) (-1750.834) * (-1745.174) [-1741.812] (-1741.234) (-1744.272) -- 0:01:06 57500 -- [-1743.538] (-1746.110) (-1745.099) (-1747.424) * (-1744.755) (-1742.281) (-1746.431) [-1742.913] -- 0:01:05 58000 -- (-1745.963) (-1746.477) [-1742.751] (-1744.932) * (-1744.308) [-1742.318] (-1743.591) (-1743.008) -- 0:01:04 58500 -- [-1743.243] (-1743.757) (-1744.297) (-1743.865) * (-1748.296) [-1742.833] (-1747.811) (-1742.950) -- 0:01:04 59000 -- (-1744.585) (-1742.926) [-1742.731] (-1741.833) * (-1744.029) (-1743.114) [-1744.366] (-1742.296) -- 0:01:03 59500 -- (-1744.539) (-1742.424) [-1742.146] (-1744.424) * [-1741.719] (-1745.415) (-1748.969) (-1742.474) -- 0:01:03 60000 -- (-1744.728) (-1743.239) [-1742.419] (-1742.372) * [-1741.968] (-1741.693) (-1748.936) (-1742.395) -- 0:01:02 Average standard deviation of split frequencies: 0.027628 60500 -- (-1744.547) (-1741.422) [-1742.737] (-1745.279) * (-1742.601) (-1740.665) (-1748.335) [-1741.225] -- 0:01:02 61000 -- (-1744.773) (-1744.275) [-1742.737] (-1743.738) * (-1743.260) (-1743.078) [-1743.221] (-1742.632) -- 0:01:01 61500 -- (-1744.410) [-1742.317] (-1741.289) (-1742.111) * [-1743.076] (-1741.133) (-1742.040) (-1741.151) -- 0:01:01 62000 -- (-1744.857) (-1741.287) [-1740.818] (-1742.516) * [-1741.939] (-1743.707) (-1748.829) (-1741.885) -- 0:01:00 62500 -- (-1744.802) (-1742.454) (-1742.724) [-1743.159] * (-1741.475) (-1743.606) (-1750.944) [-1745.258] -- 0:01:00 63000 -- (-1743.113) [-1741.948] (-1743.184) (-1743.308) * (-1743.495) (-1744.892) (-1749.377) [-1742.091] -- 0:00:59 63500 -- (-1746.365) (-1741.293) [-1743.036] (-1742.429) * [-1741.128] (-1744.733) (-1742.810) (-1744.543) -- 0:00:58 64000 -- [-1742.984] (-1741.688) (-1742.424) (-1742.081) * (-1744.345) (-1748.517) [-1743.776] (-1741.219) -- 0:00:58 64500 -- (-1745.845) (-1741.388) (-1743.576) [-1742.780] * (-1740.547) (-1746.921) (-1741.673) [-1741.107] -- 0:01:12 65000 -- (-1743.301) [-1740.972] (-1743.162) (-1741.787) * [-1742.265] (-1748.642) (-1741.672) (-1741.021) -- 0:01:11 Average standard deviation of split frequencies: 0.029641 65500 -- (-1742.376) [-1742.720] (-1743.162) (-1744.066) * (-1743.533) [-1743.547] (-1742.330) (-1741.093) -- 0:01:11 66000 -- (-1743.857) [-1741.877] (-1744.002) (-1742.655) * (-1743.493) (-1743.865) [-1742.421] (-1744.027) -- 0:01:10 66500 -- [-1742.235] (-1746.410) (-1742.085) (-1742.676) * (-1747.139) [-1742.548] (-1742.786) (-1742.063) -- 0:01:10 67000 -- [-1742.575] (-1749.421) (-1743.088) (-1741.533) * (-1744.330) (-1743.563) [-1742.580] (-1743.469) -- 0:01:09 67500 -- [-1741.959] (-1749.168) (-1742.470) (-1742.429) * (-1740.985) (-1743.146) (-1743.152) [-1743.403] -- 0:01:09 68000 -- [-1741.346] (-1745.442) (-1742.445) (-1743.243) * (-1742.931) (-1742.532) (-1742.700) [-1740.969] -- 0:01:08 68500 -- [-1742.336] (-1744.546) (-1741.899) (-1743.987) * (-1742.354) (-1743.464) [-1749.653] (-1741.212) -- 0:01:07 69000 -- (-1742.438) (-1742.211) (-1742.940) [-1744.365] * (-1746.436) (-1743.168) (-1748.093) [-1743.311] -- 0:01:07 69500 -- [-1741.794] (-1741.330) (-1743.965) (-1742.107) * (-1745.904) [-1742.252] (-1744.288) (-1741.761) -- 0:01:06 70000 -- [-1744.098] (-1741.247) (-1744.314) (-1743.858) * (-1744.253) (-1742.480) (-1745.195) [-1742.231] -- 0:01:06 Average standard deviation of split frequencies: 0.024089 70500 -- (-1745.820) (-1744.161) [-1741.945] (-1743.751) * (-1744.407) (-1741.318) [-1742.606] (-1743.020) -- 0:01:05 71000 -- (-1746.349) [-1740.439] (-1742.944) (-1749.023) * (-1742.504) [-1741.096] (-1742.593) (-1748.307) -- 0:01:05 71500 -- [-1742.425] (-1741.087) (-1743.219) (-1744.193) * [-1743.555] (-1743.030) (-1746.779) (-1741.405) -- 0:01:04 72000 -- (-1743.200) [-1741.557] (-1745.054) (-1748.654) * (-1741.435) [-1741.772] (-1741.217) (-1741.458) -- 0:01:04 72500 -- (-1744.487) (-1740.970) [-1743.048] (-1743.050) * (-1742.622) [-1741.779] (-1745.339) (-1740.633) -- 0:01:03 73000 -- (-1744.361) (-1741.045) [-1744.444] (-1743.515) * [-1741.280] (-1741.645) (-1742.449) (-1743.997) -- 0:01:03 73500 -- (-1743.274) (-1742.505) [-1743.405] (-1741.730) * (-1740.726) (-1741.842) (-1742.914) [-1743.204] -- 0:01:03 74000 -- [-1741.007] (-1744.096) (-1740.232) (-1741.909) * (-1741.330) [-1744.342] (-1741.713) (-1740.867) -- 0:01:02 74500 -- (-1742.537) [-1743.180] (-1740.293) (-1743.158) * (-1744.975) [-1744.427] (-1741.363) (-1744.439) -- 0:01:02 75000 -- (-1743.287) (-1742.810) [-1740.422] (-1744.267) * [-1742.697] (-1741.651) (-1744.069) (-1744.798) -- 0:01:01 Average standard deviation of split frequencies: 0.019338 75500 -- (-1742.512) (-1741.515) [-1741.526] (-1741.296) * (-1742.236) (-1744.114) [-1741.878] (-1748.551) -- 0:01:01 76000 -- (-1743.152) (-1743.226) [-1741.526] (-1743.853) * (-1742.853) [-1742.724] (-1742.599) (-1744.917) -- 0:01:00 76500 -- (-1740.759) (-1742.706) (-1741.642) [-1744.138] * (-1742.416) [-1741.475] (-1747.438) (-1741.937) -- 0:01:00 77000 -- (-1741.428) (-1744.437) [-1740.296] (-1740.968) * [-1742.417] (-1742.088) (-1744.545) (-1740.682) -- 0:00:59 77500 -- (-1741.428) [-1742.993] (-1740.879) (-1742.343) * (-1741.646) (-1749.167) (-1744.019) [-1741.504] -- 0:01:11 78000 -- (-1742.941) [-1743.361] (-1743.001) (-1747.324) * [-1742.200] (-1741.974) (-1742.007) (-1743.773) -- 0:01:10 78500 -- (-1741.544) (-1743.282) (-1741.189) [-1741.413] * (-1741.932) [-1742.584] (-1743.539) (-1747.269) -- 0:01:10 79000 -- (-1743.608) (-1743.495) [-1742.805] (-1740.702) * (-1742.357) (-1742.284) [-1746.225] (-1752.706) -- 0:01:09 79500 -- (-1742.975) (-1743.315) (-1742.471) [-1744.709] * [-1743.020] (-1742.756) (-1744.139) (-1749.304) -- 0:01:09 80000 -- [-1741.714] (-1742.922) (-1744.113) (-1743.382) * [-1742.341] (-1742.324) (-1746.098) (-1744.107) -- 0:01:09 Average standard deviation of split frequencies: 0.022453 80500 -- (-1741.047) (-1749.248) (-1744.623) [-1741.840] * (-1745.524) (-1742.890) [-1746.471] (-1745.612) -- 0:01:08 81000 -- (-1741.047) (-1746.314) [-1743.703] (-1742.790) * (-1742.685) (-1742.886) [-1747.107] (-1748.572) -- 0:01:08 81500 -- [-1740.870] (-1742.562) (-1744.638) (-1741.012) * [-1741.994] (-1745.035) (-1741.614) (-1749.207) -- 0:01:07 82000 -- [-1742.504] (-1742.220) (-1746.418) (-1741.201) * (-1741.996) (-1744.709) (-1741.300) [-1743.824] -- 0:01:07 82500 -- (-1740.877) [-1743.335] (-1744.309) (-1744.193) * [-1741.662] (-1745.055) (-1742.360) (-1745.684) -- 0:01:06 83000 -- (-1741.639) [-1744.719] (-1742.038) (-1742.403) * (-1744.626) [-1744.041] (-1743.058) (-1743.665) -- 0:01:06 83500 -- (-1741.438) (-1741.729) (-1741.486) [-1741.155] * (-1745.249) [-1743.750] (-1743.667) (-1743.023) -- 0:01:05 84000 -- (-1749.171) (-1741.180) [-1741.980] (-1741.520) * (-1743.543) [-1744.740] (-1743.163) (-1742.782) -- 0:01:05 84500 -- (-1748.088) [-1742.019] (-1740.735) (-1741.470) * (-1744.684) [-1741.656] (-1745.926) (-1744.690) -- 0:01:05 85000 -- (-1747.388) (-1741.872) [-1741.471] (-1744.129) * [-1741.755] (-1741.344) (-1743.590) (-1743.109) -- 0:01:04 Average standard deviation of split frequencies: 0.023296 85500 -- (-1742.149) (-1743.101) [-1742.545] (-1749.352) * (-1742.207) [-1743.784] (-1742.795) (-1740.726) -- 0:01:04 86000 -- (-1743.204) (-1741.777) [-1743.147] (-1741.390) * (-1742.066) (-1741.101) [-1746.288] (-1740.726) -- 0:01:03 86500 -- (-1742.173) [-1741.553] (-1741.604) (-1743.100) * (-1745.382) (-1741.914) [-1742.972] (-1743.824) -- 0:01:03 87000 -- (-1742.173) [-1742.842] (-1741.715) (-1741.856) * [-1742.815] (-1740.992) (-1742.320) (-1742.987) -- 0:01:02 87500 -- (-1742.173) (-1741.943) (-1740.927) [-1744.009] * (-1742.616) [-1746.286] (-1742.199) (-1742.987) -- 0:01:02 88000 -- (-1743.543) (-1744.838) [-1742.775] (-1743.788) * (-1742.613) [-1742.175] (-1743.546) (-1740.654) -- 0:01:02 88500 -- (-1742.416) (-1740.763) [-1742.251] (-1745.206) * (-1743.706) (-1742.269) (-1741.693) [-1747.825] -- 0:01:01 89000 -- (-1742.416) [-1740.876] (-1741.770) (-1741.382) * (-1742.426) [-1741.234] (-1743.554) (-1742.636) -- 0:01:01 89500 -- [-1742.372] (-1741.481) (-1741.587) (-1742.143) * (-1740.822) (-1741.526) (-1742.539) [-1741.388] -- 0:01:01 90000 -- (-1741.473) [-1740.954] (-1741.679) (-1742.566) * (-1741.006) [-1741.961] (-1743.087) (-1741.389) -- 0:01:00 Average standard deviation of split frequencies: 0.022986 90500 -- (-1744.675) (-1740.872) (-1742.821) [-1745.813] * (-1742.426) (-1743.274) (-1743.345) [-1740.823] -- 0:01:00 91000 -- (-1747.310) (-1740.872) (-1741.590) [-1744.204] * (-1741.735) (-1742.861) [-1741.687] (-1741.181) -- 0:00:59 91500 -- (-1744.267) (-1740.869) (-1741.591) [-1744.019] * (-1741.759) (-1742.427) (-1742.576) [-1741.065] -- 0:01:09 92000 -- (-1742.437) (-1740.880) [-1740.891] (-1744.361) * (-1747.661) [-1741.020] (-1741.728) (-1741.185) -- 0:01:09 92500 -- [-1741.629] (-1741.796) (-1740.891) (-1742.947) * (-1744.528) [-1742.811] (-1741.729) (-1741.769) -- 0:01:08 93000 -- (-1741.327) (-1742.018) [-1744.888] (-1748.614) * [-1742.520] (-1743.148) (-1743.572) (-1741.769) -- 0:01:08 93500 -- [-1741.989] (-1742.960) (-1743.430) (-1741.717) * (-1741.355) [-1742.801] (-1742.189) (-1741.388) -- 0:01:07 94000 -- (-1743.863) [-1741.285] (-1748.372) (-1742.512) * (-1742.286) [-1743.961] (-1742.797) (-1740.938) -- 0:01:07 94500 -- (-1744.330) (-1742.058) [-1743.117] (-1741.384) * (-1742.084) (-1741.123) (-1742.472) [-1742.978] -- 0:01:07 95000 -- (-1746.341) (-1741.887) [-1743.677] (-1749.531) * (-1742.597) [-1741.209] (-1742.763) (-1745.371) -- 0:01:06 Average standard deviation of split frequencies: 0.025098 95500 -- [-1743.192] (-1741.783) (-1743.643) (-1744.633) * [-1742.590] (-1742.120) (-1746.289) (-1741.295) -- 0:01:06 96000 -- (-1742.234) (-1744.421) (-1742.319) [-1744.161] * (-1743.116) (-1742.037) (-1745.583) [-1742.769] -- 0:01:05 96500 -- (-1741.053) (-1744.584) (-1742.283) [-1745.312] * (-1744.364) (-1741.748) (-1744.595) [-1742.837] -- 0:01:05 97000 -- [-1740.989] (-1741.942) (-1741.754) (-1742.615) * (-1745.808) [-1742.457] (-1743.100) (-1741.437) -- 0:01:05 97500 -- (-1745.331) (-1744.920) [-1743.303] (-1741.905) * (-1745.319) (-1741.064) (-1741.391) [-1741.692] -- 0:01:04 98000 -- [-1741.967] (-1743.415) (-1743.809) (-1742.280) * (-1743.712) [-1741.050] (-1741.736) (-1742.596) -- 0:01:04 98500 -- (-1740.933) (-1747.614) [-1742.876] (-1741.944) * (-1746.367) (-1742.798) [-1741.816] (-1743.428) -- 0:01:04 99000 -- (-1742.326) [-1741.146] (-1743.797) (-1742.854) * (-1746.976) [-1740.980] (-1741.816) (-1742.199) -- 0:01:03 99500 -- (-1740.890) (-1742.488) [-1742.566] (-1741.947) * (-1744.914) [-1740.879] (-1741.840) (-1741.095) -- 0:01:03 100000 -- (-1740.890) (-1741.432) (-1741.734) [-1741.946] * (-1743.178) (-1741.107) [-1742.812] (-1741.309) -- 0:01:02 Average standard deviation of split frequencies: 0.022634 100500 -- (-1740.873) [-1741.367] (-1741.181) (-1742.552) * (-1745.199) [-1741.550] (-1742.285) (-1746.796) -- 0:01:02 101000 -- (-1740.391) (-1742.855) [-1741.001] (-1742.866) * (-1746.704) (-1743.525) [-1741.767] (-1744.899) -- 0:01:02 101500 -- [-1741.595] (-1744.451) (-1741.789) (-1742.584) * (-1742.874) (-1741.266) [-1741.068] (-1744.640) -- 0:01:01 102000 -- (-1741.138) (-1745.400) [-1743.410] (-1742.468) * (-1742.051) [-1742.852] (-1742.425) (-1742.045) -- 0:01:01 102500 -- (-1742.255) (-1743.584) (-1742.898) [-1741.148] * (-1740.611) (-1743.250) (-1743.046) [-1742.903] -- 0:01:01 103000 -- (-1741.452) [-1742.755] (-1741.601) (-1742.040) * [-1740.883] (-1742.223) (-1742.409) (-1742.903) -- 0:01:00 103500 -- (-1740.588) [-1742.351] (-1741.661) (-1743.688) * [-1741.172] (-1741.827) (-1742.456) (-1742.694) -- 0:01:00 104000 -- (-1741.210) (-1741.280) (-1742.241) [-1742.913] * (-1741.795) [-1740.769] (-1740.684) (-1747.699) -- 0:01:00 104500 -- (-1741.913) [-1741.756] (-1742.057) (-1744.386) * (-1743.542) (-1741.231) [-1741.928] (-1743.302) -- 0:00:59 105000 -- [-1742.905] (-1748.370) (-1746.119) (-1743.700) * (-1740.525) (-1740.603) (-1742.909) [-1741.402] -- 0:00:59 Average standard deviation of split frequencies: 0.020364 105500 -- [-1742.072] (-1747.672) (-1741.797) (-1743.924) * (-1740.576) (-1740.543) [-1744.109] (-1745.640) -- 0:00:59 106000 -- (-1745.764) [-1743.678] (-1742.270) (-1743.482) * (-1744.437) [-1740.531] (-1740.338) (-1743.365) -- 0:01:07 106500 -- [-1742.908] (-1745.532) (-1743.087) (-1745.758) * (-1744.438) (-1741.952) [-1741.788] (-1740.797) -- 0:01:07 107000 -- (-1742.118) (-1744.503) [-1743.221] (-1746.329) * (-1741.669) (-1742.065) (-1742.215) [-1740.809] -- 0:01:06 107500 -- (-1744.020) (-1742.838) (-1743.730) [-1741.109] * (-1740.898) (-1742.012) [-1742.544] (-1741.067) -- 0:01:06 108000 -- [-1743.752] (-1744.056) (-1744.845) (-1745.554) * (-1745.265) (-1740.788) [-1742.050] (-1743.511) -- 0:01:06 108500 -- [-1745.959] (-1740.394) (-1742.215) (-1746.597) * (-1742.970) (-1741.197) (-1742.157) [-1744.831] -- 0:01:05 109000 -- (-1742.910) (-1741.670) [-1743.266] (-1741.066) * (-1741.008) (-1742.859) [-1741.490] (-1741.970) -- 0:01:05 109500 -- (-1745.118) [-1742.379] (-1744.495) (-1743.724) * (-1740.866) [-1742.843] (-1742.633) (-1742.237) -- 0:01:05 110000 -- (-1742.796) (-1742.379) (-1743.113) [-1742.822] * (-1742.726) (-1740.993) (-1742.297) [-1742.957] -- 0:01:04 Average standard deviation of split frequencies: 0.019729 110500 -- (-1741.488) [-1742.505] (-1743.916) (-1742.359) * (-1741.436) (-1744.139) [-1745.359] (-1745.073) -- 0:01:04 111000 -- (-1741.574) (-1742.277) (-1744.618) [-1740.765] * (-1746.466) [-1742.639] (-1742.170) (-1745.153) -- 0:01:04 111500 -- [-1740.922] (-1740.543) (-1743.087) (-1744.411) * (-1747.483) (-1742.425) [-1742.846] (-1744.736) -- 0:01:03 112000 -- (-1741.108) (-1742.948) [-1744.596] (-1743.034) * [-1742.369] (-1743.721) (-1742.758) (-1742.434) -- 0:01:03 112500 -- (-1741.471) (-1740.841) [-1742.497] (-1743.404) * (-1743.293) (-1740.955) [-1743.737] (-1743.345) -- 0:01:03 113000 -- [-1743.185] (-1742.717) (-1742.173) (-1743.014) * (-1743.979) (-1741.962) (-1741.887) [-1741.102] -- 0:01:02 113500 -- (-1742.540) (-1742.193) (-1741.153) [-1742.278] * [-1742.270] (-1740.845) (-1742.909) (-1744.352) -- 0:01:02 114000 -- (-1741.376) (-1742.442) (-1741.949) [-1742.568] * [-1740.807] (-1741.348) (-1743.479) (-1744.542) -- 0:01:02 114500 -- [-1742.002] (-1741.488) (-1741.624) (-1743.750) * (-1743.919) [-1743.459] (-1744.178) (-1742.738) -- 0:01:01 115000 -- (-1742.240) [-1741.452] (-1746.643) (-1743.662) * [-1741.896] (-1747.792) (-1741.862) (-1741.527) -- 0:01:01 Average standard deviation of split frequencies: 0.020771 115500 -- (-1740.739) (-1742.524) [-1742.675] (-1741.542) * (-1743.116) (-1743.980) [-1742.750] (-1743.850) -- 0:01:01 116000 -- (-1741.434) [-1740.977] (-1742.534) (-1747.375) * (-1746.175) [-1741.300] (-1743.287) (-1743.410) -- 0:01:00 116500 -- (-1753.708) [-1740.962] (-1741.856) (-1744.368) * [-1741.629] (-1742.384) (-1745.969) (-1741.422) -- 0:01:00 117000 -- (-1742.919) (-1742.236) (-1741.526) [-1742.245] * (-1741.491) (-1743.400) (-1743.733) [-1742.070] -- 0:01:00 117500 -- (-1743.407) (-1747.619) (-1742.302) [-1744.498] * [-1741.998] (-1746.405) (-1742.161) (-1740.433) -- 0:01:00 118000 -- (-1742.536) (-1749.111) [-1742.555] (-1749.309) * (-1741.486) (-1742.823) [-1742.961] (-1742.035) -- 0:00:59 118500 -- (-1742.648) [-1744.059] (-1742.179) (-1742.291) * (-1741.464) (-1744.238) [-1742.397] (-1740.941) -- 0:00:59 119000 -- (-1742.858) [-1741.190] (-1743.664) (-1742.594) * (-1741.063) [-1743.635] (-1741.261) (-1741.434) -- 0:00:59 119500 -- (-1744.747) (-1741.192) [-1744.539] (-1743.300) * (-1744.566) [-1744.318] (-1741.648) (-1740.975) -- 0:00:58 120000 -- (-1742.329) [-1740.417] (-1743.038) (-1742.647) * (-1746.707) (-1742.596) [-1741.235] (-1744.726) -- 0:00:58 Average standard deviation of split frequencies: 0.021831 120500 -- (-1743.782) (-1741.625) (-1742.798) [-1742.540] * [-1747.549] (-1745.910) (-1741.322) (-1746.292) -- 0:00:58 121000 -- (-1741.729) (-1742.830) [-1743.880] (-1741.029) * (-1745.076) (-1742.469) [-1742.390] (-1744.239) -- 0:01:05 121500 -- (-1742.465) [-1743.735] (-1742.697) (-1740.849) * (-1745.285) (-1743.595) [-1742.877] (-1747.279) -- 0:01:05 122000 -- (-1741.723) (-1743.024) [-1742.424] (-1742.978) * (-1749.484) [-1748.514] (-1742.296) (-1747.010) -- 0:01:04 122500 -- (-1740.988) [-1743.833] (-1742.424) (-1742.978) * (-1742.755) (-1742.634) (-1741.875) [-1747.155] -- 0:01:04 123000 -- (-1747.394) (-1741.637) [-1743.756] (-1742.373) * [-1742.241] (-1741.575) (-1746.770) (-1747.202) -- 0:01:04 123500 -- (-1743.925) (-1742.629) [-1743.524] (-1742.151) * (-1742.760) [-1741.545] (-1741.122) (-1743.038) -- 0:01:03 124000 -- (-1742.840) (-1741.961) (-1745.082) [-1740.655] * (-1741.410) [-1742.182] (-1741.620) (-1743.880) -- 0:01:03 124500 -- (-1741.994) (-1743.782) [-1744.631] (-1743.390) * (-1742.961) [-1741.257] (-1741.805) (-1748.457) -- 0:01:03 125000 -- (-1743.915) [-1741.925] (-1742.349) (-1743.917) * (-1740.676) [-1740.902] (-1741.568) (-1751.572) -- 0:01:03 Average standard deviation of split frequencies: 0.023235 125500 -- [-1741.716] (-1744.552) (-1745.127) (-1750.324) * (-1741.893) [-1741.817] (-1742.997) (-1747.484) -- 0:01:02 126000 -- (-1743.822) [-1744.540] (-1743.945) (-1748.300) * [-1742.122] (-1741.889) (-1743.686) (-1743.065) -- 0:01:02 126500 -- (-1743.728) (-1745.366) [-1743.673] (-1750.276) * (-1741.610) (-1745.244) (-1741.015) [-1742.608] -- 0:01:02 127000 -- (-1744.525) (-1743.384) [-1742.789] (-1746.610) * (-1743.768) (-1742.520) (-1741.286) [-1741.206] -- 0:01:01 127500 -- (-1744.566) (-1740.577) [-1741.464] (-1745.677) * [-1740.911] (-1742.064) (-1740.751) (-1744.108) -- 0:01:01 128000 -- (-1742.583) (-1742.920) [-1741.339] (-1742.683) * (-1741.091) (-1743.619) [-1740.756] (-1743.456) -- 0:01:01 128500 -- [-1741.845] (-1742.965) (-1741.370) (-1742.816) * (-1743.259) (-1742.227) [-1742.003] (-1744.883) -- 0:01:01 129000 -- (-1741.796) [-1744.776] (-1745.999) (-1741.760) * (-1742.013) (-1741.677) [-1741.032] (-1743.223) -- 0:01:00 129500 -- (-1741.789) (-1742.006) [-1743.316] (-1744.714) * (-1741.560) (-1745.717) [-1741.529] (-1742.532) -- 0:01:00 130000 -- (-1741.718) (-1743.884) (-1741.103) [-1745.230] * (-1745.093) [-1742.051] (-1743.645) (-1743.949) -- 0:01:00 Average standard deviation of split frequencies: 0.021466 130500 -- (-1741.915) [-1743.131] (-1742.576) (-1744.579) * [-1744.607] (-1746.250) (-1742.621) (-1742.975) -- 0:00:59 131000 -- [-1741.915] (-1743.904) (-1743.166) (-1742.980) * (-1743.589) [-1746.042] (-1744.161) (-1741.911) -- 0:00:59 131500 -- (-1742.248) (-1745.174) (-1744.080) [-1745.762] * (-1744.338) [-1741.088] (-1741.345) (-1741.371) -- 0:00:59 132000 -- (-1743.663) (-1740.918) (-1741.389) [-1744.548] * [-1744.201] (-1741.088) (-1741.237) (-1742.765) -- 0:00:59 132500 -- (-1745.367) (-1740.830) [-1742.025] (-1744.956) * [-1741.341] (-1742.162) (-1741.309) (-1741.469) -- 0:00:58 133000 -- [-1744.675] (-1740.769) (-1742.820) (-1744.360) * (-1744.741) [-1743.056] (-1742.120) (-1744.996) -- 0:00:58 133500 -- (-1740.975) (-1747.130) (-1742.650) [-1744.346] * (-1743.910) (-1748.977) [-1743.583] (-1743.062) -- 0:00:58 134000 -- (-1742.557) [-1744.577] (-1744.650) (-1743.606) * (-1745.375) (-1742.131) [-1742.545] (-1741.299) -- 0:00:58 134500 -- [-1741.645] (-1743.874) (-1744.181) (-1743.540) * [-1745.103] (-1742.991) (-1741.660) (-1741.203) -- 0:00:57 135000 -- (-1741.479) (-1743.840) (-1745.093) [-1743.265] * [-1742.129] (-1743.420) (-1741.573) (-1742.694) -- 0:01:04 Average standard deviation of split frequencies: 0.020389 135500 -- (-1743.219) [-1741.694] (-1742.281) (-1742.201) * [-1743.351] (-1741.785) (-1740.970) (-1742.706) -- 0:01:03 136000 -- (-1743.467) (-1741.097) [-1742.449] (-1741.630) * (-1743.100) (-1741.701) (-1741.841) [-1742.542] -- 0:01:03 136500 -- (-1744.629) (-1743.400) [-1741.150] (-1742.191) * (-1743.331) (-1741.387) (-1742.046) [-1742.719] -- 0:01:03 137000 -- (-1746.269) [-1742.390] (-1741.363) (-1741.272) * [-1741.969] (-1741.342) (-1742.022) (-1742.285) -- 0:01:02 137500 -- (-1744.227) (-1744.004) [-1742.711] (-1740.468) * (-1745.116) (-1741.073) [-1743.634] (-1745.507) -- 0:01:02 138000 -- (-1744.929) [-1744.256] (-1742.643) (-1741.174) * (-1742.691) (-1740.895) [-1741.180] (-1744.485) -- 0:01:02 138500 -- (-1743.825) (-1744.670) (-1745.283) [-1741.159] * (-1741.394) (-1744.290) (-1741.345) [-1743.570] -- 0:01:02 139000 -- (-1742.561) (-1745.468) (-1746.298) [-1741.299] * (-1741.713) (-1742.969) [-1740.979] (-1743.569) -- 0:01:01 139500 -- [-1741.493] (-1742.512) (-1746.693) (-1740.814) * [-1745.300] (-1742.219) (-1740.735) (-1743.135) -- 0:01:01 140000 -- (-1741.431) (-1743.339) (-1744.329) [-1741.562] * (-1742.979) (-1745.525) (-1743.502) [-1741.851] -- 0:01:01 Average standard deviation of split frequencies: 0.019921 140500 -- (-1742.539) (-1742.510) (-1743.105) [-1741.125] * (-1743.477) (-1742.691) (-1743.499) [-1741.331] -- 0:01:01 141000 -- (-1741.077) [-1745.100] (-1742.803) (-1742.662) * [-1742.456] (-1742.597) (-1744.129) (-1741.328) -- 0:01:00 141500 -- (-1740.803) (-1745.527) [-1745.383] (-1746.105) * (-1741.851) (-1741.537) [-1742.366] (-1742.869) -- 0:01:00 142000 -- (-1742.754) (-1741.902) [-1740.947] (-1744.779) * (-1741.982) (-1744.804) (-1748.202) [-1740.598] -- 0:01:00 142500 -- (-1741.682) (-1742.021) [-1743.383] (-1744.602) * (-1741.723) [-1743.804] (-1744.323) (-1743.990) -- 0:01:00 143000 -- [-1743.167] (-1742.492) (-1742.852) (-1742.530) * (-1741.973) (-1742.999) (-1743.189) [-1741.190] -- 0:00:59 143500 -- (-1741.601) (-1746.789) (-1741.129) [-1741.674] * (-1744.161) (-1741.063) (-1742.204) [-1741.216] -- 0:00:59 144000 -- [-1744.725] (-1744.884) (-1741.347) (-1741.882) * (-1743.201) (-1742.569) (-1742.226) [-1742.334] -- 0:00:59 144500 -- (-1744.440) (-1743.273) (-1742.112) [-1741.790] * (-1745.743) (-1740.945) (-1743.498) [-1741.350] -- 0:00:59 145000 -- (-1742.506) [-1743.629] (-1742.267) (-1741.462) * (-1743.837) (-1742.155) (-1743.497) [-1742.267] -- 0:00:58 Average standard deviation of split frequencies: 0.017938 145500 -- (-1742.509) (-1751.738) [-1741.600] (-1741.560) * (-1744.002) [-1741.125] (-1748.788) (-1742.144) -- 0:00:58 146000 -- (-1743.785) [-1741.883] (-1741.640) (-1741.697) * [-1742.019] (-1741.125) (-1743.398) (-1743.781) -- 0:00:58 146500 -- (-1742.970) [-1742.551] (-1743.562) (-1741.697) * (-1742.762) [-1743.370] (-1743.094) (-1742.697) -- 0:00:58 147000 -- (-1742.178) [-1743.033] (-1743.878) (-1741.799) * [-1742.253] (-1742.295) (-1741.534) (-1742.179) -- 0:00:58 147500 -- (-1744.069) (-1742.895) [-1742.196] (-1741.437) * (-1742.959) (-1742.289) (-1741.546) [-1741.855] -- 0:00:57 148000 -- (-1743.561) [-1744.456] (-1741.875) (-1742.390) * [-1746.320] (-1743.710) (-1741.149) (-1742.036) -- 0:00:57 148500 -- [-1743.698] (-1740.749) (-1741.961) (-1742.762) * (-1743.551) (-1743.111) [-1740.738] (-1744.665) -- 0:00:57 149000 -- (-1743.641) (-1740.859) [-1740.494] (-1743.192) * (-1742.377) [-1744.013] (-1741.357) (-1749.515) -- 0:00:57 149500 -- (-1744.298) (-1742.679) (-1740.627) [-1745.552] * (-1746.095) (-1742.859) [-1740.568] (-1743.787) -- 0:01:02 150000 -- (-1744.319) [-1741.812] (-1740.627) (-1744.308) * (-1743.898) (-1743.000) [-1740.917] (-1743.645) -- 0:01:02 Average standard deviation of split frequencies: 0.019642 150500 -- [-1743.433] (-1742.105) (-1740.627) (-1745.660) * (-1743.702) (-1745.396) (-1747.774) [-1741.401] -- 0:01:02 151000 -- (-1744.769) [-1742.232] (-1740.627) (-1743.418) * (-1742.740) (-1742.822) [-1741.672] (-1742.717) -- 0:01:01 151500 -- [-1742.539] (-1743.970) (-1747.800) (-1743.013) * [-1745.546] (-1740.906) (-1743.009) (-1742.282) -- 0:01:01 152000 -- [-1743.756] (-1744.320) (-1741.910) (-1742.282) * [-1741.430] (-1745.035) (-1743.537) (-1744.774) -- 0:01:01 152500 -- (-1743.785) (-1742.071) [-1741.734] (-1742.214) * (-1741.707) (-1745.035) (-1743.130) [-1743.297] -- 0:01:01 153000 -- [-1741.701] (-1744.725) (-1743.077) (-1742.505) * [-1743.087] (-1746.162) (-1742.306) (-1743.856) -- 0:01:00 153500 -- (-1743.341) [-1747.934] (-1744.978) (-1742.158) * [-1741.098] (-1746.522) (-1743.952) (-1743.012) -- 0:01:00 154000 -- [-1744.252] (-1746.553) (-1741.737) (-1740.699) * [-1741.931] (-1747.180) (-1741.918) (-1745.435) -- 0:01:00 154500 -- (-1743.149) (-1743.770) [-1743.586] (-1740.858) * [-1742.911] (-1747.995) (-1743.152) (-1750.058) -- 0:01:00 155000 -- [-1742.987] (-1741.025) (-1741.797) (-1740.856) * [-1745.202] (-1745.653) (-1746.078) (-1753.004) -- 0:00:59 Average standard deviation of split frequencies: 0.019474 155500 -- [-1744.238] (-1741.025) (-1741.516) (-1744.819) * [-1741.912] (-1744.979) (-1746.502) (-1746.743) -- 0:00:59 156000 -- [-1748.740] (-1740.389) (-1746.934) (-1743.538) * (-1741.793) (-1745.590) [-1749.385] (-1746.621) -- 0:00:59 156500 -- (-1745.388) (-1741.384) [-1742.562] (-1742.538) * (-1743.102) [-1742.103] (-1745.365) (-1743.036) -- 0:00:59 157000 -- [-1742.307] (-1740.942) (-1744.628) (-1744.362) * (-1742.973) [-1742.224] (-1745.040) (-1741.739) -- 0:00:59 157500 -- [-1743.309] (-1743.039) (-1741.285) (-1749.205) * (-1741.809) (-1742.876) [-1743.326] (-1741.809) -- 0:00:58 158000 -- (-1742.543) (-1746.404) [-1742.234] (-1743.130) * [-1741.808] (-1743.219) (-1741.139) (-1741.364) -- 0:00:58 158500 -- (-1742.319) (-1740.573) [-1744.020] (-1743.130) * (-1745.427) (-1746.229) (-1740.686) [-1741.050] -- 0:00:58 159000 -- (-1741.093) (-1740.698) (-1743.590) [-1742.861] * (-1744.532) (-1751.006) [-1742.843] (-1742.034) -- 0:00:58 159500 -- (-1742.364) (-1740.594) (-1744.764) [-1743.074] * (-1744.637) (-1744.007) (-1742.469) [-1742.452] -- 0:00:57 160000 -- [-1743.550] (-1742.394) (-1746.838) (-1747.043) * (-1743.794) (-1742.193) (-1742.186) [-1740.881] -- 0:00:57 Average standard deviation of split frequencies: 0.020193 160500 -- (-1744.928) (-1743.058) (-1741.428) [-1742.400] * (-1744.691) (-1742.551) (-1742.074) [-1743.687] -- 0:00:57 161000 -- (-1745.742) (-1741.604) [-1741.962] (-1742.980) * (-1745.010) [-1742.360] (-1743.255) (-1742.252) -- 0:00:57 161500 -- (-1742.049) (-1741.927) [-1747.566] (-1744.860) * (-1743.682) [-1740.941] (-1743.216) (-1745.566) -- 0:00:57 162000 -- (-1741.753) (-1746.298) [-1743.098] (-1742.250) * [-1742.951] (-1744.870) (-1741.260) (-1752.551) -- 0:00:56 162500 -- (-1746.888) (-1747.693) [-1742.038] (-1742.392) * (-1742.115) (-1747.337) [-1743.457] (-1747.027) -- 0:00:56 163000 -- (-1745.838) (-1745.970) [-1740.798] (-1742.356) * (-1741.196) (-1745.823) [-1741.543] (-1745.394) -- 0:00:56 163500 -- (-1741.424) (-1744.028) (-1743.979) [-1740.928] * (-1742.727) (-1745.418) (-1742.671) [-1742.328] -- 0:00:56 164000 -- (-1744.110) (-1744.320) [-1742.391] (-1741.041) * [-1742.450] (-1743.935) (-1744.943) (-1745.475) -- 0:01:01 164500 -- (-1746.543) (-1746.319) [-1741.677] (-1744.833) * (-1746.281) [-1744.857] (-1746.383) (-1748.660) -- 0:01:00 165000 -- (-1744.659) [-1746.945] (-1744.394) (-1743.147) * (-1744.584) (-1744.551) (-1744.997) [-1743.624] -- 0:01:00 Average standard deviation of split frequencies: 0.017206 165500 -- (-1741.632) (-1744.994) [-1744.581] (-1744.718) * (-1741.803) (-1741.465) (-1741.906) [-1741.474] -- 0:01:00 166000 -- [-1741.631] (-1741.261) (-1744.570) (-1744.571) * [-1741.737] (-1741.468) (-1748.760) (-1744.563) -- 0:01:00 166500 -- [-1742.934] (-1741.606) (-1745.513) (-1743.653) * [-1743.529] (-1743.741) (-1742.891) (-1743.488) -- 0:01:00 167000 -- (-1743.223) (-1741.030) (-1748.744) [-1741.061] * (-1742.812) (-1741.719) (-1743.115) [-1742.019] -- 0:00:59 167500 -- (-1746.928) (-1743.027) [-1743.703] (-1743.442) * [-1741.835] (-1741.718) (-1746.982) (-1746.160) -- 0:00:59 168000 -- (-1746.090) [-1742.989] (-1743.459) (-1740.777) * (-1743.022) (-1742.189) [-1745.658] (-1743.044) -- 0:00:59 168500 -- [-1746.513] (-1742.508) (-1744.264) (-1742.211) * [-1741.522] (-1741.811) (-1741.745) (-1745.366) -- 0:00:59 169000 -- (-1743.784) (-1742.205) [-1741.366] (-1741.287) * (-1742.211) (-1742.000) (-1741.795) [-1742.213] -- 0:00:59 169500 -- [-1743.694] (-1745.599) (-1743.569) (-1742.362) * (-1742.516) (-1745.488) [-1741.727] (-1742.392) -- 0:00:58 170000 -- (-1742.379) (-1740.667) [-1744.018] (-1742.168) * (-1743.713) [-1741.286] (-1745.575) (-1743.442) -- 0:00:58 Average standard deviation of split frequencies: 0.017187 170500 -- (-1743.084) [-1740.545] (-1741.961) (-1742.369) * (-1743.890) (-1743.258) (-1746.763) [-1743.161] -- 0:00:58 171000 -- (-1746.665) (-1742.063) (-1740.896) [-1740.804] * [-1741.305] (-1741.372) (-1747.850) (-1743.479) -- 0:00:58 171500 -- [-1741.637] (-1741.277) (-1743.005) (-1741.257) * (-1742.024) (-1741.488) (-1745.781) [-1743.799] -- 0:00:57 172000 -- (-1741.971) (-1743.343) (-1743.164) [-1742.080] * (-1743.299) (-1743.334) (-1742.308) [-1741.826] -- 0:00:57 172500 -- [-1741.290] (-1741.542) (-1742.623) (-1743.979) * (-1745.579) [-1742.473] (-1742.297) (-1743.438) -- 0:00:57 173000 -- (-1744.587) (-1742.298) [-1742.617] (-1741.912) * (-1743.836) [-1742.036] (-1745.644) (-1742.080) -- 0:00:57 173500 -- (-1745.482) [-1742.027] (-1747.691) (-1741.830) * [-1747.003] (-1742.385) (-1745.554) (-1742.416) -- 0:00:57 174000 -- (-1743.741) [-1743.729] (-1741.827) (-1743.899) * (-1747.509) (-1745.962) [-1744.624] (-1741.077) -- 0:00:56 174500 -- (-1743.319) (-1743.078) [-1740.928] (-1747.004) * (-1745.008) [-1744.004] (-1743.053) (-1745.295) -- 0:00:56 175000 -- (-1743.007) (-1742.255) [-1741.784] (-1743.127) * [-1749.191] (-1744.382) (-1742.092) (-1750.175) -- 0:00:56 Average standard deviation of split frequencies: 0.016775 175500 -- (-1742.187) [-1741.165] (-1742.077) (-1742.780) * (-1751.666) [-1745.795] (-1746.095) (-1759.445) -- 0:00:56 176000 -- (-1743.154) (-1741.031) (-1742.077) [-1743.696] * [-1742.380] (-1741.268) (-1743.541) (-1753.673) -- 0:00:56 176500 -- [-1742.764] (-1743.638) (-1742.177) (-1746.237) * (-1741.482) [-1741.731] (-1746.769) (-1750.930) -- 0:00:55 177000 -- (-1745.903) [-1741.847] (-1742.383) (-1743.370) * (-1741.031) (-1740.987) [-1742.782] (-1742.073) -- 0:00:55 177500 -- (-1745.371) (-1747.001) [-1745.541] (-1745.313) * (-1741.612) (-1744.302) [-1741.103] (-1740.844) -- 0:00:55 178000 -- [-1744.376] (-1743.258) (-1743.876) (-1743.359) * (-1741.111) (-1744.174) [-1741.793] (-1742.361) -- 0:00:55 178500 -- (-1743.447) (-1743.914) [-1743.471] (-1742.868) * [-1741.180] (-1740.683) (-1742.160) (-1743.856) -- 0:00:55 179000 -- [-1745.317] (-1744.981) (-1743.189) (-1743.087) * (-1741.456) [-1743.249] (-1741.648) (-1741.899) -- 0:00:59 179500 -- (-1746.640) (-1748.270) (-1744.744) [-1742.000] * [-1741.615] (-1743.968) (-1741.627) (-1741.329) -- 0:00:59 180000 -- (-1741.313) (-1746.367) [-1743.757] (-1745.541) * (-1742.793) [-1742.610] (-1741.619) (-1742.298) -- 0:00:59 Average standard deviation of split frequencies: 0.016891 180500 -- [-1748.246] (-1747.406) (-1741.714) (-1745.643) * (-1743.338) (-1745.410) (-1743.594) [-1744.078] -- 0:00:59 181000 -- (-1740.750) (-1745.760) [-1741.478] (-1749.135) * (-1742.682) [-1744.671] (-1742.975) (-1742.122) -- 0:00:58 181500 -- [-1741.030] (-1747.359) (-1744.971) (-1746.992) * (-1742.539) [-1746.113] (-1742.953) (-1741.924) -- 0:00:58 182000 -- [-1742.825] (-1743.464) (-1743.944) (-1743.509) * (-1740.961) (-1743.840) (-1741.875) [-1741.673] -- 0:00:58 182500 -- (-1741.775) (-1743.147) (-1743.512) [-1743.383] * (-1742.042) (-1745.466) [-1744.508] (-1741.673) -- 0:00:58 183000 -- (-1743.646) (-1743.110) [-1742.202] (-1741.708) * (-1740.593) (-1747.192) [-1741.183] (-1741.811) -- 0:00:58 183500 -- (-1742.179) (-1745.627) [-1742.628] (-1742.056) * (-1740.470) (-1747.137) (-1743.549) [-1741.268] -- 0:00:57 184000 -- (-1742.418) (-1745.001) [-1742.629] (-1742.905) * [-1742.850] (-1745.568) (-1743.691) (-1742.026) -- 0:00:57 184500 -- (-1743.424) (-1743.032) (-1740.471) [-1746.170] * (-1746.033) (-1741.738) (-1742.195) [-1741.142] -- 0:00:57 185000 -- [-1745.108] (-1744.600) (-1741.941) (-1744.332) * (-1742.999) (-1740.500) (-1746.055) [-1741.076] -- 0:00:57 Average standard deviation of split frequencies: 0.016807 185500 -- (-1746.138) (-1743.204) (-1744.257) [-1744.199] * (-1742.864) (-1742.017) (-1743.139) [-1741.025] -- 0:00:57 186000 -- (-1741.186) [-1743.417] (-1744.532) (-1743.235) * (-1750.212) (-1743.472) (-1741.293) [-1740.823] -- 0:00:56 186500 -- (-1741.692) (-1744.027) (-1743.727) [-1743.804] * (-1751.025) [-1741.719] (-1741.059) (-1741.379) -- 0:00:56 187000 -- (-1742.141) [-1744.856] (-1741.214) (-1741.400) * (-1751.029) (-1741.406) [-1741.518] (-1742.471) -- 0:00:56 187500 -- (-1742.323) (-1743.152) (-1741.617) [-1741.977] * (-1744.731) [-1742.020] (-1740.876) (-1741.364) -- 0:00:56 188000 -- [-1741.723] (-1745.492) (-1744.385) (-1741.630) * [-1742.979] (-1741.272) (-1742.207) (-1741.522) -- 0:00:56 188500 -- (-1745.790) (-1745.332) [-1743.357] (-1744.078) * (-1743.056) (-1743.502) [-1741.760] (-1741.933) -- 0:00:55 189000 -- (-1745.128) (-1744.107) (-1740.912) [-1742.871] * [-1743.550] (-1743.255) (-1741.469) (-1740.619) -- 0:00:55 189500 -- (-1743.336) (-1745.574) (-1740.922) [-1740.711] * (-1741.249) (-1742.745) [-1744.105] (-1741.142) -- 0:00:55 190000 -- (-1743.069) [-1742.062] (-1742.930) (-1744.000) * (-1747.180) [-1742.297] (-1747.626) (-1746.296) -- 0:00:55 Average standard deviation of split frequencies: 0.016526 190500 -- [-1740.814] (-1744.875) (-1742.023) (-1741.307) * (-1741.981) [-1741.028] (-1743.206) (-1741.669) -- 0:00:55 191000 -- (-1745.828) (-1741.342) [-1742.346] (-1745.517) * (-1742.386) (-1743.089) [-1743.417] (-1746.884) -- 0:00:55 191500 -- (-1742.234) (-1741.310) (-1746.410) [-1741.562] * (-1744.887) (-1743.697) (-1741.283) [-1742.748] -- 0:00:54 192000 -- (-1746.381) (-1741.179) (-1747.545) [-1746.437] * (-1742.428) (-1745.468) [-1741.272] (-1744.995) -- 0:00:58 192500 -- [-1742.758] (-1746.324) (-1751.342) (-1752.522) * (-1743.923) (-1744.470) [-1741.241] (-1743.703) -- 0:00:58 193000 -- (-1741.866) (-1741.273) [-1744.925] (-1746.431) * [-1743.717] (-1742.964) (-1743.945) (-1743.581) -- 0:00:58 193500 -- [-1742.209] (-1742.538) (-1742.056) (-1741.497) * [-1743.445] (-1745.741) (-1743.172) (-1743.087) -- 0:00:58 194000 -- (-1741.804) [-1742.571] (-1744.000) (-1742.703) * (-1743.985) (-1743.031) [-1742.272] (-1743.487) -- 0:00:58 194500 -- (-1741.832) (-1741.401) [-1742.192] (-1744.870) * (-1742.966) (-1746.709) [-1741.847] (-1745.463) -- 0:00:57 195000 -- (-1741.825) (-1743.870) [-1743.041] (-1742.468) * [-1741.597] (-1747.952) (-1741.658) (-1744.554) -- 0:00:57 Average standard deviation of split frequencies: 0.018038 195500 -- [-1740.825] (-1744.785) (-1744.393) (-1743.169) * (-1745.654) [-1743.646] (-1741.864) (-1743.545) -- 0:00:57 196000 -- (-1741.426) (-1745.194) [-1745.101] (-1743.438) * (-1740.707) [-1744.233] (-1749.166) (-1744.570) -- 0:00:57 196500 -- (-1746.491) (-1742.720) (-1742.086) [-1742.551] * (-1741.450) [-1744.133] (-1745.495) (-1744.108) -- 0:00:57 197000 -- [-1741.860] (-1742.282) (-1742.359) (-1742.072) * [-1744.158] (-1743.912) (-1743.926) (-1744.488) -- 0:00:57 197500 -- (-1742.308) (-1741.560) [-1744.295] (-1745.877) * [-1741.744] (-1748.112) (-1742.579) (-1740.877) -- 0:00:56 198000 -- (-1743.134) [-1744.156] (-1742.856) (-1744.557) * (-1742.014) (-1745.437) (-1743.735) [-1740.890] -- 0:00:56 198500 -- (-1743.777) (-1745.361) (-1744.591) [-1743.007] * [-1741.341] (-1743.328) (-1745.805) (-1741.033) -- 0:00:56 199000 -- (-1741.798) (-1743.802) (-1744.100) [-1743.340] * [-1744.141] (-1743.434) (-1745.904) (-1740.742) -- 0:00:56 199500 -- (-1741.751) [-1744.707] (-1742.950) (-1745.901) * [-1744.880] (-1744.427) (-1741.938) (-1741.071) -- 0:00:56 200000 -- [-1741.844] (-1742.119) (-1744.043) (-1748.196) * (-1742.631) (-1745.792) [-1741.758] (-1741.212) -- 0:00:55 Average standard deviation of split frequencies: 0.017928 200500 -- [-1741.802] (-1741.649) (-1742.765) (-1745.688) * (-1742.030) (-1742.683) (-1741.499) [-1745.510] -- 0:00:55 201000 -- (-1741.509) [-1741.627] (-1743.133) (-1746.663) * [-1743.643] (-1741.819) (-1744.238) (-1744.569) -- 0:00:55 201500 -- (-1741.499) (-1741.055) [-1743.465] (-1743.573) * [-1741.951] (-1746.286) (-1747.444) (-1744.695) -- 0:00:55 202000 -- [-1742.306] (-1741.032) (-1753.133) (-1744.625) * (-1745.755) [-1743.426] (-1747.472) (-1747.021) -- 0:00:55 202500 -- (-1744.696) [-1744.434] (-1744.268) (-1743.743) * (-1741.617) [-1741.583] (-1747.394) (-1741.740) -- 0:00:55 203000 -- (-1746.339) [-1743.546] (-1744.409) (-1743.741) * (-1744.189) (-1741.769) [-1746.320] (-1741.863) -- 0:00:54 203500 -- (-1743.771) [-1742.960] (-1741.819) (-1743.142) * [-1742.567] (-1741.517) (-1745.449) (-1742.549) -- 0:00:54 204000 -- [-1744.794] (-1741.875) (-1747.273) (-1742.930) * [-1740.836] (-1747.139) (-1742.570) (-1741.329) -- 0:00:54 204500 -- (-1748.722) (-1742.180) [-1741.710] (-1741.371) * (-1740.900) (-1744.042) [-1743.507] (-1742.385) -- 0:00:58 205000 -- (-1740.765) [-1742.692] (-1741.377) (-1741.916) * (-1741.413) [-1741.973] (-1745.930) (-1741.866) -- 0:00:58 Average standard deviation of split frequencies: 0.018066 205500 -- (-1741.040) [-1742.160] (-1741.638) (-1743.064) * [-1743.435] (-1742.480) (-1742.082) (-1742.409) -- 0:00:57 206000 -- (-1743.375) (-1742.057) [-1742.683] (-1744.931) * (-1741.137) (-1743.079) (-1749.309) [-1742.307] -- 0:00:57 206500 -- [-1744.082] (-1744.308) (-1742.108) (-1743.846) * (-1741.147) [-1742.715] (-1747.034) (-1742.765) -- 0:00:57 207000 -- (-1742.103) (-1743.334) (-1746.948) [-1743.325] * [-1742.543] (-1742.450) (-1742.674) (-1742.626) -- 0:00:57 207500 -- (-1743.752) (-1747.847) (-1742.996) [-1742.482] * (-1748.416) [-1742.191] (-1742.753) (-1742.929) -- 0:00:57 208000 -- [-1743.473] (-1746.178) (-1743.182) (-1744.461) * (-1745.890) (-1743.335) [-1743.366] (-1742.352) -- 0:00:57 208500 -- (-1742.102) [-1742.453] (-1742.087) (-1744.105) * (-1745.188) (-1744.454) (-1743.296) [-1745.790] -- 0:00:56 209000 -- (-1742.458) [-1743.525] (-1741.481) (-1741.884) * [-1746.484] (-1745.352) (-1743.039) (-1742.724) -- 0:00:56 209500 -- (-1742.047) (-1741.621) [-1741.022] (-1743.083) * (-1746.447) (-1745.752) [-1742.762] (-1743.032) -- 0:00:56 210000 -- (-1743.341) (-1741.289) [-1741.176] (-1744.797) * (-1745.821) [-1741.932] (-1741.548) (-1742.831) -- 0:00:56 Average standard deviation of split frequencies: 0.017280 210500 -- (-1744.545) (-1743.120) [-1741.169] (-1748.969) * [-1746.328] (-1740.592) (-1744.360) (-1743.821) -- 0:00:56 211000 -- (-1744.951) [-1740.821] (-1741.865) (-1742.740) * (-1745.183) (-1742.090) (-1744.589) [-1745.155] -- 0:00:56 211500 -- (-1744.949) (-1741.490) (-1742.685) [-1742.175] * (-1744.027) [-1742.116] (-1749.889) (-1745.103) -- 0:00:55 212000 -- (-1743.883) (-1743.634) [-1741.491] (-1742.697) * (-1742.738) [-1741.061] (-1744.274) (-1744.244) -- 0:00:55 212500 -- [-1742.948] (-1741.862) (-1742.291) (-1741.990) * (-1742.770) (-1741.034) (-1742.170) [-1742.716] -- 0:00:55 213000 -- (-1747.117) (-1743.534) [-1741.655] (-1742.113) * (-1741.830) (-1741.403) [-1743.222] (-1742.803) -- 0:00:55 213500 -- [-1744.532] (-1742.639) (-1741.530) (-1742.093) * (-1741.299) [-1742.330] (-1742.536) (-1743.949) -- 0:00:55 214000 -- [-1743.959] (-1745.514) (-1743.836) (-1741.201) * (-1742.959) [-1742.328] (-1747.950) (-1743.272) -- 0:00:55 214500 -- (-1742.625) (-1744.057) [-1741.321] (-1742.001) * [-1741.928] (-1741.573) (-1746.297) (-1744.036) -- 0:00:54 215000 -- (-1741.845) [-1744.243] (-1742.427) (-1747.243) * (-1744.186) (-1741.664) (-1743.058) [-1746.747] -- 0:00:54 Average standard deviation of split frequencies: 0.018187 215500 -- (-1742.505) (-1744.902) [-1743.401] (-1747.064) * (-1746.105) (-1750.562) [-1748.178] (-1744.077) -- 0:00:54 216000 -- [-1742.547] (-1745.950) (-1740.635) (-1746.899) * [-1744.065] (-1749.494) (-1741.872) (-1742.486) -- 0:00:58 216500 -- (-1742.938) [-1741.416] (-1740.701) (-1743.909) * (-1745.853) [-1740.238] (-1740.941) (-1744.205) -- 0:00:57 217000 -- (-1745.080) (-1741.892) [-1740.701] (-1746.303) * (-1748.360) [-1741.836] (-1743.039) (-1743.849) -- 0:00:57 217500 -- (-1741.569) (-1746.850) [-1741.018] (-1745.951) * [-1741.929] (-1741.250) (-1742.114) (-1751.684) -- 0:00:57 218000 -- (-1740.793) (-1742.396) [-1741.104] (-1744.683) * (-1741.740) (-1744.327) (-1741.497) [-1749.896] -- 0:00:57 218500 -- (-1740.537) [-1741.555] (-1741.336) (-1742.976) * [-1741.128] (-1742.658) (-1741.591) (-1746.360) -- 0:00:57 219000 -- [-1741.914] (-1743.673) (-1742.374) (-1745.720) * [-1744.119] (-1742.463) (-1742.361) (-1744.963) -- 0:00:57 219500 -- [-1741.614] (-1742.198) (-1742.952) (-1748.016) * (-1743.422) [-1742.284] (-1741.906) (-1742.666) -- 0:00:56 220000 -- (-1742.175) [-1743.044] (-1744.109) (-1748.152) * (-1749.394) (-1745.854) (-1744.195) [-1742.962] -- 0:00:56 Average standard deviation of split frequencies: 0.018040 220500 -- [-1740.824] (-1745.229) (-1742.744) (-1744.281) * [-1743.562] (-1741.799) (-1742.207) (-1742.332) -- 0:00:56 221000 -- (-1741.929) (-1745.768) [-1741.999] (-1744.044) * [-1742.782] (-1741.799) (-1744.960) (-1741.296) -- 0:00:56 221500 -- (-1746.677) [-1742.366] (-1742.899) (-1742.557) * (-1744.722) (-1742.297) [-1743.762] (-1741.892) -- 0:00:56 222000 -- (-1747.394) [-1742.464] (-1743.010) (-1740.592) * (-1742.016) [-1742.737] (-1744.215) (-1747.508) -- 0:00:56 222500 -- (-1745.879) [-1744.986] (-1743.460) (-1740.537) * [-1743.387] (-1742.515) (-1742.205) (-1747.275) -- 0:00:55 223000 -- (-1743.014) (-1743.507) [-1741.725] (-1741.129) * (-1741.397) [-1744.690] (-1741.920) (-1743.678) -- 0:00:55 223500 -- (-1741.942) (-1742.618) [-1741.914] (-1743.859) * (-1741.397) (-1742.682) [-1740.841] (-1742.744) -- 0:00:55 224000 -- [-1741.819] (-1742.155) (-1741.916) (-1746.209) * [-1741.397] (-1745.593) (-1744.065) (-1740.994) -- 0:00:55 224500 -- [-1741.265] (-1741.924) (-1742.466) (-1743.277) * (-1741.188) (-1742.508) (-1743.911) [-1742.462] -- 0:00:55 225000 -- (-1744.364) (-1741.928) (-1745.473) [-1742.921] * (-1741.511) (-1740.522) (-1742.458) [-1741.384] -- 0:00:55 Average standard deviation of split frequencies: 0.017150 225500 -- (-1742.609) [-1740.708] (-1742.526) (-1742.122) * (-1742.489) [-1741.162] (-1749.899) (-1742.936) -- 0:00:54 226000 -- (-1742.763) [-1740.835] (-1743.996) (-1743.117) * (-1741.968) (-1742.429) [-1742.581] (-1743.157) -- 0:00:54 226500 -- (-1742.481) [-1742.865] (-1744.379) (-1743.927) * (-1748.752) (-1748.605) [-1740.804] (-1743.219) -- 0:00:54 227000 -- (-1741.974) (-1742.344) [-1746.018] (-1745.888) * (-1743.490) [-1747.143] (-1743.928) (-1740.656) -- 0:00:54 227500 -- (-1744.276) (-1744.847) (-1743.965) [-1741.361] * (-1741.445) (-1741.526) (-1747.142) [-1742.694] -- 0:00:54 228000 -- [-1743.766] (-1743.475) (-1743.880) (-1742.199) * (-1740.743) [-1741.860] (-1747.062) (-1742.798) -- 0:00:54 228500 -- (-1741.815) (-1741.921) [-1742.309] (-1742.199) * (-1744.467) (-1744.795) [-1742.192] (-1742.418) -- 0:00:54 229000 -- (-1741.506) (-1744.924) (-1743.039) [-1743.054] * (-1746.840) (-1741.570) (-1740.688) [-1742.003] -- 0:00:57 229500 -- (-1747.122) (-1741.060) (-1742.625) [-1742.816] * [-1741.472] (-1742.390) (-1743.002) (-1743.190) -- 0:00:57 230000 -- (-1743.823) [-1740.475] (-1743.183) (-1742.065) * (-1744.408) [-1742.915] (-1742.959) (-1742.722) -- 0:00:56 Average standard deviation of split frequencies: 0.017672 230500 -- (-1743.372) (-1740.475) (-1741.493) [-1740.835] * (-1741.925) [-1742.050] (-1742.948) (-1741.301) -- 0:00:56 231000 -- (-1742.140) [-1745.392] (-1745.518) (-1744.083) * (-1742.130) [-1742.264] (-1741.613) (-1742.208) -- 0:00:56 231500 -- (-1742.109) [-1741.717] (-1743.982) (-1742.681) * [-1741.872] (-1742.264) (-1742.536) (-1742.844) -- 0:00:56 232000 -- [-1741.428] (-1742.917) (-1745.972) (-1741.102) * (-1741.419) (-1742.399) [-1744.315] (-1743.172) -- 0:00:56 232500 -- (-1741.434) [-1742.199] (-1746.225) (-1746.993) * [-1742.091] (-1742.623) (-1743.312) (-1743.082) -- 0:00:56 233000 -- (-1746.971) [-1742.201] (-1745.853) (-1744.003) * (-1742.399) (-1743.140) [-1743.324] (-1744.528) -- 0:00:55 233500 -- [-1740.542] (-1744.851) (-1743.692) (-1745.620) * (-1741.574) (-1744.456) [-1740.625] (-1742.222) -- 0:00:55 234000 -- (-1740.808) (-1744.014) (-1742.399) [-1741.303] * [-1741.452] (-1743.282) (-1741.137) (-1742.046) -- 0:00:55 234500 -- (-1741.047) (-1744.919) [-1745.169] (-1744.152) * (-1743.248) (-1744.557) (-1741.486) [-1744.372] -- 0:00:55 235000 -- (-1743.087) (-1741.720) [-1742.955] (-1743.035) * [-1742.322] (-1743.366) (-1746.964) (-1744.297) -- 0:00:55 Average standard deviation of split frequencies: 0.017507 235500 -- (-1741.623) [-1742.471] (-1743.507) (-1741.243) * (-1742.096) [-1744.367] (-1744.173) (-1742.007) -- 0:00:55 236000 -- (-1741.598) (-1744.851) [-1742.395] (-1743.805) * [-1744.692] (-1744.650) (-1743.224) (-1743.913) -- 0:00:55 236500 -- (-1745.954) (-1741.942) (-1742.645) [-1743.805] * (-1741.809) [-1742.037] (-1741.101) (-1744.113) -- 0:00:54 237000 -- [-1741.109] (-1743.479) (-1742.090) (-1743.061) * (-1741.997) [-1741.169] (-1741.522) (-1741.646) -- 0:00:54 237500 -- [-1740.732] (-1742.441) (-1744.616) (-1743.201) * (-1741.569) (-1741.314) (-1742.836) [-1743.032] -- 0:00:54 238000 -- (-1741.544) (-1745.687) [-1744.882] (-1742.525) * [-1741.079] (-1743.665) (-1745.248) (-1745.045) -- 0:00:54 238500 -- (-1742.214) (-1743.575) [-1744.669] (-1744.961) * (-1745.663) (-1745.924) [-1743.489] (-1743.977) -- 0:00:54 239000 -- [-1741.413] (-1743.835) (-1741.254) (-1741.160) * (-1741.111) (-1741.408) (-1740.730) [-1745.799] -- 0:00:54 239500 -- (-1744.949) (-1747.073) (-1741.973) [-1742.118] * (-1742.872) (-1743.881) [-1741.215] (-1740.690) -- 0:00:53 240000 -- (-1743.969) (-1744.317) [-1746.708] (-1741.580) * (-1743.747) (-1742.484) (-1741.102) [-1741.314] -- 0:00:53 Average standard deviation of split frequencies: 0.015785 240500 -- (-1743.726) (-1745.283) (-1742.900) [-1740.964] * (-1743.227) [-1741.806] (-1742.816) (-1745.222) -- 0:00:53 241000 -- (-1740.728) (-1746.935) [-1741.990] (-1740.826) * (-1743.334) [-1740.892] (-1741.217) (-1743.428) -- 0:00:53 241500 -- (-1741.601) [-1745.385] (-1741.025) (-1742.151) * [-1740.929] (-1741.576) (-1742.033) (-1742.271) -- 0:00:53 242000 -- (-1744.476) [-1745.083] (-1740.958) (-1744.243) * [-1742.775] (-1742.546) (-1741.645) (-1743.159) -- 0:00:53 242500 -- (-1744.754) (-1743.745) [-1742.723] (-1742.789) * (-1743.101) [-1742.340] (-1743.944) (-1745.109) -- 0:00:53 243000 -- (-1743.967) [-1741.192] (-1741.880) (-1742.575) * (-1744.127) (-1743.991) [-1742.737] (-1743.913) -- 0:00:56 243500 -- [-1744.293] (-1741.192) (-1742.731) (-1742.425) * (-1743.205) (-1741.777) [-1740.973] (-1741.534) -- 0:00:55 244000 -- (-1741.711) (-1745.127) (-1743.765) [-1743.049] * [-1747.131] (-1741.588) (-1742.977) (-1741.947) -- 0:00:55 244500 -- (-1743.934) (-1747.601) (-1742.918) [-1742.906] * (-1748.781) (-1741.599) [-1741.424] (-1741.423) -- 0:00:55 245000 -- (-1744.289) (-1742.697) (-1742.406) [-1741.447] * (-1747.268) (-1746.187) (-1745.955) [-1741.534] -- 0:00:55 Average standard deviation of split frequencies: 0.015543 245500 -- (-1745.132) [-1742.402] (-1741.443) (-1743.516) * (-1743.060) (-1744.978) [-1745.727] (-1745.019) -- 0:00:55 246000 -- (-1747.268) [-1742.866] (-1740.839) (-1744.687) * (-1741.948) [-1741.490] (-1741.201) (-1743.348) -- 0:00:55 246500 -- (-1743.332) (-1743.168) (-1742.555) [-1743.254] * [-1742.830] (-1742.327) (-1743.132) (-1743.458) -- 0:00:55 247000 -- (-1743.753) [-1742.763] (-1742.577) (-1742.096) * (-1743.227) (-1741.803) [-1742.929] (-1742.780) -- 0:00:54 247500 -- (-1742.133) [-1741.812] (-1742.297) (-1742.763) * (-1743.412) [-1742.911] (-1742.121) (-1742.258) -- 0:00:54 248000 -- (-1741.081) (-1740.507) (-1744.238) [-1743.099] * [-1744.644] (-1741.916) (-1742.229) (-1742.312) -- 0:00:54 248500 -- [-1744.220] (-1740.404) (-1741.286) (-1744.330) * (-1746.642) (-1745.714) [-1740.935] (-1744.083) -- 0:00:54 249000 -- (-1743.233) [-1740.647] (-1742.295) (-1744.578) * [-1742.335] (-1744.544) (-1743.062) (-1743.763) -- 0:00:54 249500 -- (-1743.299) [-1740.979] (-1742.680) (-1744.296) * [-1744.069] (-1743.072) (-1744.305) (-1743.744) -- 0:00:54 250000 -- [-1741.984] (-1741.265) (-1743.263) (-1743.828) * (-1744.513) [-1742.878] (-1740.995) (-1742.309) -- 0:00:54 Average standard deviation of split frequencies: 0.015567 250500 -- (-1742.415) [-1741.270] (-1742.790) (-1742.379) * [-1740.470] (-1743.074) (-1743.103) (-1743.587) -- 0:00:53 251000 -- (-1743.836) [-1742.964] (-1746.887) (-1746.474) * [-1743.338] (-1745.188) (-1741.507) (-1744.693) -- 0:00:53 251500 -- (-1741.998) (-1741.622) [-1740.917] (-1744.924) * [-1742.129] (-1740.779) (-1741.470) (-1748.107) -- 0:00:53 252000 -- (-1741.934) (-1742.688) [-1742.295] (-1745.462) * [-1740.904] (-1741.246) (-1742.276) (-1740.967) -- 0:00:53 252500 -- (-1742.081) [-1740.540] (-1741.549) (-1747.556) * (-1741.561) (-1742.023) (-1740.903) [-1740.854] -- 0:00:53 253000 -- (-1742.271) [-1743.512] (-1740.585) (-1746.152) * (-1746.394) (-1741.139) (-1742.294) [-1742.244] -- 0:00:53 253500 -- [-1741.454] (-1744.271) (-1743.329) (-1742.766) * [-1740.916] (-1744.375) (-1742.856) (-1741.349) -- 0:00:53 254000 -- (-1744.338) (-1743.805) [-1743.017] (-1742.144) * (-1741.077) (-1747.068) (-1742.389) [-1748.590] -- 0:00:52 254500 -- (-1744.380) (-1741.358) (-1743.440) [-1741.475] * [-1741.425] (-1744.002) (-1741.004) (-1744.401) -- 0:00:52 255000 -- (-1742.376) (-1741.271) [-1745.746] (-1740.706) * (-1741.429) [-1744.033] (-1741.131) (-1744.307) -- 0:00:52 Average standard deviation of split frequencies: 0.015165 255500 -- [-1742.958] (-1743.649) (-1742.770) (-1742.578) * (-1743.847) (-1744.279) (-1743.596) [-1743.834] -- 0:00:52 256000 -- [-1741.504] (-1741.215) (-1743.793) (-1741.984) * (-1743.350) [-1742.980] (-1744.564) (-1741.314) -- 0:00:52 256500 -- [-1741.591] (-1743.423) (-1744.579) (-1742.106) * (-1741.999) [-1743.315] (-1742.639) (-1741.324) -- 0:00:55 257000 -- (-1742.225) (-1742.803) [-1744.306] (-1741.355) * (-1742.734) [-1741.818] (-1742.363) (-1741.399) -- 0:00:54 257500 -- (-1742.010) [-1744.615] (-1743.221) (-1742.520) * (-1740.915) (-1742.831) [-1742.497] (-1748.419) -- 0:00:54 258000 -- [-1743.410] (-1745.627) (-1742.411) (-1744.037) * [-1741.511] (-1743.593) (-1741.183) (-1743.023) -- 0:00:54 258500 -- (-1743.816) [-1741.667] (-1743.086) (-1747.348) * (-1742.030) [-1746.305] (-1741.021) (-1742.072) -- 0:00:54 259000 -- (-1743.390) (-1743.011) (-1744.882) [-1745.524] * [-1743.925] (-1743.935) (-1742.814) (-1742.740) -- 0:00:54 259500 -- (-1741.916) [-1743.714] (-1741.693) (-1744.803) * (-1741.932) (-1745.214) (-1743.528) [-1743.346] -- 0:00:54 260000 -- (-1741.056) (-1746.876) (-1743.529) [-1741.719] * (-1745.278) (-1742.739) (-1747.752) [-1744.880] -- 0:00:54 Average standard deviation of split frequencies: 0.014468 260500 -- (-1741.594) (-1741.898) (-1741.276) [-1741.995] * (-1742.651) (-1740.930) [-1740.562] (-1749.632) -- 0:00:53 261000 -- [-1740.829] (-1743.905) (-1742.435) (-1742.467) * [-1744.212] (-1741.251) (-1745.239) (-1743.831) -- 0:00:53 261500 -- [-1740.752] (-1741.357) (-1743.416) (-1742.038) * (-1746.138) [-1741.807] (-1742.125) (-1743.425) -- 0:00:53 262000 -- (-1745.644) (-1741.353) [-1741.822] (-1742.462) * (-1745.463) [-1741.714] (-1741.681) (-1742.341) -- 0:00:53 262500 -- (-1743.842) (-1742.491) (-1740.403) [-1743.223] * (-1743.748) [-1741.041] (-1743.505) (-1743.349) -- 0:00:53 263000 -- (-1752.275) (-1743.750) [-1746.082] (-1743.761) * [-1742.639] (-1741.926) (-1743.087) (-1742.179) -- 0:00:53 263500 -- (-1745.141) (-1742.243) (-1742.869) [-1742.809] * [-1742.061] (-1742.049) (-1741.658) (-1742.050) -- 0:00:53 264000 -- (-1740.982) (-1741.005) [-1741.470] (-1742.350) * (-1742.023) (-1744.599) [-1741.816] (-1744.370) -- 0:00:52 264500 -- [-1741.924] (-1741.027) (-1742.005) (-1745.600) * [-1743.301] (-1744.963) (-1742.676) (-1742.838) -- 0:00:52 265000 -- (-1742.439) (-1744.024) (-1744.798) [-1742.730] * (-1742.304) (-1744.854) (-1742.452) [-1741.800] -- 0:00:52 Average standard deviation of split frequencies: 0.013784 265500 -- (-1740.578) (-1741.952) [-1743.716] (-1743.544) * (-1748.434) (-1745.100) (-1743.825) [-1741.592] -- 0:00:52 266000 -- [-1740.871] (-1741.284) (-1745.456) (-1741.031) * (-1742.442) (-1744.085) (-1744.161) [-1740.810] -- 0:00:52 266500 -- (-1741.681) (-1741.421) [-1742.156] (-1741.021) * (-1742.618) [-1743.381] (-1745.411) (-1744.166) -- 0:00:52 267000 -- (-1741.829) [-1741.873] (-1747.111) (-1742.459) * (-1743.548) (-1742.123) (-1746.448) [-1747.032] -- 0:00:52 267500 -- (-1741.041) [-1741.892] (-1750.217) (-1741.756) * (-1745.928) (-1742.077) [-1742.964] (-1743.428) -- 0:00:52 268000 -- [-1743.482] (-1742.928) (-1743.348) (-1742.550) * (-1744.594) (-1741.030) [-1742.253] (-1742.334) -- 0:00:51 268500 -- (-1743.471) [-1742.997] (-1745.763) (-1742.622) * (-1744.696) [-1740.842] (-1744.469) (-1745.241) -- 0:00:51 269000 -- (-1741.617) (-1742.089) [-1744.423] (-1745.409) * (-1745.140) (-1742.210) (-1743.351) [-1741.582] -- 0:00:51 269500 -- (-1742.781) [-1741.706] (-1740.675) (-1746.122) * (-1746.655) [-1742.501] (-1745.268) (-1742.192) -- 0:00:51 270000 -- (-1742.573) (-1742.582) (-1742.390) [-1742.277] * (-1743.665) (-1744.456) [-1746.545] (-1742.191) -- 0:00:54 Average standard deviation of split frequencies: 0.012704 270500 -- (-1741.976) (-1742.110) [-1743.970] (-1741.670) * (-1743.020) (-1745.308) (-1742.871) [-1742.023] -- 0:00:53 271000 -- (-1741.440) (-1743.603) (-1748.575) [-1741.681] * (-1749.497) (-1743.589) (-1743.633) [-1742.392] -- 0:00:53 271500 -- (-1742.685) (-1741.193) (-1748.150) [-1741.418] * (-1743.476) [-1743.395] (-1744.883) (-1744.174) -- 0:00:53 272000 -- (-1740.617) [-1744.833] (-1742.601) (-1741.895) * (-1743.086) (-1743.329) [-1744.586] (-1743.189) -- 0:00:53 272500 -- (-1741.666) [-1741.567] (-1741.408) (-1745.557) * (-1741.040) (-1742.951) (-1744.842) [-1741.553] -- 0:00:53 273000 -- (-1742.696) (-1741.549) [-1741.522] (-1744.568) * (-1740.936) [-1742.531] (-1744.968) (-1742.219) -- 0:00:53 273500 -- (-1744.014) [-1741.334] (-1741.522) (-1743.923) * (-1740.853) [-1742.955] (-1742.236) (-1743.321) -- 0:00:53 274000 -- [-1741.202] (-1744.499) (-1742.056) (-1745.518) * (-1741.471) [-1744.927] (-1742.712) (-1742.459) -- 0:00:52 274500 -- (-1744.304) (-1742.696) [-1740.615] (-1742.161) * [-1741.429] (-1742.855) (-1744.003) (-1740.936) -- 0:00:52 275000 -- (-1742.689) (-1742.562) [-1740.527] (-1741.423) * (-1743.930) (-1740.787) (-1742.623) [-1741.580] -- 0:00:52 Average standard deviation of split frequencies: 0.012917 275500 -- (-1740.610) (-1742.813) (-1740.527) [-1740.579] * (-1744.927) (-1741.783) [-1741.505] (-1742.333) -- 0:00:52 276000 -- (-1742.278) (-1742.391) (-1743.397) [-1741.193] * (-1743.848) [-1741.605] (-1746.631) (-1741.814) -- 0:00:52 276500 -- (-1742.685) (-1742.810) (-1745.440) [-1743.188] * (-1742.727) (-1741.602) [-1743.455] (-1741.902) -- 0:00:52 277000 -- (-1742.668) (-1742.930) [-1744.143] (-1740.849) * (-1741.175) (-1740.588) (-1741.201) [-1742.183] -- 0:00:52 277500 -- (-1746.788) (-1742.198) (-1741.537) [-1741.444] * (-1742.838) (-1743.900) (-1743.713) [-1743.898] -- 0:00:52 278000 -- (-1745.172) (-1742.449) (-1741.216) [-1740.820] * (-1745.067) [-1740.867] (-1745.798) (-1741.961) -- 0:00:51 278500 -- (-1744.608) (-1745.093) [-1741.836] (-1742.068) * (-1748.085) [-1740.867] (-1744.100) (-1741.237) -- 0:00:51 279000 -- (-1743.547) (-1744.155) [-1741.212] (-1742.986) * (-1743.728) [-1742.018] (-1743.883) (-1742.430) -- 0:00:51 279500 -- (-1744.051) [-1744.171] (-1740.828) (-1745.889) * [-1741.910] (-1748.573) (-1742.731) (-1742.453) -- 0:00:51 280000 -- (-1748.673) (-1742.852) (-1740.825) [-1741.793] * [-1740.818] (-1741.189) (-1742.368) (-1745.197) -- 0:00:51 Average standard deviation of split frequencies: 0.012807 280500 -- (-1743.774) (-1741.706) (-1742.620) [-1742.032] * (-1741.149) (-1741.189) (-1742.229) [-1742.602] -- 0:00:51 281000 -- (-1747.942) (-1740.997) (-1742.285) [-1742.753] * (-1741.874) [-1741.642] (-1745.335) (-1743.475) -- 0:00:51 281500 -- (-1747.468) (-1742.292) (-1744.631) [-1742.247] * (-1742.850) (-1740.358) [-1741.592] (-1742.387) -- 0:00:51 282000 -- [-1741.450] (-1743.080) (-1743.750) (-1740.800) * [-1741.258] (-1743.401) (-1741.507) (-1743.509) -- 0:00:50 282500 -- (-1741.419) [-1743.646] (-1743.363) (-1742.658) * (-1743.992) (-1741.286) [-1741.553] (-1746.358) -- 0:00:50 283000 -- (-1742.117) (-1742.653) [-1743.393] (-1743.779) * (-1743.561) [-1746.682] (-1748.520) (-1742.613) -- 0:00:50 283500 -- (-1744.688) [-1742.494] (-1741.797) (-1744.195) * (-1744.793) [-1741.582] (-1747.515) (-1743.791) -- 0:00:53 284000 -- [-1742.276] (-1741.808) (-1740.851) (-1742.917) * (-1743.870) [-1741.563] (-1744.819) (-1744.888) -- 0:00:52 284500 -- (-1741.292) (-1741.695) (-1740.957) [-1740.837] * (-1744.596) [-1741.524] (-1744.333) (-1745.971) -- 0:00:52 285000 -- [-1742.024] (-1741.797) (-1743.407) (-1745.595) * (-1745.824) (-1741.863) [-1744.619] (-1745.912) -- 0:00:52 Average standard deviation of split frequencies: 0.011926 285500 -- (-1742.140) (-1742.463) [-1744.833] (-1743.616) * (-1742.730) [-1741.061] (-1742.748) (-1741.290) -- 0:00:52 286000 -- [-1743.379] (-1741.751) (-1743.698) (-1740.770) * (-1742.238) [-1742.351] (-1743.443) (-1750.414) -- 0:00:52 286500 -- (-1743.811) [-1745.556] (-1745.149) (-1741.579) * [-1740.610] (-1741.531) (-1745.711) (-1746.397) -- 0:00:52 287000 -- [-1742.312] (-1745.640) (-1741.251) (-1742.304) * (-1740.864) [-1744.627] (-1749.254) (-1743.221) -- 0:00:52 287500 -- (-1741.777) [-1743.711] (-1741.878) (-1742.245) * (-1744.543) [-1743.161] (-1747.688) (-1742.776) -- 0:00:52 288000 -- (-1741.313) (-1741.872) (-1743.315) [-1743.082] * (-1743.275) [-1744.674] (-1747.746) (-1742.841) -- 0:00:51 288500 -- (-1741.590) (-1743.438) [-1742.300] (-1743.719) * (-1741.052) [-1743.148] (-1742.768) (-1742.731) -- 0:00:51 289000 -- (-1741.895) (-1742.929) [-1741.787] (-1745.530) * [-1741.012] (-1741.857) (-1744.915) (-1744.604) -- 0:00:51 289500 -- [-1745.302] (-1741.554) (-1743.194) (-1744.810) * (-1741.625) [-1742.843] (-1744.512) (-1746.156) -- 0:00:51 290000 -- [-1741.598] (-1743.397) (-1741.634) (-1744.547) * (-1744.071) [-1741.420] (-1741.252) (-1746.331) -- 0:00:51 Average standard deviation of split frequencies: 0.011257 290500 -- (-1743.646) [-1741.534] (-1743.869) (-1742.572) * (-1742.113) (-1742.550) (-1741.266) [-1746.298] -- 0:00:51 291000 -- (-1744.361) [-1742.441] (-1745.587) (-1742.113) * (-1743.083) (-1743.305) (-1741.594) [-1742.260] -- 0:00:51 291500 -- (-1742.192) (-1744.633) [-1742.905] (-1741.230) * (-1745.594) (-1743.086) [-1742.263] (-1741.980) -- 0:00:51 292000 -- (-1740.472) [-1743.886] (-1744.162) (-1741.745) * (-1742.101) [-1747.290] (-1742.443) (-1743.036) -- 0:00:50 292500 -- (-1744.695) [-1742.657] (-1745.243) (-1741.117) * (-1741.441) (-1747.502) (-1744.172) [-1741.456] -- 0:00:50 293000 -- [-1744.465] (-1741.456) (-1743.080) (-1742.820) * (-1745.891) [-1744.291] (-1744.710) (-1741.868) -- 0:00:50 293500 -- (-1747.093) (-1742.712) (-1741.400) [-1740.892] * (-1744.812) (-1742.785) (-1743.723) [-1743.438] -- 0:00:50 294000 -- (-1745.272) (-1741.701) (-1741.723) [-1741.925] * (-1743.334) (-1744.160) [-1742.036] (-1745.064) -- 0:00:50 294500 -- (-1743.440) (-1742.612) [-1741.506] (-1742.249) * (-1741.079) (-1742.458) (-1741.930) [-1742.794] -- 0:00:50 295000 -- [-1742.459] (-1742.622) (-1744.481) (-1745.076) * [-1741.079] (-1746.379) (-1743.476) (-1745.812) -- 0:00:50 Average standard deviation of split frequencies: 0.010650 295500 -- [-1740.799] (-1742.300) (-1740.869) (-1743.575) * (-1741.746) (-1745.744) [-1741.840] (-1742.507) -- 0:00:50 296000 -- [-1741.131] (-1744.037) (-1744.981) (-1743.434) * (-1743.125) (-1741.625) (-1741.564) [-1744.928] -- 0:00:49 296500 -- (-1742.728) (-1746.965) [-1742.073] (-1742.750) * (-1743.094) (-1741.329) [-1743.772] (-1743.356) -- 0:00:49 297000 -- (-1742.084) (-1746.391) [-1742.749] (-1741.678) * (-1742.964) (-1742.257) [-1743.974] (-1743.562) -- 0:00:52 297500 -- (-1742.254) (-1747.130) [-1742.269] (-1741.669) * [-1744.406] (-1741.707) (-1743.707) (-1744.214) -- 0:00:51 298000 -- (-1749.085) [-1744.865] (-1743.157) (-1743.211) * (-1745.351) (-1741.598) (-1742.122) [-1742.560] -- 0:00:51 298500 -- (-1742.528) (-1743.012) [-1742.566] (-1743.789) * [-1744.721] (-1741.647) (-1741.377) (-1742.348) -- 0:00:51 299000 -- (-1743.688) [-1743.778] (-1742.400) (-1742.905) * [-1743.241] (-1740.742) (-1742.901) (-1742.366) -- 0:00:51 299500 -- (-1742.471) (-1743.924) (-1743.520) [-1742.609] * (-1742.999) [-1743.087] (-1742.189) (-1741.711) -- 0:00:51 300000 -- (-1741.189) [-1743.791] (-1742.114) (-1743.512) * (-1744.042) (-1743.658) (-1743.811) [-1741.625] -- 0:00:51 Average standard deviation of split frequencies: 0.011067 300500 -- (-1740.802) [-1742.553] (-1742.658) (-1743.085) * (-1744.650) (-1741.139) [-1743.972] (-1742.604) -- 0:00:51 301000 -- [-1741.125] (-1741.676) (-1743.747) (-1742.726) * (-1742.611) [-1743.045] (-1741.832) (-1740.694) -- 0:00:51 301500 -- (-1741.593) [-1742.269] (-1743.629) (-1743.952) * (-1743.610) [-1743.997] (-1742.709) (-1742.399) -- 0:00:50 302000 -- [-1741.593] (-1742.470) (-1746.266) (-1742.587) * (-1741.487) (-1744.758) (-1741.834) [-1741.515] -- 0:00:50 302500 -- (-1741.519) (-1742.535) (-1743.162) [-1742.860] * (-1742.350) (-1746.017) [-1741.820] (-1742.551) -- 0:00:50 303000 -- (-1741.519) (-1741.486) (-1742.712) [-1741.029] * (-1741.551) (-1744.465) (-1741.683) [-1741.554] -- 0:00:50 303500 -- (-1741.519) (-1740.817) [-1742.186] (-1741.807) * (-1740.690) (-1744.673) (-1741.746) [-1741.362] -- 0:00:50 304000 -- (-1742.583) (-1741.490) [-1744.154] (-1747.514) * [-1740.939] (-1743.482) (-1744.692) (-1743.828) -- 0:00:50 304500 -- (-1741.235) [-1741.486] (-1743.951) (-1743.844) * (-1745.885) [-1745.932] (-1741.872) (-1742.846) -- 0:00:50 305000 -- (-1742.717) (-1742.490) [-1749.444] (-1744.856) * (-1742.966) (-1743.197) (-1743.882) [-1742.086] -- 0:00:50 Average standard deviation of split frequencies: 0.010603 305500 -- (-1744.340) (-1742.465) [-1743.927] (-1743.036) * [-1743.855] (-1745.188) (-1741.388) (-1742.638) -- 0:00:50 306000 -- [-1742.326] (-1742.308) (-1742.635) (-1748.227) * (-1744.415) (-1745.063) (-1742.099) [-1746.152] -- 0:00:49 306500 -- (-1742.303) [-1743.465] (-1744.790) (-1742.893) * [-1742.016] (-1743.883) (-1741.702) (-1744.025) -- 0:00:49 307000 -- (-1745.885) [-1740.469] (-1743.739) (-1742.961) * [-1743.542] (-1742.477) (-1745.048) (-1743.107) -- 0:00:49 307500 -- [-1743.298] (-1740.476) (-1742.961) (-1743.247) * [-1742.148] (-1742.879) (-1741.961) (-1744.000) -- 0:00:49 308000 -- [-1741.676] (-1740.478) (-1747.396) (-1740.654) * (-1744.874) (-1745.424) (-1741.839) [-1742.578] -- 0:00:49 308500 -- [-1742.393] (-1742.378) (-1745.393) (-1741.585) * (-1743.662) (-1744.699) [-1740.996] (-1741.738) -- 0:00:49 309000 -- [-1745.977] (-1742.378) (-1745.594) (-1742.378) * (-1745.559) [-1742.399] (-1741.522) (-1742.310) -- 0:00:49 309500 -- (-1746.023) (-1742.293) (-1741.984) [-1742.525] * (-1745.679) (-1742.572) (-1741.627) [-1744.359] -- 0:00:49 310000 -- (-1744.352) (-1741.695) (-1742.047) [-1741.812] * (-1745.996) (-1741.371) [-1743.320] (-1742.033) -- 0:00:51 Average standard deviation of split frequencies: 0.009908 310500 -- (-1745.393) (-1741.432) (-1740.614) [-1742.031] * [-1742.983] (-1741.753) (-1746.253) (-1742.416) -- 0:00:51 311000 -- (-1748.984) (-1742.786) [-1742.452] (-1748.571) * [-1747.027] (-1741.753) (-1742.133) (-1741.614) -- 0:00:50 311500 -- (-1740.421) (-1743.124) [-1741.340] (-1743.760) * (-1743.453) (-1743.554) (-1742.170) [-1741.586] -- 0:00:50 312000 -- (-1742.576) [-1740.842] (-1742.844) (-1744.092) * (-1744.930) (-1742.825) (-1741.934) [-1741.832] -- 0:00:50 312500 -- [-1745.877] (-1740.924) (-1745.206) (-1746.006) * [-1740.741] (-1741.813) (-1743.143) (-1742.812) -- 0:00:50 313000 -- [-1740.486] (-1745.771) (-1745.174) (-1748.124) * (-1742.243) [-1742.960] (-1741.137) (-1740.854) -- 0:00:50 313500 -- (-1740.673) (-1741.470) [-1741.779] (-1743.124) * [-1742.989] (-1743.348) (-1743.886) (-1740.911) -- 0:00:50 314000 -- (-1740.689) [-1741.045] (-1743.235) (-1742.835) * (-1742.009) (-1741.445) (-1743.190) [-1744.085] -- 0:00:50 314500 -- [-1742.238] (-1740.646) (-1742.333) (-1743.633) * [-1740.702] (-1744.702) (-1744.547) (-1745.033) -- 0:00:50 315000 -- [-1742.162] (-1741.084) (-1743.005) (-1743.594) * (-1740.784) [-1743.549] (-1744.581) (-1745.043) -- 0:00:50 Average standard deviation of split frequencies: 0.009653 315500 -- (-1741.669) (-1741.227) [-1742.776] (-1743.345) * [-1740.975] (-1743.708) (-1744.388) (-1743.428) -- 0:00:49 316000 -- (-1744.168) [-1745.357] (-1742.023) (-1740.830) * (-1742.151) [-1743.072] (-1743.264) (-1742.635) -- 0:00:49 316500 -- [-1742.249] (-1744.144) (-1741.962) (-1741.198) * (-1745.909) (-1745.269) (-1742.327) [-1740.534] -- 0:00:49 317000 -- (-1741.400) (-1742.276) [-1740.688] (-1741.958) * (-1742.741) [-1742.796] (-1742.568) (-1740.534) -- 0:00:49 317500 -- (-1742.497) (-1742.158) (-1745.286) [-1742.664] * (-1743.966) (-1743.993) (-1743.041) [-1741.317] -- 0:00:49 318000 -- (-1741.401) (-1744.443) (-1741.878) [-1742.182] * [-1744.872] (-1744.386) (-1742.327) (-1743.000) -- 0:00:49 318500 -- (-1741.586) [-1742.087] (-1742.308) (-1743.046) * (-1743.461) (-1742.789) (-1742.620) [-1743.171] -- 0:00:49 319000 -- (-1743.756) (-1746.148) [-1742.309] (-1744.239) * (-1742.119) (-1742.272) (-1741.648) [-1743.509] -- 0:00:49 319500 -- (-1743.341) [-1743.969] (-1741.085) (-1743.315) * (-1741.785) (-1741.846) [-1745.591] (-1742.375) -- 0:00:48 320000 -- (-1741.513) (-1747.928) [-1741.675] (-1748.683) * (-1746.707) (-1743.441) (-1743.182) [-1744.428] -- 0:00:48 Average standard deviation of split frequencies: 0.009426 320500 -- (-1748.438) (-1744.301) (-1740.940) [-1742.281] * (-1744.169) [-1742.633] (-1741.448) (-1743.672) -- 0:00:48 321000 -- (-1744.637) (-1742.144) (-1742.963) [-1742.880] * (-1742.229) (-1743.589) [-1742.707] (-1744.127) -- 0:00:48 321500 -- (-1744.706) (-1741.619) (-1743.381) [-1742.048] * (-1741.333) (-1741.691) (-1743.239) [-1742.357] -- 0:00:48 322000 -- (-1742.948) (-1741.820) [-1746.796] (-1745.632) * (-1741.507) (-1743.841) (-1741.091) [-1743.345] -- 0:00:48 322500 -- (-1742.954) [-1742.107] (-1745.553) (-1750.130) * (-1741.795) (-1741.814) (-1740.847) [-1744.219] -- 0:00:48 323000 -- (-1743.403) (-1743.127) [-1744.494] (-1743.992) * (-1743.211) [-1744.352] (-1741.346) (-1742.530) -- 0:00:50 323500 -- (-1744.430) [-1745.038] (-1745.300) (-1745.737) * (-1744.393) (-1747.089) (-1742.670) [-1743.136] -- 0:00:50 324000 -- [-1744.437] (-1745.881) (-1743.024) (-1742.396) * [-1743.274] (-1740.958) (-1743.984) (-1749.009) -- 0:00:50 324500 -- (-1745.254) [-1742.474] (-1741.929) (-1743.996) * (-1746.864) [-1742.816] (-1747.069) (-1742.907) -- 0:00:49 325000 -- (-1742.976) (-1741.893) (-1745.405) [-1741.091] * [-1742.026] (-1743.030) (-1743.545) (-1742.262) -- 0:00:49 Average standard deviation of split frequencies: 0.009782 325500 -- (-1741.820) (-1742.296) (-1744.263) [-1741.116] * (-1743.184) [-1742.847] (-1746.231) (-1741.891) -- 0:00:49 326000 -- [-1740.430] (-1744.402) (-1741.969) (-1744.331) * [-1742.345] (-1743.373) (-1743.956) (-1741.402) -- 0:00:49 326500 -- (-1741.715) (-1744.693) [-1740.637] (-1747.589) * (-1741.813) (-1742.764) (-1745.952) [-1740.643] -- 0:00:49 327000 -- (-1740.870) [-1744.483] (-1746.119) (-1747.104) * (-1741.538) (-1742.139) (-1745.524) [-1740.999] -- 0:00:49 327500 -- (-1745.668) (-1743.476) [-1745.056] (-1746.664) * [-1744.228] (-1743.384) (-1743.649) (-1740.757) -- 0:00:49 328000 -- (-1741.756) (-1741.012) [-1741.381] (-1747.207) * (-1742.678) (-1745.679) (-1743.648) [-1740.878] -- 0:00:49 328500 -- [-1742.689] (-1745.836) (-1741.819) (-1743.227) * [-1741.337] (-1744.207) (-1741.078) (-1740.943) -- 0:00:49 329000 -- (-1740.973) (-1742.061) [-1742.238] (-1746.363) * (-1745.172) (-1741.122) (-1741.634) [-1743.473] -- 0:00:48 329500 -- (-1747.755) [-1744.897] (-1742.385) (-1747.498) * (-1742.749) (-1741.454) [-1741.254] (-1745.112) -- 0:00:48 330000 -- (-1746.367) (-1744.028) (-1741.500) [-1741.306] * (-1742.249) (-1742.090) (-1742.582) [-1744.355] -- 0:00:48 Average standard deviation of split frequencies: 0.009476 330500 -- (-1744.079) [-1741.787] (-1743.106) (-1741.171) * (-1743.920) (-1744.086) (-1742.204) [-1740.860] -- 0:00:48 331000 -- (-1745.590) [-1740.439] (-1742.677) (-1744.143) * (-1744.938) (-1744.409) (-1742.137) [-1743.290] -- 0:00:48 331500 -- (-1743.130) (-1741.686) (-1743.129) [-1742.922] * [-1743.911] (-1744.332) (-1743.158) (-1741.796) -- 0:00:48 332000 -- (-1742.661) (-1740.768) [-1742.109] (-1743.293) * (-1745.821) (-1747.165) [-1741.992] (-1743.410) -- 0:00:48 332500 -- (-1744.852) [-1744.176] (-1741.065) (-1742.877) * [-1749.068] (-1743.064) (-1740.779) (-1743.461) -- 0:00:48 333000 -- (-1746.084) (-1741.804) [-1740.830] (-1743.922) * (-1748.286) [-1742.060] (-1741.231) (-1743.858) -- 0:00:48 333500 -- (-1745.405) (-1743.989) (-1742.619) [-1741.516] * (-1743.582) (-1748.117) (-1745.151) [-1743.231] -- 0:00:47 334000 -- (-1743.302) (-1741.282) (-1743.698) [-1742.212] * [-1742.658] (-1744.821) (-1741.354) (-1743.363) -- 0:00:47 334500 -- (-1741.236) [-1742.499] (-1742.917) (-1742.797) * [-1743.233] (-1745.324) (-1742.365) (-1741.620) -- 0:00:47 335000 -- (-1740.886) [-1743.572] (-1742.262) (-1741.122) * (-1743.594) (-1742.874) [-1744.320] (-1742.821) -- 0:00:49 Average standard deviation of split frequencies: 0.009656 335500 -- (-1740.431) (-1742.024) (-1741.068) [-1746.254] * (-1741.921) (-1742.400) [-1740.581] (-1741.494) -- 0:00:49 336000 -- [-1740.742] (-1742.298) (-1740.722) (-1748.278) * (-1742.277) (-1742.217) (-1741.403) [-1740.849] -- 0:00:49 336500 -- (-1741.033) [-1742.323] (-1741.441) (-1741.840) * (-1746.704) (-1741.793) (-1740.492) [-1741.210] -- 0:00:49 337000 -- (-1740.342) (-1742.322) [-1740.799] (-1745.807) * (-1744.863) [-1743.656] (-1742.249) (-1741.006) -- 0:00:49 337500 -- (-1744.662) (-1741.996) [-1741.195] (-1742.664) * (-1741.392) (-1741.347) [-1744.840] (-1740.984) -- 0:00:49 338000 -- (-1741.521) [-1743.979] (-1741.570) (-1740.899) * (-1742.309) (-1741.652) (-1742.883) [-1743.670] -- 0:00:48 338500 -- [-1742.278] (-1741.469) (-1741.005) (-1740.890) * (-1743.695) [-1744.004] (-1742.521) (-1741.673) -- 0:00:48 339000 -- (-1742.772) [-1741.962] (-1741.017) (-1741.520) * (-1745.237) (-1748.358) (-1744.337) [-1741.637] -- 0:00:48 339500 -- [-1742.040] (-1743.644) (-1740.609) (-1741.467) * (-1743.556) (-1741.955) [-1744.329] (-1743.483) -- 0:00:48 340000 -- (-1742.231) [-1743.897] (-1742.498) (-1741.057) * [-1741.145] (-1740.929) (-1745.331) (-1742.499) -- 0:00:48 Average standard deviation of split frequencies: 0.009524 340500 -- (-1740.219) (-1745.580) [-1744.135] (-1742.058) * (-1742.634) (-1741.831) (-1744.669) [-1741.993] -- 0:00:48 341000 -- [-1742.242] (-1744.045) (-1743.618) (-1740.919) * (-1744.114) (-1745.076) (-1741.894) [-1742.202] -- 0:00:48 341500 -- (-1744.295) (-1742.432) (-1743.463) [-1740.998] * [-1741.252] (-1743.576) (-1743.253) (-1744.031) -- 0:00:48 342000 -- (-1749.817) (-1743.584) (-1744.016) [-1742.064] * (-1742.238) (-1743.826) (-1742.836) [-1743.945] -- 0:00:48 342500 -- [-1743.219] (-1741.890) (-1741.290) (-1742.124) * [-1740.622] (-1742.424) (-1741.905) (-1741.315) -- 0:00:47 343000 -- (-1741.996) [-1741.835] (-1741.290) (-1744.513) * [-1740.643] (-1741.156) (-1746.268) (-1742.956) -- 0:00:47 343500 -- (-1743.025) (-1744.584) [-1741.342] (-1743.292) * (-1742.829) [-1741.672] (-1742.661) (-1743.597) -- 0:00:47 344000 -- (-1743.145) [-1740.646] (-1742.132) (-1744.028) * (-1747.163) (-1741.195) (-1742.669) [-1743.301] -- 0:00:47 344500 -- [-1741.688] (-1742.046) (-1746.019) (-1743.921) * [-1744.327] (-1741.091) (-1740.993) (-1744.087) -- 0:00:47 345000 -- [-1742.020] (-1743.903) (-1744.334) (-1741.882) * (-1741.637) (-1740.877) [-1743.722] (-1742.196) -- 0:00:47 Average standard deviation of split frequencies: 0.009159 345500 -- [-1741.968] (-1742.880) (-1744.898) (-1742.109) * (-1740.766) (-1741.085) (-1742.560) [-1744.184] -- 0:00:47 346000 -- (-1741.874) (-1742.448) (-1745.353) [-1741.020] * (-1741.115) [-1743.698] (-1741.453) (-1743.212) -- 0:00:47 346500 -- [-1743.195] (-1741.862) (-1747.108) (-1742.047) * [-1742.118] (-1742.271) (-1743.091) (-1744.436) -- 0:00:47 347000 -- (-1742.263) (-1743.881) [-1741.654] (-1745.806) * (-1741.284) (-1742.556) [-1740.981] (-1742.099) -- 0:00:47 347500 -- (-1742.259) (-1742.799) [-1742.144] (-1741.783) * (-1742.376) [-1745.033] (-1741.619) (-1744.399) -- 0:00:46 348000 -- (-1742.001) [-1743.330] (-1742.593) (-1742.720) * [-1743.472] (-1743.398) (-1741.104) (-1741.716) -- 0:00:46 348500 -- [-1741.419] (-1743.560) (-1742.332) (-1742.725) * (-1746.448) [-1741.960] (-1741.840) (-1744.967) -- 0:00:48 349000 -- [-1740.681] (-1743.575) (-1743.032) (-1742.999) * [-1745.460] (-1741.741) (-1742.855) (-1742.212) -- 0:00:48 349500 -- (-1741.807) (-1746.539) [-1743.828] (-1744.530) * (-1745.711) [-1742.434] (-1745.208) (-1741.726) -- 0:00:48 350000 -- [-1740.774] (-1743.403) (-1742.789) (-1747.828) * (-1742.818) [-1741.197] (-1746.497) (-1742.121) -- 0:00:48 Average standard deviation of split frequencies: 0.008654 350500 -- [-1740.578] (-1746.198) (-1742.048) (-1749.681) * [-1742.765] (-1741.958) (-1744.515) (-1741.362) -- 0:00:48 351000 -- [-1743.471] (-1745.351) (-1743.168) (-1744.564) * (-1742.881) [-1746.645] (-1744.335) (-1744.763) -- 0:00:48 351500 -- [-1742.247] (-1745.876) (-1743.284) (-1746.164) * (-1742.313) (-1747.347) [-1743.182] (-1743.414) -- 0:00:47 352000 -- [-1742.366] (-1745.459) (-1742.085) (-1743.347) * (-1742.197) [-1745.822] (-1743.283) (-1743.792) -- 0:00:47 352500 -- (-1742.247) [-1742.286] (-1740.341) (-1742.774) * (-1743.593) (-1745.014) (-1742.713) [-1742.384] -- 0:00:47 353000 -- (-1744.212) [-1740.981] (-1741.616) (-1743.486) * (-1740.751) [-1742.256] (-1742.563) (-1744.137) -- 0:00:47 353500 -- (-1741.245) (-1740.547) [-1742.108] (-1742.598) * [-1743.926] (-1741.933) (-1743.878) (-1742.506) -- 0:00:47 354000 -- (-1740.601) (-1741.377) [-1747.157] (-1741.865) * (-1741.349) [-1742.244] (-1743.483) (-1743.814) -- 0:00:47 354500 -- (-1740.584) (-1741.134) [-1742.188] (-1741.823) * (-1741.901) (-1742.436) [-1741.268] (-1744.887) -- 0:00:47 355000 -- (-1740.727) (-1741.692) (-1741.522) [-1741.593] * (-1743.151) [-1741.700] (-1741.684) (-1744.899) -- 0:00:47 Average standard deviation of split frequencies: 0.009186 355500 -- [-1742.406] (-1741.575) (-1741.813) (-1740.670) * (-1742.086) (-1742.484) (-1741.176) [-1741.728] -- 0:00:47 356000 -- (-1747.936) (-1744.712) [-1740.523] (-1741.603) * (-1747.348) (-1743.773) [-1741.545] (-1741.620) -- 0:00:47 356500 -- (-1747.344) (-1743.536) (-1741.110) [-1742.189] * (-1743.645) [-1743.085] (-1745.832) (-1741.561) -- 0:00:46 357000 -- (-1742.624) [-1745.153] (-1741.660) (-1741.347) * (-1744.595) [-1743.736] (-1741.816) (-1741.884) -- 0:00:46 357500 -- (-1741.892) (-1742.483) (-1742.301) [-1742.208] * (-1743.539) [-1741.895] (-1743.555) (-1741.752) -- 0:00:46 358000 -- (-1742.918) (-1746.899) [-1746.527] (-1746.308) * (-1744.733) [-1744.180] (-1741.111) (-1741.990) -- 0:00:46 358500 -- (-1741.213) (-1742.351) (-1746.544) [-1741.890] * (-1742.304) [-1744.220] (-1743.112) (-1741.483) -- 0:00:46 359000 -- (-1744.039) (-1743.832) [-1743.568] (-1741.700) * (-1742.138) [-1745.881] (-1741.448) (-1742.248) -- 0:00:46 359500 -- (-1742.983) (-1744.385) [-1744.148] (-1741.748) * (-1741.818) (-1749.328) [-1741.694] (-1742.263) -- 0:00:46 360000 -- (-1743.287) (-1746.080) (-1741.840) [-1742.095] * (-1743.798) (-1747.582) (-1742.174) [-1740.648] -- 0:00:46 Average standard deviation of split frequencies: 0.009803 360500 -- (-1744.469) (-1747.613) (-1745.578) [-1742.126] * (-1743.740) (-1746.022) [-1741.757] (-1741.655) -- 0:00:46 361000 -- [-1742.857] (-1742.804) (-1742.614) (-1744.740) * (-1743.089) (-1745.335) [-1741.588] (-1740.754) -- 0:00:46 361500 -- (-1742.507) [-1743.696] (-1743.787) (-1746.736) * (-1743.225) (-1744.823) (-1740.814) [-1743.785] -- 0:00:45 362000 -- (-1742.199) (-1741.455) (-1746.676) [-1742.156] * (-1743.334) (-1744.370) [-1742.298] (-1742.516) -- 0:00:45 362500 -- [-1743.387] (-1743.184) (-1744.428) (-1744.963) * (-1744.352) [-1741.972] (-1742.387) (-1747.500) -- 0:00:45 363000 -- (-1745.061) [-1740.958] (-1742.191) (-1742.105) * [-1741.892] (-1743.422) (-1741.313) (-1742.117) -- 0:00:47 363500 -- (-1742.031) [-1740.861] (-1741.218) (-1741.888) * (-1743.674) [-1745.310] (-1743.351) (-1742.430) -- 0:00:47 364000 -- (-1743.539) (-1742.756) [-1742.432] (-1740.859) * [-1744.564] (-1745.130) (-1743.263) (-1742.749) -- 0:00:47 364500 -- (-1742.905) (-1744.803) [-1742.721] (-1744.488) * (-1745.151) (-1742.341) (-1744.025) [-1742.140] -- 0:00:47 365000 -- (-1742.445) (-1742.577) (-1743.521) [-1744.607] * (-1744.363) [-1745.800] (-1744.421) (-1741.157) -- 0:00:46 Average standard deviation of split frequencies: 0.011735 365500 -- (-1743.958) (-1742.578) (-1744.302) [-1741.776] * [-1744.368] (-1744.443) (-1745.722) (-1742.860) -- 0:00:46 366000 -- (-1741.195) [-1741.913] (-1743.137) (-1741.403) * (-1746.181) [-1741.958] (-1743.813) (-1742.293) -- 0:00:46 366500 -- (-1741.164) (-1744.669) (-1742.351) [-1745.781] * [-1742.481] (-1747.573) (-1743.386) (-1742.293) -- 0:00:46 367000 -- (-1744.081) (-1745.228) (-1743.644) [-1742.533] * (-1741.544) (-1745.115) [-1742.325] (-1743.772) -- 0:00:46 367500 -- (-1746.348) (-1743.849) (-1742.467) [-1740.931] * (-1743.059) (-1748.255) [-1744.692] (-1742.500) -- 0:00:46 368000 -- (-1742.438) (-1745.100) (-1743.024) [-1741.922] * [-1743.690] (-1742.973) (-1741.719) (-1743.242) -- 0:00:46 368500 -- (-1742.991) (-1743.727) [-1741.982] (-1741.156) * (-1740.896) [-1741.629] (-1744.498) (-1742.767) -- 0:00:46 369000 -- (-1742.973) (-1744.837) (-1742.021) [-1740.756] * [-1740.826] (-1744.012) (-1744.964) (-1743.287) -- 0:00:46 369500 -- (-1744.743) (-1743.252) [-1742.488] (-1746.206) * (-1741.897) (-1745.427) [-1743.472] (-1742.788) -- 0:00:46 370000 -- (-1742.668) [-1744.628] (-1741.343) (-1744.436) * (-1743.347) (-1743.069) [-1747.466] (-1742.952) -- 0:00:45 Average standard deviation of split frequencies: 0.011517 370500 -- (-1741.612) (-1740.888) (-1742.346) [-1742.333] * (-1743.745) (-1741.428) [-1741.994] (-1742.945) -- 0:00:45 371000 -- [-1742.264] (-1740.888) (-1742.806) (-1743.592) * (-1743.268) (-1742.185) [-1744.105] (-1748.716) -- 0:00:45 371500 -- (-1741.587) (-1740.961) [-1743.236] (-1744.177) * (-1743.013) [-1743.766] (-1743.655) (-1742.376) -- 0:00:45 372000 -- (-1742.139) [-1740.990] (-1744.748) (-1742.369) * (-1743.827) [-1741.245] (-1745.629) (-1741.808) -- 0:00:45 372500 -- (-1741.566) (-1740.788) (-1741.662) [-1741.901] * [-1743.594] (-1742.721) (-1742.168) (-1742.022) -- 0:00:45 373000 -- (-1747.460) (-1740.674) [-1742.551] (-1742.759) * (-1745.368) (-1742.021) (-1743.045) [-1740.983] -- 0:00:45 373500 -- (-1742.778) (-1742.605) (-1744.028) [-1741.566] * (-1741.777) (-1740.462) (-1742.884) [-1740.875] -- 0:00:45 374000 -- (-1741.580) (-1746.287) [-1743.614] (-1741.519) * (-1742.646) [-1741.302] (-1743.775) (-1740.999) -- 0:00:45 374500 -- [-1743.739] (-1746.089) (-1744.993) (-1743.418) * (-1742.366) (-1740.621) [-1740.529] (-1745.030) -- 0:00:45 375000 -- (-1743.996) (-1741.626) [-1743.353] (-1741.919) * (-1742.384) (-1741.112) [-1742.237] (-1744.503) -- 0:00:45 Average standard deviation of split frequencies: 0.011431 375500 -- (-1744.025) (-1741.152) (-1742.258) [-1741.853] * (-1744.277) (-1745.169) (-1741.468) [-1745.350] -- 0:00:44 376000 -- (-1748.026) (-1741.367) (-1742.495) [-1742.849] * (-1747.969) (-1743.907) [-1741.852] (-1742.008) -- 0:00:44 376500 -- (-1743.632) (-1741.927) (-1744.228) [-1741.005] * (-1745.035) (-1744.684) (-1743.820) [-1742.332] -- 0:00:44 377000 -- [-1741.328] (-1741.340) (-1744.140) (-1742.584) * [-1742.343] (-1750.329) (-1743.603) (-1741.523) -- 0:00:44 377500 -- [-1744.721] (-1741.958) (-1744.553) (-1746.577) * (-1741.145) (-1740.928) (-1744.194) [-1741.895] -- 0:00:46 378000 -- (-1742.885) [-1742.879] (-1743.815) (-1742.165) * (-1742.980) (-1741.107) (-1744.706) [-1740.615] -- 0:00:46 378500 -- (-1744.588) [-1741.011] (-1741.409) (-1745.611) * (-1745.281) [-1743.811] (-1744.201) (-1741.176) -- 0:00:45 379000 -- (-1742.643) (-1741.829) [-1741.250] (-1741.344) * (-1744.137) (-1742.887) [-1742.852] (-1741.009) -- 0:00:45 379500 -- (-1745.561) (-1741.943) (-1742.311) [-1741.387] * [-1743.124] (-1741.829) (-1741.903) (-1741.137) -- 0:00:45 380000 -- (-1742.009) [-1742.133] (-1744.487) (-1742.719) * [-1741.902] (-1741.558) (-1745.265) (-1743.387) -- 0:00:45 Average standard deviation of split frequencies: 0.011377 380500 -- [-1743.243] (-1747.468) (-1742.971) (-1740.937) * (-1743.816) (-1741.771) [-1742.208] (-1743.236) -- 0:00:45 381000 -- (-1743.755) (-1743.267) (-1742.989) [-1740.514] * [-1742.341] (-1743.610) (-1742.208) (-1741.896) -- 0:00:45 381500 -- (-1742.291) (-1743.215) (-1744.887) [-1742.310] * (-1743.352) (-1741.377) (-1743.068) [-1741.562] -- 0:00:45 382000 -- (-1741.073) (-1746.461) (-1744.200) [-1743.496] * (-1743.518) [-1742.227] (-1743.542) (-1747.329) -- 0:00:45 382500 -- (-1742.760) (-1742.343) [-1742.020] (-1742.003) * (-1741.160) [-1741.630] (-1740.909) (-1745.547) -- 0:00:45 383000 -- (-1746.839) (-1742.453) [-1742.917] (-1743.086) * (-1746.857) (-1744.416) [-1740.909] (-1743.969) -- 0:00:45 383500 -- [-1740.579] (-1741.940) (-1743.764) (-1743.474) * [-1744.014] (-1741.349) (-1742.251) (-1745.270) -- 0:00:45 384000 -- (-1741.447) [-1742.866] (-1743.814) (-1744.717) * (-1741.406) [-1741.197] (-1741.471) (-1742.296) -- 0:00:44 384500 -- (-1740.925) [-1743.573] (-1745.705) (-1744.986) * [-1745.302] (-1741.786) (-1743.770) (-1744.567) -- 0:00:44 385000 -- [-1740.954] (-1744.828) (-1744.013) (-1743.144) * [-1745.253] (-1744.851) (-1741.493) (-1745.100) -- 0:00:44 Average standard deviation of split frequencies: 0.010915 385500 -- (-1740.998) (-1742.660) [-1742.089] (-1742.594) * (-1744.654) [-1741.770] (-1740.839) (-1745.686) -- 0:00:44 386000 -- [-1741.249] (-1741.876) (-1742.971) (-1743.185) * (-1741.329) (-1743.733) [-1740.617] (-1742.901) -- 0:00:44 386500 -- (-1741.047) [-1741.786] (-1743.816) (-1743.567) * (-1742.310) [-1741.513] (-1741.850) (-1741.844) -- 0:00:44 387000 -- [-1741.458] (-1741.250) (-1741.159) (-1742.032) * [-1740.845] (-1741.504) (-1741.206) (-1743.553) -- 0:00:44 387500 -- (-1740.673) (-1741.195) [-1743.117] (-1742.654) * (-1744.930) (-1745.595) [-1740.727] (-1742.712) -- 0:00:44 388000 -- [-1745.857] (-1743.663) (-1744.009) (-1747.534) * [-1743.553] (-1742.967) (-1740.422) (-1742.716) -- 0:00:44 388500 -- (-1744.434) (-1741.191) (-1742.762) [-1742.786] * (-1745.838) [-1744.881] (-1742.995) (-1741.072) -- 0:00:44 389000 -- (-1743.191) [-1741.580] (-1741.205) (-1745.238) * (-1741.405) (-1744.815) [-1741.463] (-1740.735) -- 0:00:43 389500 -- [-1745.439] (-1741.522) (-1741.699) (-1745.422) * (-1746.313) [-1740.799] (-1741.295) (-1741.065) -- 0:00:43 390000 -- (-1745.152) (-1741.623) (-1743.659) [-1747.914] * (-1745.792) (-1740.490) (-1741.175) [-1740.955] -- 0:00:43 Average standard deviation of split frequencies: 0.011086 390500 -- [-1741.866] (-1741.156) (-1742.845) (-1743.264) * [-1746.246] (-1741.896) (-1746.768) (-1742.137) -- 0:00:43 391000 -- (-1743.285) (-1741.075) [-1741.522] (-1745.199) * [-1742.465] (-1745.648) (-1746.108) (-1741.253) -- 0:00:43 391500 -- (-1747.780) (-1741.725) [-1741.068] (-1742.889) * (-1743.695) (-1743.563) (-1740.649) [-1741.352] -- 0:00:43 392000 -- [-1744.075] (-1741.094) (-1740.489) (-1741.833) * [-1741.881] (-1742.930) (-1741.242) (-1742.843) -- 0:00:43 392500 -- (-1744.018) (-1742.907) [-1741.441] (-1743.018) * (-1743.177) [-1744.402] (-1742.970) (-1743.065) -- 0:00:44 393000 -- (-1741.892) (-1740.286) [-1741.433] (-1745.363) * (-1743.256) [-1741.738] (-1743.430) (-1742.352) -- 0:00:44 393500 -- (-1746.665) (-1740.738) (-1740.771) [-1748.065] * (-1742.454) (-1742.038) (-1742.233) [-1742.007] -- 0:00:44 394000 -- (-1748.380) (-1745.123) (-1742.707) [-1745.368] * (-1741.368) (-1744.531) (-1743.474) [-1741.787] -- 0:00:44 394500 -- (-1745.754) (-1745.372) [-1743.283] (-1751.698) * (-1740.873) [-1744.198] (-1744.814) (-1740.546) -- 0:00:44 395000 -- (-1743.605) (-1743.887) [-1743.567] (-1745.212) * [-1742.649] (-1745.069) (-1747.486) (-1741.060) -- 0:00:44 Average standard deviation of split frequencies: 0.010416 395500 -- (-1744.597) [-1743.971] (-1743.801) (-1741.318) * (-1744.163) [-1742.509] (-1745.193) (-1742.327) -- 0:00:44 396000 -- (-1741.652) [-1742.811] (-1743.425) (-1741.299) * [-1742.656] (-1742.021) (-1742.389) (-1744.947) -- 0:00:44 396500 -- (-1744.897) (-1741.865) (-1743.225) [-1743.759] * (-1743.930) [-1742.167] (-1742.388) (-1741.909) -- 0:00:44 397000 -- (-1747.135) (-1740.858) (-1749.731) [-1741.407] * (-1743.305) [-1745.791] (-1742.387) (-1743.993) -- 0:00:44 397500 -- (-1744.024) (-1741.112) (-1743.254) [-1744.441] * (-1742.973) (-1742.374) [-1742.949] (-1740.863) -- 0:00:43 398000 -- (-1741.362) (-1747.203) [-1742.239] (-1740.735) * [-1743.541] (-1743.149) (-1743.153) (-1741.711) -- 0:00:43 398500 -- (-1745.163) (-1742.417) (-1746.493) [-1740.996] * (-1741.417) (-1743.668) (-1744.106) [-1741.374] -- 0:00:43 399000 -- (-1745.588) (-1743.762) (-1743.673) [-1741.860] * [-1747.104] (-1741.663) (-1742.362) (-1741.825) -- 0:00:43 399500 -- (-1746.000) (-1744.489) (-1742.791) [-1743.959] * (-1742.895) (-1742.653) (-1743.061) [-1743.533] -- 0:00:43 400000 -- (-1747.455) [-1743.520] (-1742.003) (-1741.066) * [-1740.954] (-1741.738) (-1742.923) (-1744.524) -- 0:00:43 Average standard deviation of split frequencies: 0.009780 400500 -- [-1744.183] (-1742.212) (-1744.893) (-1740.967) * (-1744.266) (-1743.139) (-1740.868) [-1746.127] -- 0:00:43 401000 -- (-1744.963) (-1741.216) [-1742.399] (-1742.177) * [-1741.375] (-1743.505) (-1742.533) (-1747.916) -- 0:00:43 401500 -- [-1743.707] (-1740.753) (-1744.190) (-1743.295) * [-1741.475] (-1746.401) (-1743.170) (-1747.721) -- 0:00:43 402000 -- (-1746.706) [-1740.753] (-1745.093) (-1743.599) * (-1741.982) [-1742.318] (-1742.409) (-1741.856) -- 0:00:43 402500 -- [-1745.890] (-1740.594) (-1745.165) (-1740.530) * (-1741.982) (-1742.457) (-1742.364) [-1741.951] -- 0:00:43 403000 -- (-1742.416) (-1741.344) [-1743.050] (-1740.548) * (-1741.548) (-1743.241) (-1744.079) [-1741.828] -- 0:00:42 403500 -- (-1744.073) (-1741.909) (-1742.048) [-1741.057] * (-1746.011) [-1741.327] (-1744.429) (-1743.602) -- 0:00:42 404000 -- (-1741.473) (-1742.397) (-1740.392) [-1742.014] * (-1748.167) [-1742.175] (-1744.504) (-1741.623) -- 0:00:42 404500 -- (-1743.698) (-1743.094) [-1742.937] (-1741.292) * (-1744.982) [-1744.421] (-1745.251) (-1746.012) -- 0:00:42 405000 -- (-1742.613) [-1741.575] (-1742.769) (-1741.279) * [-1741.743] (-1742.366) (-1746.315) (-1741.735) -- 0:00:42 Average standard deviation of split frequencies: 0.008606 405500 -- (-1741.923) (-1742.401) [-1744.073] (-1743.730) * (-1741.834) (-1744.237) [-1741.627] (-1743.554) -- 0:00:42 406000 -- (-1744.100) [-1743.211] (-1745.262) (-1753.892) * (-1741.861) (-1742.348) [-1741.735] (-1744.386) -- 0:00:42 406500 -- [-1741.559] (-1744.560) (-1742.321) (-1743.303) * (-1743.326) (-1747.279) (-1742.186) [-1741.833] -- 0:00:42 407000 -- [-1742.181] (-1744.142) (-1742.245) (-1741.005) * (-1741.315) (-1746.709) (-1742.054) [-1743.399] -- 0:00:42 407500 -- (-1742.465) (-1743.239) [-1743.292] (-1746.949) * (-1741.332) (-1743.825) (-1742.962) [-1744.953] -- 0:00:43 408000 -- (-1746.829) (-1744.062) (-1744.845) [-1740.839] * (-1742.949) (-1742.886) [-1741.392] (-1746.667) -- 0:00:43 408500 -- (-1742.884) (-1743.323) [-1743.263] (-1745.100) * [-1743.431] (-1743.556) (-1742.574) (-1741.971) -- 0:00:43 409000 -- (-1741.998) [-1742.147] (-1744.088) (-1743.491) * [-1743.651] (-1744.378) (-1741.400) (-1742.904) -- 0:00:43 409500 -- (-1742.214) (-1742.940) [-1742.338] (-1741.249) * (-1745.473) [-1742.771] (-1742.813) (-1741.111) -- 0:00:43 410000 -- (-1741.816) (-1742.940) (-1742.206) [-1740.893] * (-1742.848) [-1742.839] (-1745.724) (-1741.317) -- 0:00:43 Average standard deviation of split frequencies: 0.008913 410500 -- (-1744.329) (-1742.479) (-1741.745) [-1742.006] * (-1744.918) (-1744.004) (-1741.829) [-1742.714] -- 0:00:43 411000 -- (-1740.807) (-1743.175) [-1742.002] (-1742.555) * (-1742.726) [-1744.121] (-1745.886) (-1742.454) -- 0:00:42 411500 -- [-1742.294] (-1744.542) (-1742.524) (-1743.717) * [-1743.334] (-1741.766) (-1742.309) (-1742.766) -- 0:00:42 412000 -- [-1741.053] (-1744.857) (-1746.754) (-1743.663) * (-1743.631) [-1741.861] (-1742.300) (-1746.595) -- 0:00:42 412500 -- [-1740.645] (-1744.857) (-1746.132) (-1743.851) * (-1746.665) (-1741.894) (-1749.797) [-1745.053] -- 0:00:42 413000 -- (-1745.020) [-1741.432] (-1744.853) (-1746.275) * [-1742.883] (-1742.225) (-1747.430) (-1746.389) -- 0:00:42 413500 -- (-1743.356) (-1745.239) [-1742.132] (-1742.895) * [-1741.974] (-1741.829) (-1743.786) (-1742.368) -- 0:00:42 414000 -- (-1741.526) (-1745.382) [-1743.081] (-1741.079) * (-1741.903) (-1746.457) [-1743.658] (-1741.959) -- 0:00:42 414500 -- (-1740.745) (-1745.383) (-1746.154) [-1741.028] * (-1742.081) (-1747.274) (-1744.429) [-1740.566] -- 0:00:42 415000 -- [-1743.569] (-1741.695) (-1743.091) (-1740.510) * [-1745.454] (-1741.107) (-1743.476) (-1742.597) -- 0:00:42 Average standard deviation of split frequencies: 0.009703 415500 -- (-1742.459) [-1742.155] (-1743.398) (-1744.609) * [-1741.706] (-1742.359) (-1743.871) (-1741.533) -- 0:00:42 416000 -- (-1742.501) (-1742.125) [-1743.010] (-1743.308) * (-1742.494) (-1742.092) (-1744.368) [-1741.847] -- 0:00:42 416500 -- (-1743.419) [-1740.833] (-1740.321) (-1745.191) * (-1741.840) [-1742.116] (-1742.056) (-1742.008) -- 0:00:42 417000 -- (-1743.890) (-1748.825) [-1742.728] (-1742.464) * (-1742.620) [-1742.654] (-1743.113) (-1740.822) -- 0:00:41 417500 -- (-1741.969) (-1742.786) (-1741.217) [-1743.239] * (-1745.775) [-1741.939] (-1744.211) (-1741.464) -- 0:00:41 418000 -- [-1742.852] (-1743.156) (-1742.325) (-1743.086) * [-1741.037] (-1745.541) (-1740.587) (-1741.503) -- 0:00:41 418500 -- (-1741.194) [-1741.956] (-1742.401) (-1743.104) * (-1740.766) (-1746.747) (-1740.967) [-1741.211] -- 0:00:41 419000 -- (-1744.164) [-1741.813] (-1744.653) (-1741.922) * (-1743.187) [-1746.568] (-1740.978) (-1743.056) -- 0:00:41 419500 -- (-1744.858) (-1741.583) [-1740.907] (-1744.366) * (-1743.382) (-1743.711) [-1741.586] (-1741.575) -- 0:00:41 420000 -- (-1743.250) (-1743.692) [-1741.750] (-1743.937) * (-1749.404) [-1742.959] (-1741.459) (-1741.845) -- 0:00:41 Average standard deviation of split frequencies: 0.010156 420500 -- [-1743.512] (-1742.412) (-1743.334) (-1744.307) * (-1746.083) (-1741.573) (-1741.213) [-1742.872] -- 0:00:41 421000 -- (-1743.316) (-1744.093) [-1742.187] (-1741.786) * (-1741.743) (-1745.824) [-1743.082] (-1741.994) -- 0:00:41 421500 -- (-1744.231) [-1743.937] (-1743.842) (-1742.508) * (-1743.135) [-1746.089] (-1745.978) (-1745.309) -- 0:00:41 422000 -- [-1742.113] (-1742.662) (-1743.492) (-1743.411) * [-1741.228] (-1741.909) (-1742.791) (-1742.161) -- 0:00:41 422500 -- (-1742.548) (-1741.609) [-1742.971] (-1743.806) * (-1743.500) [-1742.381] (-1743.829) (-1741.888) -- 0:00:42 423000 -- [-1741.979] (-1741.527) (-1742.461) (-1742.722) * (-1742.409) [-1742.128] (-1746.688) (-1742.585) -- 0:00:42 423500 -- [-1741.961] (-1742.846) (-1743.494) (-1743.406) * (-1740.971) (-1741.926) (-1745.228) [-1741.134] -- 0:00:42 424000 -- (-1741.324) (-1745.274) (-1743.171) [-1742.769] * (-1740.884) (-1740.737) (-1743.045) [-1741.091] -- 0:00:42 424500 -- (-1743.009) (-1743.810) [-1743.351] (-1743.098) * (-1741.689) (-1741.073) (-1745.743) [-1741.265] -- 0:00:42 425000 -- (-1741.950) [-1740.770] (-1743.163) (-1744.249) * (-1746.612) [-1740.306] (-1750.802) (-1741.255) -- 0:00:41 Average standard deviation of split frequencies: 0.009752 425500 -- [-1744.467] (-1740.770) (-1743.930) (-1746.239) * (-1742.432) (-1744.487) (-1748.727) [-1740.383] -- 0:00:41 426000 -- (-1742.636) (-1741.730) (-1744.061) [-1743.400] * (-1741.362) (-1741.828) (-1742.101) [-1740.805] -- 0:00:41 426500 -- [-1742.929] (-1742.081) (-1742.622) (-1744.455) * [-1742.369] (-1740.707) (-1746.650) (-1742.587) -- 0:00:41 427000 -- (-1743.269) (-1741.613) (-1742.328) [-1742.979] * (-1746.573) (-1740.680) (-1741.278) [-1742.331] -- 0:00:41 427500 -- (-1745.602) (-1742.530) [-1740.792] (-1741.323) * (-1745.382) [-1741.668] (-1744.341) (-1743.133) -- 0:00:41 428000 -- (-1743.997) [-1742.480] (-1742.457) (-1741.227) * (-1740.768) [-1743.283] (-1741.320) (-1742.028) -- 0:00:41 428500 -- (-1742.826) (-1742.079) [-1740.495] (-1744.737) * (-1746.945) (-1744.058) (-1741.971) [-1744.862] -- 0:00:41 429000 -- (-1743.003) (-1742.157) (-1740.494) [-1744.556] * [-1742.142] (-1747.256) (-1741.811) (-1741.138) -- 0:00:41 429500 -- (-1745.826) (-1742.294) [-1741.499] (-1741.681) * (-1746.951) (-1741.575) (-1742.457) [-1743.467] -- 0:00:41 430000 -- (-1746.304) [-1744.606] (-1741.444) (-1741.356) * (-1745.194) [-1741.987] (-1741.303) (-1741.303) -- 0:00:41 Average standard deviation of split frequencies: 0.008346 430500 -- (-1744.531) (-1742.256) (-1742.661) [-1741.867] * (-1743.916) (-1744.665) [-1740.828] (-1741.785) -- 0:00:41 431000 -- (-1746.271) (-1743.050) [-1741.611] (-1741.404) * (-1741.279) (-1742.382) (-1741.022) [-1741.906] -- 0:00:40 431500 -- (-1743.260) [-1740.872] (-1744.247) (-1743.538) * (-1747.959) [-1741.425] (-1742.203) (-1741.626) -- 0:00:40 432000 -- [-1741.403] (-1743.447) (-1744.212) (-1743.577) * (-1742.664) (-1744.953) [-1741.635] (-1742.919) -- 0:00:40 432500 -- [-1743.033] (-1742.732) (-1742.112) (-1744.330) * [-1742.891] (-1744.854) (-1743.981) (-1743.644) -- 0:00:40 433000 -- [-1742.346] (-1743.877) (-1742.826) (-1741.189) * (-1741.815) (-1743.472) [-1740.992] (-1741.983) -- 0:00:40 433500 -- (-1742.473) (-1742.338) [-1742.459] (-1742.957) * (-1741.438) [-1741.467] (-1741.142) (-1744.357) -- 0:00:40 434000 -- (-1741.847) (-1743.012) (-1744.489) [-1740.981] * [-1741.669] (-1744.921) (-1742.489) (-1744.451) -- 0:00:40 434500 -- (-1742.123) (-1744.167) [-1743.974] (-1743.277) * [-1743.968] (-1741.436) (-1745.395) (-1743.709) -- 0:00:40 435000 -- [-1742.004] (-1742.048) (-1745.206) (-1742.569) * [-1741.806] (-1741.869) (-1745.479) (-1742.137) -- 0:00:40 Average standard deviation of split frequencies: 0.008514 435500 -- (-1742.163) (-1741.790) [-1744.083] (-1741.669) * [-1742.437] (-1741.940) (-1749.451) (-1742.537) -- 0:00:40 436000 -- (-1743.233) [-1742.151] (-1744.251) (-1744.628) * [-1742.930] (-1742.068) (-1743.773) (-1743.167) -- 0:00:40 436500 -- (-1741.347) [-1744.348] (-1753.076) (-1742.237) * [-1741.194] (-1741.727) (-1743.991) (-1742.358) -- 0:00:40 437000 -- (-1740.657) (-1746.411) (-1754.147) [-1746.168] * [-1740.480] (-1740.996) (-1743.206) (-1742.395) -- 0:00:39 437500 -- (-1742.404) [-1743.220] (-1747.157) (-1745.649) * (-1740.744) (-1741.838) (-1742.439) [-1743.649] -- 0:00:41 438000 -- (-1746.160) (-1743.155) [-1742.270] (-1745.549) * [-1742.004] (-1745.449) (-1743.926) (-1742.173) -- 0:00:41 438500 -- [-1741.104] (-1747.401) (-1743.539) (-1743.520) * (-1743.324) (-1749.034) [-1743.099] (-1746.519) -- 0:00:40 439000 -- [-1741.610] (-1742.279) (-1746.025) (-1741.907) * (-1743.398) [-1741.134] (-1741.488) (-1743.129) -- 0:00:40 439500 -- (-1743.262) (-1740.876) (-1743.956) [-1741.447] * (-1741.065) (-1742.653) [-1742.366] (-1745.167) -- 0:00:40 440000 -- (-1742.281) [-1744.667] (-1742.659) (-1744.359) * [-1740.472] (-1743.563) (-1745.365) (-1745.292) -- 0:00:40 Average standard deviation of split frequencies: 0.008892 440500 -- (-1741.427) [-1742.545] (-1742.301) (-1744.882) * (-1741.623) (-1740.986) (-1744.442) [-1745.898] -- 0:00:40 441000 -- [-1741.234] (-1746.233) (-1741.768) (-1741.884) * [-1740.614] (-1745.118) (-1741.856) (-1742.211) -- 0:00:40 441500 -- (-1742.600) [-1740.721] (-1741.518) (-1742.944) * (-1743.982) (-1745.450) (-1742.567) [-1742.953] -- 0:00:40 442000 -- (-1740.741) (-1741.197) (-1744.799) [-1745.077] * [-1741.417] (-1746.537) (-1746.186) (-1742.390) -- 0:00:40 442500 -- [-1742.957] (-1741.221) (-1742.144) (-1745.167) * [-1743.344] (-1743.720) (-1740.892) (-1744.341) -- 0:00:40 443000 -- (-1741.397) [-1742.538] (-1741.688) (-1743.893) * (-1741.444) [-1743.267] (-1741.260) (-1742.182) -- 0:00:40 443500 -- (-1740.927) (-1745.582) (-1742.942) [-1741.337] * (-1742.109) (-1743.111) (-1741.836) [-1742.136] -- 0:00:40 444000 -- (-1740.422) (-1745.838) [-1742.393] (-1744.565) * (-1741.931) [-1744.095] (-1741.102) (-1741.579) -- 0:00:40 444500 -- (-1741.709) (-1742.512) [-1743.786] (-1744.594) * (-1744.973) [-1740.917] (-1741.653) (-1741.126) -- 0:00:39 445000 -- (-1740.528) (-1743.364) (-1742.431) [-1743.477] * (-1742.205) (-1743.481) [-1743.688] (-1741.703) -- 0:00:39 Average standard deviation of split frequencies: 0.008522 445500 -- [-1740.567] (-1741.052) (-1741.893) (-1742.064) * (-1742.479) (-1743.996) (-1745.305) [-1742.094] -- 0:00:39 446000 -- (-1744.355) (-1742.613) (-1745.087) [-1741.054] * [-1741.438] (-1740.809) (-1742.843) (-1741.983) -- 0:00:39 446500 -- (-1743.596) [-1744.498] (-1741.587) (-1741.898) * (-1746.565) (-1740.501) (-1742.701) [-1741.645] -- 0:00:39 447000 -- [-1743.068] (-1741.330) (-1740.683) (-1740.581) * (-1747.653) [-1741.104] (-1742.272) (-1742.409) -- 0:00:39 447500 -- (-1743.463) (-1745.026) [-1740.714] (-1741.716) * (-1743.392) [-1741.260] (-1742.272) (-1741.227) -- 0:00:39 448000 -- (-1742.256) [-1741.778] (-1743.221) (-1742.778) * [-1742.488] (-1740.718) (-1742.092) (-1740.867) -- 0:00:39 448500 -- (-1741.049) (-1744.575) [-1742.073] (-1742.419) * (-1749.457) (-1742.263) [-1744.741] (-1741.088) -- 0:00:39 449000 -- (-1743.521) (-1743.129) [-1744.194] (-1741.814) * (-1742.004) (-1745.580) (-1744.511) [-1741.489] -- 0:00:39 449500 -- [-1747.482] (-1745.507) (-1744.804) (-1746.058) * (-1743.725) (-1742.560) [-1744.089] (-1743.477) -- 0:00:39 450000 -- (-1740.810) (-1745.621) [-1744.303] (-1743.801) * (-1742.751) [-1743.818] (-1743.227) (-1742.325) -- 0:00:39 Average standard deviation of split frequencies: 0.008041 450500 -- (-1741.630) (-1743.111) [-1742.188] (-1743.665) * (-1744.204) (-1742.881) (-1740.628) [-1741.712] -- 0:00:39 451000 -- (-1742.787) (-1747.975) [-1740.483] (-1742.910) * [-1740.988] (-1741.410) (-1741.020) (-1740.948) -- 0:00:38 451500 -- (-1742.270) (-1744.683) [-1743.883] (-1742.747) * (-1744.266) (-1741.245) (-1741.020) [-1742.822] -- 0:00:38 452000 -- [-1742.051] (-1744.167) (-1744.208) (-1742.702) * (-1742.500) [-1741.329] (-1741.722) (-1747.362) -- 0:00:38 452500 -- (-1744.790) (-1745.285) [-1741.721] (-1742.586) * (-1743.923) (-1748.700) [-1741.634] (-1742.359) -- 0:00:39 453000 -- [-1741.730] (-1744.095) (-1743.282) (-1744.540) * [-1744.098] (-1743.020) (-1741.706) (-1745.160) -- 0:00:39 453500 -- (-1740.604) (-1744.502) (-1743.506) [-1742.959] * (-1741.238) [-1742.387] (-1742.756) (-1746.980) -- 0:00:39 454000 -- (-1744.593) [-1745.891] (-1744.853) (-1740.554) * [-1742.014] (-1742.458) (-1742.179) (-1742.895) -- 0:00:39 454500 -- (-1743.943) [-1742.093] (-1744.685) (-1741.611) * (-1741.024) (-1740.929) (-1743.651) [-1743.196] -- 0:00:39 455000 -- (-1745.380) [-1741.676] (-1741.255) (-1745.234) * (-1740.902) [-1744.287] (-1744.263) (-1745.504) -- 0:00:39 Average standard deviation of split frequencies: 0.008012 455500 -- (-1744.296) (-1743.120) (-1740.759) [-1741.665] * (-1744.584) (-1744.225) (-1744.260) [-1743.446] -- 0:00:39 456000 -- (-1745.346) (-1743.404) (-1741.699) [-1744.338] * (-1743.753) [-1741.309] (-1742.562) (-1741.758) -- 0:00:39 456500 -- [-1742.862] (-1742.620) (-1741.452) (-1742.990) * [-1743.665] (-1742.048) (-1742.677) (-1743.880) -- 0:00:39 457000 -- (-1741.231) [-1743.511] (-1742.421) (-1743.857) * [-1742.478] (-1744.486) (-1742.389) (-1746.702) -- 0:00:39 457500 -- (-1741.505) (-1743.521) [-1742.396] (-1745.574) * (-1742.849) (-1740.907) (-1743.282) [-1743.153] -- 0:00:39 458000 -- [-1740.746] (-1743.508) (-1741.437) (-1742.557) * (-1743.438) [-1741.412] (-1742.703) (-1742.839) -- 0:00:39 458500 -- [-1740.760] (-1741.142) (-1745.284) (-1742.135) * (-1741.608) [-1741.387] (-1742.744) (-1742.207) -- 0:00:38 459000 -- (-1741.575) (-1741.719) (-1746.083) [-1741.081] * (-1742.164) [-1741.899] (-1744.479) (-1741.602) -- 0:00:38 459500 -- [-1741.910] (-1745.700) (-1742.834) (-1742.713) * (-1745.638) (-1741.864) [-1745.627] (-1741.894) -- 0:00:38 460000 -- [-1743.343] (-1745.819) (-1741.976) (-1742.991) * (-1746.431) (-1743.723) [-1743.609] (-1744.706) -- 0:00:38 Average standard deviation of split frequencies: 0.008378 460500 -- (-1741.252) (-1746.289) [-1742.358] (-1744.394) * [-1745.907] (-1743.541) (-1742.461) (-1744.769) -- 0:00:38 461000 -- (-1741.517) (-1744.190) [-1742.481] (-1743.492) * [-1742.552] (-1743.278) (-1742.841) (-1743.373) -- 0:00:38 461500 -- (-1743.522) [-1742.368] (-1744.293) (-1742.664) * [-1740.460] (-1744.610) (-1745.379) (-1743.487) -- 0:00:38 462000 -- [-1747.282] (-1741.320) (-1742.400) (-1742.544) * (-1740.336) (-1743.010) [-1742.972] (-1742.458) -- 0:00:38 462500 -- (-1749.585) (-1745.054) [-1742.550] (-1743.910) * (-1741.473) (-1745.016) (-1742.884) [-1740.880] -- 0:00:38 463000 -- (-1747.292) (-1741.337) (-1746.467) [-1741.389] * [-1740.747] (-1744.735) (-1746.466) (-1742.468) -- 0:00:38 463500 -- (-1742.869) [-1740.705] (-1744.501) (-1745.379) * (-1743.045) (-1742.939) [-1744.565] (-1744.417) -- 0:00:38 464000 -- (-1745.220) (-1744.845) (-1744.609) [-1742.096] * (-1741.904) [-1744.097] (-1741.919) (-1743.712) -- 0:00:38 464500 -- [-1740.833] (-1740.862) (-1743.577) (-1742.674) * (-1742.829) (-1741.691) [-1741.038] (-1742.159) -- 0:00:38 465000 -- (-1740.735) [-1743.190] (-1742.878) (-1743.203) * [-1741.936] (-1740.656) (-1746.196) (-1743.521) -- 0:00:37 Average standard deviation of split frequencies: 0.009818 465500 -- (-1742.147) [-1745.070] (-1743.588) (-1747.658) * (-1742.069) (-1743.851) [-1744.062] (-1746.963) -- 0:00:37 466000 -- [-1741.327] (-1748.664) (-1745.421) (-1745.746) * (-1744.524) (-1745.535) (-1743.632) [-1743.683] -- 0:00:37 466500 -- (-1741.263) (-1743.315) [-1744.559] (-1744.661) * [-1742.658] (-1743.906) (-1743.649) (-1741.154) -- 0:00:38 467000 -- [-1741.463] (-1745.918) (-1743.522) (-1745.808) * (-1747.316) (-1742.083) (-1748.446) [-1740.785] -- 0:00:38 467500 -- (-1741.115) (-1741.938) (-1745.626) [-1741.464] * (-1745.661) (-1741.892) (-1742.364) [-1741.908] -- 0:00:38 468000 -- (-1742.554) (-1744.851) (-1747.472) [-1743.770] * (-1745.068) (-1741.270) [-1743.705] (-1745.779) -- 0:00:38 468500 -- (-1744.589) [-1744.545] (-1746.236) (-1745.545) * [-1742.445] (-1741.861) (-1746.838) (-1742.669) -- 0:00:38 469000 -- (-1741.358) (-1742.523) (-1747.187) [-1744.854] * [-1742.067] (-1743.458) (-1746.152) (-1743.236) -- 0:00:38 469500 -- [-1741.540] (-1742.221) (-1742.774) (-1744.157) * [-1745.207] (-1743.305) (-1742.464) (-1741.788) -- 0:00:38 470000 -- (-1741.519) [-1741.394] (-1744.090) (-1744.721) * (-1742.221) [-1740.682] (-1745.748) (-1746.067) -- 0:00:38 Average standard deviation of split frequencies: 0.009662 470500 -- (-1742.569) [-1742.007] (-1743.185) (-1744.369) * (-1744.247) [-1742.488] (-1744.089) (-1741.096) -- 0:00:38 471000 -- [-1742.836] (-1742.719) (-1741.853) (-1743.200) * (-1742.115) (-1745.967) [-1744.051] (-1746.474) -- 0:00:38 471500 -- (-1741.466) [-1741.625] (-1741.317) (-1743.660) * (-1743.854) [-1742.286] (-1742.149) (-1742.125) -- 0:00:38 472000 -- (-1741.750) (-1744.159) (-1742.418) [-1741.565] * [-1742.378] (-1740.499) (-1743.764) (-1740.982) -- 0:00:38 472500 -- (-1742.343) [-1744.229] (-1741.927) (-1742.750) * (-1742.100) (-1746.619) [-1744.294] (-1741.108) -- 0:00:37 473000 -- (-1741.606) (-1746.566) [-1742.766] (-1743.794) * (-1740.752) (-1746.826) (-1746.727) [-1741.816] -- 0:00:37 473500 -- (-1746.971) (-1745.483) [-1743.128] (-1743.763) * [-1741.757] (-1744.072) (-1741.930) (-1743.072) -- 0:00:37 474000 -- (-1745.465) (-1741.837) (-1742.546) [-1743.713] * (-1744.859) (-1742.839) [-1741.961] (-1743.339) -- 0:00:37 474500 -- (-1744.478) (-1741.226) [-1742.476] (-1745.754) * (-1743.236) [-1744.218] (-1745.303) (-1745.619) -- 0:00:37 475000 -- (-1742.036) (-1741.226) [-1741.536] (-1744.112) * (-1743.596) (-1744.139) [-1749.494] (-1743.245) -- 0:00:37 Average standard deviation of split frequencies: 0.009030 475500 -- (-1741.921) [-1741.140] (-1740.815) (-1746.320) * (-1743.443) (-1744.426) [-1740.829] (-1745.471) -- 0:00:37 476000 -- (-1740.585) (-1741.207) (-1743.452) [-1742.499] * [-1742.822] (-1742.900) (-1746.301) (-1743.843) -- 0:00:37 476500 -- (-1743.397) [-1741.266] (-1746.831) (-1741.679) * (-1744.945) [-1741.502] (-1743.866) (-1746.328) -- 0:00:37 477000 -- [-1740.900] (-1741.004) (-1744.078) (-1742.841) * (-1743.587) [-1744.321] (-1743.323) (-1742.160) -- 0:00:37 477500 -- (-1741.647) (-1745.309) [-1743.238] (-1745.913) * [-1742.043] (-1742.426) (-1743.363) (-1741.874) -- 0:00:37 478000 -- (-1742.208) [-1746.543] (-1743.038) (-1747.537) * (-1743.326) (-1744.323) [-1747.839] (-1740.928) -- 0:00:37 478500 -- (-1742.127) (-1741.239) [-1742.219] (-1748.319) * (-1742.245) (-1742.558) (-1745.436) [-1741.465] -- 0:00:37 479000 -- (-1742.521) (-1742.909) [-1741.453] (-1741.542) * [-1746.313] (-1741.295) (-1745.585) (-1743.316) -- 0:00:36 479500 -- (-1741.580) (-1743.628) (-1743.715) [-1741.144] * (-1746.681) (-1742.019) (-1746.175) [-1740.891] -- 0:00:36 480000 -- (-1742.740) (-1743.228) [-1743.122] (-1742.395) * [-1742.630] (-1740.286) (-1746.289) (-1742.438) -- 0:00:36 Average standard deviation of split frequencies: 0.008827 480500 -- (-1744.916) (-1741.186) (-1743.251) [-1742.004] * (-1741.578) [-1741.269] (-1743.977) (-1743.520) -- 0:00:36 481000 -- (-1744.515) [-1741.511] (-1741.939) (-1742.556) * [-1740.957] (-1741.465) (-1742.314) (-1748.587) -- 0:00:37 481500 -- (-1743.650) [-1742.046] (-1742.813) (-1742.247) * [-1743.061] (-1741.312) (-1743.318) (-1745.852) -- 0:00:37 482000 -- (-1742.628) [-1742.215] (-1742.779) (-1741.293) * (-1742.209) (-1740.791) (-1743.533) [-1747.300] -- 0:00:37 482500 -- (-1748.221) [-1743.390] (-1744.217) (-1742.599) * (-1744.527) [-1740.458] (-1743.143) (-1746.487) -- 0:00:37 483000 -- [-1742.723] (-1743.160) (-1742.353) (-1742.939) * (-1741.466) (-1745.348) [-1742.983] (-1750.752) -- 0:00:37 483500 -- (-1747.052) (-1744.324) [-1740.492] (-1742.336) * (-1743.245) [-1742.184] (-1741.542) (-1742.041) -- 0:00:37 484000 -- (-1744.732) [-1744.119] (-1740.500) (-1741.510) * (-1741.103) (-1742.591) (-1741.649) [-1742.416] -- 0:00:37 484500 -- [-1742.476] (-1743.306) (-1741.343) (-1741.854) * [-1740.680] (-1742.587) (-1743.094) (-1741.606) -- 0:00:37 485000 -- (-1742.599) (-1744.889) (-1740.553) [-1741.579] * [-1740.652] (-1744.272) (-1743.930) (-1741.596) -- 0:00:37 Average standard deviation of split frequencies: 0.008559 485500 -- (-1742.469) (-1741.121) [-1741.434] (-1744.959) * [-1741.848] (-1742.653) (-1744.779) (-1743.044) -- 0:00:37 486000 -- (-1743.977) [-1741.608] (-1742.455) (-1745.241) * [-1741.279] (-1742.278) (-1742.907) (-1740.998) -- 0:00:37 486500 -- (-1742.336) [-1740.666] (-1742.660) (-1745.480) * (-1741.135) (-1741.598) (-1740.515) [-1744.546] -- 0:00:36 487000 -- [-1742.082] (-1741.269) (-1742.393) (-1742.404) * (-1743.251) [-1740.590] (-1740.751) (-1742.251) -- 0:00:36 487500 -- [-1742.621] (-1740.805) (-1742.507) (-1745.037) * (-1746.595) [-1745.027] (-1741.628) (-1742.006) -- 0:00:36 488000 -- (-1743.188) [-1740.656] (-1743.561) (-1745.406) * (-1743.690) (-1742.995) (-1741.824) [-1743.625] -- 0:00:36 488500 -- (-1743.500) (-1747.308) (-1740.889) [-1743.069] * (-1745.302) (-1741.396) (-1742.205) [-1743.859] -- 0:00:36 489000 -- (-1743.468) (-1741.983) (-1741.488) [-1745.677] * (-1741.221) [-1742.874] (-1742.051) (-1743.064) -- 0:00:36 489500 -- (-1743.154) (-1745.653) [-1740.681] (-1741.297) * (-1745.387) (-1745.404) (-1744.748) [-1742.146] -- 0:00:36 490000 -- (-1741.538) (-1745.194) (-1740.657) [-1742.799] * (-1746.435) [-1742.773] (-1743.782) (-1742.145) -- 0:00:36 Average standard deviation of split frequencies: 0.008421 490500 -- (-1743.920) (-1744.821) (-1743.685) [-1741.784] * (-1744.141) (-1741.657) [-1747.413] (-1742.642) -- 0:00:36 491000 -- [-1744.553] (-1742.068) (-1743.504) (-1741.490) * (-1741.854) [-1742.897] (-1743.975) (-1742.495) -- 0:00:36 491500 -- (-1744.712) (-1745.215) [-1745.518] (-1742.587) * (-1742.022) (-1742.600) (-1742.275) [-1741.102] -- 0:00:36 492000 -- [-1744.902] (-1743.054) (-1743.732) (-1741.757) * (-1742.808) (-1743.585) [-1741.252] (-1740.544) -- 0:00:36 492500 -- (-1740.688) (-1747.172) [-1743.504] (-1741.133) * (-1745.203) (-1743.451) [-1742.153] (-1741.805) -- 0:00:36 493000 -- (-1745.338) (-1742.524) [-1744.866] (-1743.261) * (-1741.143) [-1743.347] (-1742.116) (-1741.540) -- 0:00:35 493500 -- (-1742.694) (-1741.506) (-1742.122) [-1743.737] * (-1742.436) [-1746.447] (-1745.747) (-1742.832) -- 0:00:35 494000 -- (-1746.315) (-1743.892) [-1741.247] (-1745.611) * [-1742.406] (-1743.776) (-1742.567) (-1742.281) -- 0:00:35 494500 -- [-1745.651] (-1741.432) (-1741.188) (-1746.606) * (-1742.552) (-1741.971) [-1746.149] (-1742.552) -- 0:00:35 495000 -- (-1744.848) (-1742.098) (-1742.809) [-1742.729] * (-1741.217) (-1746.266) (-1747.342) [-1741.657] -- 0:00:36 Average standard deviation of split frequencies: 0.008274 495500 -- (-1740.829) (-1743.058) [-1744.249] (-1743.451) * (-1742.120) (-1742.448) [-1743.141] (-1743.457) -- 0:00:36 496000 -- (-1743.692) (-1744.750) (-1744.243) [-1743.177] * (-1741.430) (-1743.911) (-1741.075) [-1743.220] -- 0:00:36 496500 -- (-1740.953) [-1745.627] (-1743.977) (-1744.950) * (-1741.854) [-1742.073] (-1740.651) (-1743.042) -- 0:00:36 497000 -- (-1742.037) [-1742.638] (-1742.816) (-1744.238) * (-1741.434) (-1742.061) [-1740.528] (-1743.261) -- 0:00:36 497500 -- [-1746.070] (-1744.899) (-1742.825) (-1743.665) * (-1741.881) [-1742.282] (-1745.697) (-1741.329) -- 0:00:36 498000 -- (-1741.871) (-1746.303) (-1743.836) [-1742.556] * (-1742.476) (-1741.004) [-1742.785] (-1742.906) -- 0:00:36 498500 -- (-1743.476) (-1742.677) [-1743.262] (-1741.816) * (-1744.947) (-1742.201) (-1743.702) [-1741.355] -- 0:00:36 499000 -- (-1742.611) (-1742.121) (-1743.237) [-1740.669] * [-1744.433] (-1742.810) (-1742.362) (-1741.016) -- 0:00:36 499500 -- (-1744.595) (-1741.971) [-1744.899] (-1741.738) * [-1742.644] (-1741.322) (-1745.747) (-1741.805) -- 0:00:36 500000 -- (-1743.189) (-1741.867) (-1744.288) [-1741.801] * [-1743.682] (-1747.571) (-1746.174) (-1741.834) -- 0:00:36 Average standard deviation of split frequencies: 0.008419 500500 -- (-1743.287) (-1742.865) [-1742.251] (-1742.914) * (-1742.234) [-1744.428] (-1741.795) (-1743.059) -- 0:00:35 501000 -- [-1742.200] (-1741.507) (-1743.809) (-1741.496) * (-1742.006) (-1745.800) (-1741.738) [-1744.335] -- 0:00:35 501500 -- (-1745.296) [-1740.888] (-1742.261) (-1743.781) * [-1742.952] (-1744.350) (-1741.426) (-1745.837) -- 0:00:35 502000 -- [-1745.335] (-1740.887) (-1742.154) (-1743.600) * (-1741.294) (-1746.177) (-1746.176) [-1742.851] -- 0:00:35 502500 -- (-1742.841) (-1743.650) [-1741.957] (-1747.874) * (-1743.757) (-1742.939) [-1744.025] (-1743.424) -- 0:00:35 503000 -- [-1743.746] (-1743.439) (-1749.985) (-1744.117) * (-1745.237) [-1741.465] (-1741.073) (-1743.807) -- 0:00:35 503500 -- (-1743.485) [-1741.973] (-1742.430) (-1742.621) * (-1743.017) (-1742.074) [-1741.154] (-1744.247) -- 0:00:35 504000 -- (-1746.027) (-1741.710) [-1742.443] (-1742.851) * (-1741.808) (-1741.212) [-1741.753] (-1742.854) -- 0:00:35 504500 -- [-1743.201] (-1742.107) (-1742.150) (-1745.348) * (-1743.063) (-1742.630) [-1740.329] (-1742.024) -- 0:00:35 505000 -- [-1741.523] (-1742.011) (-1748.328) (-1745.835) * (-1740.872) [-1740.800] (-1740.808) (-1742.634) -- 0:00:35 Average standard deviation of split frequencies: 0.009561 505500 -- (-1742.195) (-1744.273) (-1746.014) [-1741.774] * (-1741.041) (-1741.577) [-1740.467] (-1744.431) -- 0:00:35 506000 -- [-1741.177] (-1743.756) (-1743.743) (-1742.579) * (-1745.238) [-1741.801] (-1743.362) (-1745.121) -- 0:00:35 506500 -- [-1747.665] (-1744.839) (-1742.948) (-1747.406) * (-1744.611) [-1741.930] (-1743.145) (-1746.457) -- 0:00:35 507000 -- [-1740.371] (-1744.900) (-1745.151) (-1745.415) * (-1742.167) (-1742.769) (-1744.649) [-1744.035] -- 0:00:35 507500 -- (-1740.841) (-1744.379) (-1743.603) [-1743.599] * (-1742.209) [-1742.652] (-1742.707) (-1741.537) -- 0:00:34 508000 -- (-1741.611) (-1742.819) [-1744.216] (-1743.605) * (-1744.118) (-1742.574) (-1742.291) [-1741.796] -- 0:00:35 508500 -- [-1743.386] (-1744.234) (-1743.519) (-1741.952) * (-1741.765) (-1742.910) [-1744.233] (-1742.139) -- 0:00:35 509000 -- (-1742.151) [-1743.616] (-1744.470) (-1743.946) * (-1740.534) (-1745.732) (-1741.542) [-1742.505] -- 0:00:35 509500 -- [-1741.558] (-1741.652) (-1745.677) (-1746.090) * [-1740.830] (-1741.887) (-1745.534) (-1743.649) -- 0:00:35 510000 -- (-1745.535) (-1743.746) [-1743.044] (-1746.404) * [-1740.925] (-1742.188) (-1751.710) (-1743.097) -- 0:00:35 Average standard deviation of split frequencies: 0.009693 510500 -- (-1741.154) [-1741.871] (-1744.449) (-1743.507) * (-1749.151) [-1742.833] (-1750.087) (-1742.499) -- 0:00:35 511000 -- (-1744.562) [-1741.689] (-1743.178) (-1741.942) * (-1744.487) [-1746.886] (-1748.001) (-1746.659) -- 0:00:35 511500 -- [-1741.588] (-1745.870) (-1743.570) (-1742.914) * (-1744.222) (-1743.107) [-1744.798] (-1743.365) -- 0:00:35 512000 -- [-1741.944] (-1741.517) (-1742.941) (-1741.376) * (-1743.322) [-1742.277] (-1744.051) (-1743.360) -- 0:00:35 512500 -- [-1743.259] (-1741.496) (-1743.010) (-1741.682) * (-1741.846) (-1743.854) [-1742.279] (-1741.588) -- 0:00:35 513000 -- (-1742.674) [-1741.336] (-1741.700) (-1742.379) * (-1743.991) (-1743.048) (-1742.658) [-1745.558] -- 0:00:35 513500 -- (-1744.732) (-1741.578) (-1741.298) [-1743.401] * (-1744.908) (-1744.138) [-1742.588] (-1746.065) -- 0:00:35 514000 -- [-1741.980] (-1742.473) (-1741.350) (-1745.581) * (-1742.981) (-1749.218) (-1743.873) [-1745.860] -- 0:00:34 514500 -- (-1749.015) [-1741.806] (-1746.692) (-1743.696) * (-1743.377) (-1743.147) [-1742.812] (-1746.126) -- 0:00:34 515000 -- (-1747.759) (-1742.397) (-1747.434) [-1741.940] * (-1744.438) [-1742.343] (-1741.961) (-1743.095) -- 0:00:34 Average standard deviation of split frequencies: 0.008374 515500 -- [-1743.646] (-1745.056) (-1741.120) (-1741.250) * (-1742.542) [-1742.851] (-1741.106) (-1746.371) -- 0:00:34 516000 -- (-1744.058) [-1741.540] (-1741.850) (-1741.368) * (-1742.261) (-1744.205) (-1741.818) [-1746.740] -- 0:00:34 516500 -- (-1745.319) (-1741.284) [-1741.845] (-1744.334) * [-1740.508] (-1742.553) (-1743.676) (-1745.219) -- 0:00:34 517000 -- (-1742.153) (-1741.862) [-1743.780] (-1742.287) * (-1741.955) [-1740.419] (-1742.921) (-1742.866) -- 0:00:34 517500 -- (-1741.509) [-1742.012] (-1749.212) (-1744.742) * [-1743.805] (-1742.652) (-1742.410) (-1742.712) -- 0:00:34 518000 -- (-1743.626) [-1742.169] (-1742.083) (-1742.003) * (-1742.106) (-1740.868) [-1744.641] (-1743.545) -- 0:00:34 518500 -- (-1741.821) (-1742.844) (-1744.022) [-1740.452] * (-1742.243) [-1740.866] (-1745.480) (-1749.128) -- 0:00:34 519000 -- (-1741.658) (-1740.699) (-1745.242) [-1741.975] * (-1747.132) [-1743.840] (-1742.646) (-1746.131) -- 0:00:34 519500 -- (-1741.920) [-1741.793] (-1743.515) (-1741.290) * (-1745.539) (-1745.600) [-1742.131] (-1745.785) -- 0:00:34 520000 -- (-1741.973) (-1741.872) (-1744.131) [-1741.414] * (-1743.597) (-1747.961) [-1741.009] (-1745.891) -- 0:00:35 Average standard deviation of split frequencies: 0.008802 520500 -- (-1741.707) (-1740.905) [-1742.701] (-1743.157) * (-1741.379) [-1743.814] (-1743.012) (-1745.622) -- 0:00:35 521000 -- (-1743.848) [-1741.041] (-1740.823) (-1744.672) * [-1742.306] (-1743.554) (-1743.341) (-1744.415) -- 0:00:34 521500 -- (-1742.259) [-1741.236] (-1741.650) (-1741.969) * (-1743.607) (-1745.272) [-1742.795] (-1746.784) -- 0:00:34 522000 -- [-1741.519] (-1741.109) (-1741.488) (-1741.350) * (-1742.142) (-1745.896) (-1742.118) [-1745.835] -- 0:00:34 522500 -- (-1742.133) (-1741.064) (-1741.706) [-1740.814] * (-1741.530) (-1741.332) (-1742.105) [-1743.388] -- 0:00:34 523000 -- [-1741.635] (-1740.725) (-1742.836) (-1743.092) * (-1742.186) [-1742.296] (-1741.728) (-1742.205) -- 0:00:34 523500 -- [-1741.880] (-1740.725) (-1742.338) (-1741.742) * (-1742.166) (-1742.326) (-1742.893) [-1742.637] -- 0:00:34 524000 -- (-1743.166) (-1741.329) (-1742.741) [-1744.167] * [-1741.344] (-1742.461) (-1745.620) (-1743.664) -- 0:00:34 524500 -- (-1743.080) (-1741.565) (-1742.253) [-1742.546] * [-1741.383] (-1741.384) (-1749.241) (-1743.280) -- 0:00:34 525000 -- (-1745.663) [-1741.508] (-1744.458) (-1742.549) * (-1742.086) [-1742.787] (-1742.713) (-1749.499) -- 0:00:34 Average standard deviation of split frequencies: 0.008862 525500 -- (-1743.172) (-1743.469) (-1742.245) [-1742.237] * (-1742.790) (-1740.813) (-1741.041) [-1741.123] -- 0:00:34 526000 -- (-1741.742) (-1742.890) (-1742.990) [-1744.475] * (-1743.761) (-1740.745) [-1741.832] (-1744.308) -- 0:00:34 526500 -- (-1744.763) (-1742.652) (-1743.707) [-1746.514] * (-1744.985) [-1740.777] (-1741.992) (-1746.409) -- 0:00:34 527000 -- (-1744.257) (-1741.437) [-1743.392] (-1743.042) * (-1743.761) (-1742.164) [-1741.656] (-1742.993) -- 0:00:34 527500 -- (-1744.296) [-1743.946] (-1745.113) (-1740.616) * (-1744.318) (-1741.395) [-1742.411] (-1745.032) -- 0:00:34 528000 -- [-1744.678] (-1744.326) (-1741.909) (-1742.873) * (-1741.453) (-1741.632) (-1742.756) [-1740.977] -- 0:00:33 528500 -- (-1745.830) (-1741.687) (-1741.497) [-1740.517] * (-1744.437) (-1745.657) (-1741.887) [-1741.050] -- 0:00:33 529000 -- (-1742.652) (-1741.454) [-1740.643] (-1740.361) * (-1749.869) (-1742.192) [-1742.219] (-1741.284) -- 0:00:33 529500 -- (-1745.432) (-1743.910) (-1743.020) [-1741.093] * [-1743.835] (-1742.212) (-1745.019) (-1741.572) -- 0:00:33 530000 -- (-1744.664) (-1744.491) (-1742.078) [-1740.285] * (-1744.861) (-1743.114) (-1745.226) [-1741.850] -- 0:00:33 Average standard deviation of split frequencies: 0.008982 530500 -- (-1741.516) [-1742.537] (-1743.960) (-1744.231) * (-1742.985) [-1740.549] (-1746.010) (-1742.034) -- 0:00:33 531000 -- (-1744.499) (-1741.332) [-1744.127] (-1749.079) * (-1743.748) (-1742.367) (-1744.898) [-1744.129] -- 0:00:33 531500 -- (-1741.379) (-1742.594) (-1745.290) [-1742.107] * (-1743.310) (-1742.907) [-1742.318] (-1741.390) -- 0:00:33 532000 -- (-1741.516) (-1743.326) (-1742.250) [-1741.985] * (-1742.199) (-1741.218) (-1742.825) [-1741.749] -- 0:00:33 532500 -- (-1743.464) (-1743.312) (-1742.531) [-1745.328] * (-1742.818) (-1742.678) (-1742.146) [-1741.367] -- 0:00:33 533000 -- [-1746.005] (-1742.999) (-1746.234) (-1746.789) * (-1742.714) (-1743.209) [-1742.622] (-1742.764) -- 0:00:33 533500 -- (-1741.002) (-1742.733) (-1745.233) [-1741.692] * (-1742.230) (-1745.702) (-1741.290) [-1742.191] -- 0:00:34 534000 -- (-1742.306) (-1742.956) (-1748.364) [-1744.089] * (-1741.929) [-1742.506] (-1743.464) (-1742.170) -- 0:00:34 534500 -- (-1741.588) (-1741.651) [-1743.086] (-1741.715) * (-1743.334) (-1742.325) (-1750.125) [-1741.565] -- 0:00:33 535000 -- [-1741.528] (-1742.395) (-1743.024) (-1741.729) * (-1743.262) [-1741.616] (-1744.255) (-1740.967) -- 0:00:33 Average standard deviation of split frequencies: 0.007967 535500 -- [-1742.928] (-1747.096) (-1744.160) (-1742.466) * [-1742.839] (-1742.054) (-1742.092) (-1743.432) -- 0:00:33 536000 -- (-1741.208) (-1747.562) (-1746.081) [-1740.885] * (-1742.526) (-1746.280) (-1743.843) [-1741.930] -- 0:00:33 536500 -- (-1741.592) (-1741.095) (-1742.388) [-1741.082] * (-1742.065) [-1743.038] (-1744.621) (-1741.511) -- 0:00:33 537000 -- (-1742.811) (-1746.012) [-1746.488] (-1741.143) * (-1743.205) (-1745.334) (-1742.263) [-1742.972] -- 0:00:33 537500 -- (-1745.200) [-1741.895] (-1743.355) (-1742.144) * (-1744.878) (-1742.988) (-1743.151) [-1742.774] -- 0:00:33 538000 -- (-1744.882) [-1741.037] (-1744.751) (-1741.250) * (-1742.453) (-1742.689) [-1742.681] (-1744.199) -- 0:00:33 538500 -- (-1747.960) (-1741.063) (-1749.449) [-1741.147] * [-1744.457] (-1741.976) (-1741.923) (-1742.516) -- 0:00:33 539000 -- (-1747.914) [-1741.655] (-1743.765) (-1741.330) * (-1741.168) [-1740.606] (-1741.976) (-1742.741) -- 0:00:33 539500 -- (-1743.447) [-1741.769] (-1744.141) (-1741.378) * (-1748.216) (-1745.365) [-1741.249] (-1742.300) -- 0:00:33 540000 -- (-1742.742) (-1743.136) (-1749.094) [-1742.769] * [-1743.616] (-1741.103) (-1741.200) (-1743.328) -- 0:00:33 Average standard deviation of split frequencies: 0.008565 540500 -- [-1742.259] (-1741.506) (-1741.606) (-1747.512) * (-1741.642) (-1740.656) [-1744.877] (-1741.479) -- 0:00:33 541000 -- (-1743.793) [-1743.237] (-1741.786) (-1743.581) * (-1740.704) (-1740.843) (-1741.851) [-1742.768] -- 0:00:33 541500 -- (-1742.933) (-1742.438) [-1741.130] (-1747.802) * (-1741.584) (-1740.948) (-1742.482) [-1742.861] -- 0:00:33 542000 -- (-1742.725) (-1740.571) (-1740.784) [-1742.814] * (-1742.018) [-1742.746] (-1741.135) (-1742.115) -- 0:00:32 542500 -- (-1745.291) [-1741.544] (-1741.623) (-1743.016) * (-1742.123) (-1742.547) (-1742.099) [-1741.782] -- 0:00:32 543000 -- (-1745.555) (-1742.319) (-1741.817) [-1747.946] * (-1742.398) [-1742.978] (-1742.165) (-1746.875) -- 0:00:32 543500 -- (-1744.603) [-1742.323] (-1744.085) (-1745.762) * (-1741.940) (-1742.972) [-1740.872] (-1748.713) -- 0:00:32 544000 -- (-1744.482) [-1741.051] (-1743.979) (-1747.468) * (-1741.059) (-1743.404) [-1740.893] (-1745.863) -- 0:00:32 544500 -- (-1743.481) (-1740.905) [-1742.607] (-1744.841) * (-1741.941) (-1742.504) [-1742.062] (-1745.337) -- 0:00:32 545000 -- [-1745.521] (-1741.051) (-1742.906) (-1742.263) * (-1742.064) [-1740.561] (-1742.756) (-1743.342) -- 0:00:32 Average standard deviation of split frequencies: 0.009209 545500 -- (-1744.952) (-1744.820) (-1741.441) [-1741.627] * (-1742.591) [-1743.946] (-1741.782) (-1742.872) -- 0:00:32 546000 -- (-1743.766) [-1743.103] (-1741.782) (-1741.268) * (-1743.138) [-1743.850] (-1742.196) (-1741.240) -- 0:00:32 546500 -- (-1749.176) (-1744.023) [-1742.397] (-1743.153) * (-1745.088) [-1740.879] (-1741.455) (-1740.497) -- 0:00:32 547000 -- (-1747.962) (-1741.910) [-1747.669] (-1742.115) * (-1745.002) (-1742.685) (-1742.037) [-1742.487] -- 0:00:32 547500 -- [-1743.410] (-1741.765) (-1743.553) (-1742.166) * [-1743.515] (-1741.402) (-1743.948) (-1742.386) -- 0:00:32 548000 -- (-1741.529) [-1741.919] (-1744.348) (-1743.473) * (-1743.117) (-1741.885) (-1751.289) [-1742.730] -- 0:00:32 548500 -- (-1745.580) (-1741.556) (-1742.414) [-1744.649] * (-1743.307) [-1741.519] (-1744.777) (-1742.494) -- 0:00:32 549000 -- (-1740.873) [-1740.746] (-1742.466) (-1741.505) * (-1742.141) [-1741.992] (-1742.777) (-1748.340) -- 0:00:32 549500 -- (-1742.959) (-1745.565) [-1741.061] (-1743.507) * (-1743.526) [-1742.320] (-1747.532) (-1747.607) -- 0:00:32 550000 -- [-1741.201] (-1742.617) (-1741.688) (-1741.441) * (-1743.213) (-1743.806) [-1745.339] (-1744.149) -- 0:00:32 Average standard deviation of split frequencies: 0.008913 550500 -- (-1740.881) (-1740.596) (-1744.442) [-1742.202] * [-1742.036] (-1746.683) (-1742.928) (-1743.232) -- 0:00:32 551000 -- (-1741.820) [-1747.251] (-1745.061) (-1743.039) * [-1741.540] (-1741.249) (-1743.318) (-1741.895) -- 0:00:32 551500 -- (-1741.400) [-1745.682] (-1742.370) (-1741.298) * (-1742.019) [-1740.699] (-1743.604) (-1742.265) -- 0:00:32 552000 -- (-1740.726) (-1744.604) (-1741.614) [-1741.008] * (-1741.216) (-1741.119) [-1740.881] (-1744.818) -- 0:00:32 552500 -- (-1742.431) (-1741.853) (-1748.024) [-1740.820] * [-1740.994] (-1742.186) (-1743.517) (-1746.691) -- 0:00:32 553000 -- (-1743.241) (-1742.191) [-1746.298] (-1740.814) * (-1741.280) (-1743.636) [-1743.634] (-1742.646) -- 0:00:32 553500 -- (-1741.029) [-1742.484] (-1741.327) (-1741.533) * [-1742.428] (-1743.326) (-1741.616) (-1742.679) -- 0:00:32 554000 -- (-1742.272) (-1742.334) [-1741.507] (-1749.740) * (-1742.901) (-1741.781) (-1743.693) [-1745.299] -- 0:00:32 554500 -- [-1743.927] (-1742.120) (-1741.060) (-1742.584) * (-1742.255) (-1743.182) (-1745.488) [-1744.167] -- 0:00:32 555000 -- (-1740.538) (-1746.447) (-1742.329) [-1745.391] * (-1742.571) [-1740.668] (-1745.726) (-1744.860) -- 0:00:32 Average standard deviation of split frequencies: 0.009526 555500 -- (-1744.221) (-1743.908) (-1742.382) [-1743.785] * (-1742.430) [-1741.515] (-1743.171) (-1741.170) -- 0:00:32 556000 -- (-1744.114) (-1743.945) (-1741.292) [-1740.788] * (-1747.175) [-1744.218] (-1741.426) (-1740.889) -- 0:00:31 556500 -- (-1744.882) [-1741.803] (-1741.825) (-1740.747) * [-1742.158] (-1743.899) (-1743.982) (-1744.386) -- 0:00:31 557000 -- (-1742.005) (-1743.233) (-1741.526) [-1742.160] * (-1742.443) [-1743.474] (-1746.426) (-1749.179) -- 0:00:31 557500 -- [-1741.082] (-1742.128) (-1742.766) (-1742.408) * (-1743.513) (-1744.375) (-1743.305) [-1741.698] -- 0:00:31 558000 -- (-1745.027) (-1742.101) (-1742.688) [-1741.609] * (-1742.376) (-1740.848) [-1742.545] (-1741.608) -- 0:00:31 558500 -- (-1744.020) (-1746.555) [-1743.179] (-1742.396) * (-1742.194) [-1743.448] (-1741.308) (-1742.045) -- 0:00:31 559000 -- [-1744.231] (-1745.346) (-1743.019) (-1742.509) * (-1741.032) [-1744.134] (-1740.825) (-1740.991) -- 0:00:31 559500 -- (-1742.620) [-1743.330] (-1742.319) (-1743.513) * (-1741.633) (-1741.225) (-1745.115) [-1740.834] -- 0:00:31 560000 -- (-1740.567) (-1742.801) [-1742.556] (-1744.913) * (-1741.486) (-1742.555) [-1740.592] (-1740.691) -- 0:00:31 Average standard deviation of split frequencies: 0.009903 560500 -- [-1742.840] (-1740.708) (-1741.586) (-1743.092) * (-1742.764) [-1742.385] (-1740.592) (-1745.994) -- 0:00:31 561000 -- (-1744.421) [-1741.782] (-1742.685) (-1744.723) * [-1744.324] (-1740.412) (-1746.718) (-1744.989) -- 0:00:31 561500 -- (-1743.324) [-1741.932] (-1741.461) (-1745.494) * (-1742.404) (-1743.918) [-1741.755] (-1743.333) -- 0:00:31 562000 -- [-1742.426] (-1744.527) (-1741.624) (-1744.307) * (-1741.388) (-1745.016) [-1742.194] (-1741.649) -- 0:00:31 562500 -- (-1741.228) [-1742.062] (-1741.795) (-1749.021) * (-1741.056) (-1742.514) [-1741.118] (-1741.300) -- 0:00:31 563000 -- (-1742.666) (-1742.292) [-1742.869] (-1745.390) * [-1742.749] (-1743.121) (-1744.592) (-1741.454) -- 0:00:31 563500 -- [-1741.618] (-1745.153) (-1741.592) (-1744.111) * (-1742.112) [-1742.777] (-1743.041) (-1741.882) -- 0:00:31 564000 -- (-1742.139) (-1743.338) [-1742.426] (-1742.639) * (-1744.354) (-1740.909) [-1740.794] (-1744.903) -- 0:00:31 564500 -- (-1742.951) [-1740.998] (-1744.933) (-1742.891) * (-1744.048) (-1742.127) [-1740.645] (-1743.294) -- 0:00:31 565000 -- [-1743.635] (-1740.937) (-1742.153) (-1742.954) * (-1743.150) [-1743.122] (-1742.519) (-1741.667) -- 0:00:31 Average standard deviation of split frequencies: 0.009902 565500 -- (-1742.452) [-1741.796] (-1742.928) (-1744.549) * (-1741.955) (-1747.722) [-1743.174] (-1747.196) -- 0:00:31 566000 -- (-1742.737) (-1741.832) (-1742.032) [-1744.276] * (-1745.271) (-1743.796) [-1740.630] (-1743.136) -- 0:00:31 566500 -- [-1740.663] (-1742.391) (-1741.847) (-1745.820) * (-1746.853) [-1744.258] (-1742.167) (-1741.470) -- 0:00:31 567000 -- (-1740.489) (-1745.326) (-1743.312) [-1741.407] * (-1743.554) [-1744.039] (-1743.069) (-1741.160) -- 0:00:31 567500 -- [-1740.496] (-1746.851) (-1744.038) (-1741.391) * (-1741.567) (-1743.469) [-1742.969] (-1744.870) -- 0:00:31 568000 -- (-1740.330) (-1744.136) [-1741.905] (-1742.254) * (-1741.920) (-1742.730) (-1742.923) [-1744.376] -- 0:00:31 568500 -- (-1741.910) [-1741.962] (-1742.026) (-1741.881) * (-1741.703) (-1742.297) [-1742.586] (-1741.664) -- 0:00:31 569000 -- (-1742.383) (-1741.905) [-1744.860] (-1741.069) * (-1743.059) [-1744.309] (-1746.942) (-1741.563) -- 0:00:31 569500 -- (-1742.304) [-1742.460] (-1745.449) (-1742.231) * (-1742.079) (-1745.411) (-1746.943) [-1742.028] -- 0:00:30 570000 -- (-1743.601) (-1741.455) (-1744.150) [-1743.736] * (-1742.770) (-1742.936) [-1741.108] (-1747.818) -- 0:00:30 Average standard deviation of split frequencies: 0.009959 570500 -- (-1741.709) (-1742.505) (-1742.607) [-1745.995] * (-1740.946) (-1740.404) [-1741.845] (-1746.517) -- 0:00:30 571000 -- (-1741.682) (-1745.356) (-1749.454) [-1748.644] * (-1741.517) (-1744.926) (-1743.204) [-1744.933] -- 0:00:30 571500 -- (-1744.127) (-1741.898) (-1744.920) [-1747.556] * (-1744.522) [-1741.697] (-1741.797) (-1743.357) -- 0:00:30 572000 -- (-1742.373) (-1740.883) (-1743.431) [-1743.328] * (-1745.985) (-1741.644) (-1741.460) [-1742.535] -- 0:00:30 572500 -- (-1744.266) (-1742.744) (-1746.873) [-1740.982] * (-1741.466) (-1741.054) (-1742.351) [-1743.063] -- 0:00:30 573000 -- (-1746.048) (-1742.231) (-1744.627) [-1743.142] * (-1741.983) (-1742.142) (-1743.965) [-1745.392] -- 0:00:30 573500 -- (-1740.555) (-1743.455) (-1743.979) [-1742.508] * (-1742.377) (-1743.746) (-1741.922) [-1743.736] -- 0:00:30 574000 -- [-1740.369] (-1744.601) (-1744.871) (-1744.930) * (-1742.083) [-1743.411] (-1743.233) (-1746.046) -- 0:00:30 574500 -- [-1741.512] (-1742.900) (-1743.274) (-1742.696) * [-1740.542] (-1747.155) (-1743.396) (-1746.619) -- 0:00:30 575000 -- (-1743.059) (-1741.635) (-1743.815) [-1741.821] * [-1740.636] (-1740.892) (-1741.023) (-1747.522) -- 0:00:30 Average standard deviation of split frequencies: 0.010048 575500 -- (-1746.661) [-1742.401] (-1744.377) (-1742.462) * (-1741.132) (-1740.806) [-1743.820] (-1742.275) -- 0:00:30 576000 -- (-1743.571) (-1748.288) (-1741.616) [-1741.436] * (-1741.246) (-1741.937) (-1742.163) [-1743.722] -- 0:00:30 576500 -- (-1742.066) [-1745.359] (-1742.585) (-1743.437) * (-1740.639) (-1743.377) [-1741.054] (-1748.318) -- 0:00:30 577000 -- (-1741.310) (-1741.687) [-1740.600] (-1741.102) * [-1746.537] (-1741.691) (-1741.462) (-1745.096) -- 0:00:30 577500 -- (-1742.160) (-1742.792) [-1741.659] (-1741.949) * (-1748.938) (-1741.776) (-1741.787) [-1742.595] -- 0:00:30 578000 -- (-1742.821) (-1745.569) [-1741.847] (-1742.332) * (-1742.427) (-1741.671) (-1743.007) [-1741.992] -- 0:00:30 578500 -- [-1743.858] (-1740.716) (-1745.550) (-1745.448) * (-1743.683) [-1741.079] (-1741.926) (-1742.509) -- 0:00:30 579000 -- (-1743.421) (-1740.712) [-1743.735] (-1742.049) * (-1742.421) (-1742.931) [-1743.576] (-1745.235) -- 0:00:30 579500 -- [-1740.989] (-1744.069) (-1745.698) (-1741.898) * [-1740.688] (-1745.880) (-1743.461) (-1741.603) -- 0:00:30 580000 -- (-1741.579) [-1746.266] (-1742.121) (-1741.152) * (-1745.598) [-1741.756] (-1746.911) (-1742.465) -- 0:00:30 Average standard deviation of split frequencies: 0.010373 580500 -- (-1741.824) (-1746.302) [-1744.295] (-1740.662) * [-1742.720] (-1742.082) (-1744.054) (-1742.121) -- 0:00:30 581000 -- (-1741.645) [-1746.391] (-1743.045) (-1741.495) * (-1742.586) (-1741.770) (-1747.688) [-1741.389] -- 0:00:30 581500 -- [-1744.746] (-1746.184) (-1742.574) (-1741.349) * [-1741.826] (-1746.116) (-1741.317) (-1745.109) -- 0:00:30 582000 -- [-1745.756] (-1745.432) (-1741.898) (-1743.626) * [-1742.204] (-1742.641) (-1743.258) (-1743.004) -- 0:00:30 582500 -- [-1742.606] (-1745.259) (-1741.177) (-1743.549) * (-1742.815) [-1743.383] (-1745.758) (-1742.438) -- 0:00:30 583000 -- (-1747.066) (-1746.792) [-1740.958] (-1742.853) * (-1742.003) [-1741.422] (-1743.684) (-1746.521) -- 0:00:30 583500 -- [-1741.972] (-1742.870) (-1740.958) (-1744.143) * (-1742.048) (-1745.401) [-1744.032] (-1742.563) -- 0:00:29 584000 -- [-1742.969] (-1743.264) (-1743.791) (-1746.678) * [-1745.413] (-1742.648) (-1741.210) (-1743.375) -- 0:00:29 584500 -- (-1742.196) (-1744.159) (-1743.155) [-1741.791] * (-1743.803) [-1743.080] (-1744.139) (-1742.187) -- 0:00:29 585000 -- (-1741.838) [-1742.600] (-1746.776) (-1743.387) * (-1742.651) (-1741.855) [-1742.641] (-1744.487) -- 0:00:29 Average standard deviation of split frequencies: 0.010234 585500 -- [-1740.887] (-1741.257) (-1743.685) (-1742.877) * [-1742.541] (-1744.687) (-1742.870) (-1747.259) -- 0:00:29 586000 -- (-1747.482) (-1741.794) [-1743.534] (-1744.722) * (-1744.184) (-1742.960) [-1744.473] (-1740.860) -- 0:00:29 586500 -- (-1742.658) (-1743.038) [-1745.464] (-1741.563) * (-1741.927) (-1743.824) (-1741.710) [-1741.238] -- 0:00:29 587000 -- [-1745.579] (-1741.619) (-1746.602) (-1741.828) * (-1741.684) (-1742.001) (-1741.965) [-1741.369] -- 0:00:29 587500 -- (-1744.527) (-1741.644) (-1742.210) [-1743.469] * (-1741.117) (-1741.934) (-1745.062) [-1742.538] -- 0:00:29 588000 -- (-1743.131) [-1740.795] (-1743.431) (-1743.752) * [-1742.656] (-1742.341) (-1742.225) (-1745.081) -- 0:00:29 588500 -- (-1743.450) (-1741.136) (-1744.953) [-1742.086] * (-1743.635) [-1741.144] (-1742.971) (-1740.749) -- 0:00:29 589000 -- (-1740.410) (-1741.109) [-1741.966] (-1743.585) * (-1741.487) (-1744.044) [-1741.652] (-1741.897) -- 0:00:29 589500 -- (-1742.764) (-1742.543) [-1743.810] (-1743.814) * (-1743.740) [-1744.899] (-1743.659) (-1742.550) -- 0:00:29 590000 -- [-1741.898] (-1743.453) (-1745.788) (-1744.509) * (-1743.478) (-1747.172) [-1741.711] (-1743.842) -- 0:00:29 Average standard deviation of split frequencies: 0.009577 590500 -- (-1744.950) (-1742.882) (-1753.024) [-1742.761] * (-1742.605) [-1742.811] (-1741.560) (-1744.271) -- 0:00:29 591000 -- (-1743.467) [-1742.630] (-1748.176) (-1742.320) * (-1746.813) (-1742.420) (-1741.465) [-1745.667] -- 0:00:29 591500 -- (-1742.922) (-1745.294) [-1740.930] (-1744.436) * [-1748.660] (-1747.049) (-1740.542) (-1743.886) -- 0:00:29 592000 -- [-1742.075] (-1741.961) (-1741.118) (-1742.270) * (-1741.972) (-1743.637) [-1741.028] (-1741.581) -- 0:00:29 592500 -- (-1743.142) [-1741.279] (-1741.896) (-1741.215) * (-1745.971) (-1742.993) [-1742.025] (-1741.563) -- 0:00:29 593000 -- (-1742.535) (-1741.310) [-1741.188] (-1741.948) * (-1741.412) [-1741.637] (-1743.705) (-1741.755) -- 0:00:29 593500 -- (-1743.676) [-1742.344] (-1742.394) (-1742.623) * (-1743.291) [-1741.225] (-1741.447) (-1741.183) -- 0:00:29 594000 -- (-1743.333) (-1740.916) (-1740.589) [-1742.715] * (-1745.342) (-1742.978) [-1742.740] (-1741.604) -- 0:00:29 594500 -- (-1742.007) (-1742.540) (-1741.873) [-1743.564] * (-1743.834) (-1742.054) (-1741.832) [-1741.821] -- 0:00:29 595000 -- [-1740.807] (-1740.911) (-1740.292) (-1742.968) * (-1741.596) (-1742.400) (-1744.106) [-1743.901] -- 0:00:29 Average standard deviation of split frequencies: 0.009366 595500 -- (-1744.146) (-1741.193) [-1740.610] (-1741.633) * [-1743.909] (-1750.541) (-1742.863) (-1744.104) -- 0:00:29 596000 -- (-1744.507) (-1744.349) [-1740.610] (-1744.217) * [-1744.388] (-1740.965) (-1748.340) (-1743.895) -- 0:00:29 596500 -- (-1744.517) (-1743.290) [-1741.406] (-1743.449) * (-1745.007) (-1742.384) (-1743.265) [-1743.570] -- 0:00:29 597000 -- (-1745.192) (-1743.153) [-1744.691] (-1743.654) * (-1746.175) (-1742.547) [-1743.391] (-1741.452) -- 0:00:29 597500 -- (-1742.651) (-1741.836) [-1743.266] (-1742.393) * (-1747.404) (-1741.856) (-1743.077) [-1743.058] -- 0:00:28 598000 -- (-1743.206) (-1742.507) (-1742.478) [-1740.581] * [-1741.843] (-1741.363) (-1744.744) (-1743.335) -- 0:00:28 598500 -- [-1742.033] (-1741.745) (-1742.064) (-1741.145) * (-1743.697) [-1742.421] (-1744.207) (-1743.309) -- 0:00:28 599000 -- (-1746.227) (-1743.290) [-1747.653] (-1741.032) * (-1741.625) (-1742.496) (-1747.738) [-1742.151] -- 0:00:28 599500 -- (-1744.152) (-1743.180) (-1748.761) [-1746.110] * (-1742.116) [-1743.743] (-1744.519) (-1741.392) -- 0:00:28 600000 -- (-1747.741) [-1741.172] (-1747.197) (-1744.573) * [-1741.944] (-1741.161) (-1749.190) (-1742.710) -- 0:00:28 Average standard deviation of split frequencies: 0.009243 600500 -- (-1741.037) [-1741.600] (-1751.663) (-1745.840) * (-1741.368) (-1742.158) [-1744.369] (-1744.746) -- 0:00:28 601000 -- (-1741.419) (-1741.319) (-1744.539) [-1744.667] * (-1741.398) (-1741.978) (-1743.571) [-1742.096] -- 0:00:28 601500 -- (-1740.728) [-1742.062] (-1744.907) (-1744.356) * (-1743.952) [-1742.264] (-1746.694) (-1741.985) -- 0:00:28 602000 -- [-1740.728] (-1741.814) (-1743.266) (-1741.000) * (-1744.656) (-1741.878) (-1744.184) [-1741.879] -- 0:00:28 602500 -- (-1743.264) [-1741.657] (-1742.575) (-1745.180) * (-1744.376) (-1742.696) (-1742.457) [-1741.834] -- 0:00:28 603000 -- (-1746.038) (-1743.365) (-1741.538) [-1751.254] * (-1744.640) (-1743.410) (-1743.467) [-1741.026] -- 0:00:28 603500 -- (-1743.444) (-1740.695) [-1743.436] (-1742.996) * [-1742.394] (-1742.253) (-1741.728) (-1742.078) -- 0:00:28 604000 -- (-1742.469) (-1740.576) [-1743.223] (-1746.041) * [-1742.913] (-1742.503) (-1740.976) (-1741.126) -- 0:00:28 604500 -- [-1743.793] (-1745.417) (-1741.880) (-1743.438) * (-1742.933) [-1741.259] (-1744.852) (-1741.784) -- 0:00:28 605000 -- (-1741.358) (-1740.748) [-1741.241] (-1744.893) * (-1743.758) [-1742.120] (-1743.206) (-1743.466) -- 0:00:28 Average standard deviation of split frequencies: 0.008925 605500 -- [-1741.765] (-1742.528) (-1742.110) (-1741.922) * (-1743.469) (-1743.641) [-1741.006] (-1745.158) -- 0:00:28 606000 -- (-1742.189) [-1741.231] (-1742.165) (-1741.607) * [-1743.269] (-1742.691) (-1741.116) (-1743.905) -- 0:00:28 606500 -- (-1741.711) (-1741.373) [-1741.501] (-1745.448) * (-1743.375) (-1744.417) (-1741.302) [-1742.658] -- 0:00:28 607000 -- (-1746.888) (-1744.736) [-1742.653] (-1743.925) * (-1744.484) [-1740.972] (-1741.059) (-1741.451) -- 0:00:28 607500 -- [-1743.217] (-1745.728) (-1746.862) (-1748.277) * (-1744.399) (-1741.449) (-1743.548) [-1740.489] -- 0:00:28 608000 -- [-1742.082] (-1743.926) (-1742.493) (-1744.992) * (-1745.914) (-1741.416) (-1741.464) [-1741.232] -- 0:00:28 608500 -- [-1741.392] (-1743.340) (-1742.050) (-1745.668) * (-1746.616) (-1746.880) [-1742.515] (-1743.354) -- 0:00:28 609000 -- [-1740.336] (-1744.226) (-1742.558) (-1741.612) * (-1749.782) [-1741.525] (-1744.306) (-1745.248) -- 0:00:28 609500 -- [-1740.969] (-1744.249) (-1744.033) (-1744.366) * (-1746.849) (-1740.846) (-1742.387) [-1744.582] -- 0:00:28 610000 -- [-1741.238] (-1745.270) (-1741.334) (-1744.972) * (-1741.702) (-1741.235) [-1741.776] (-1746.580) -- 0:00:28 Average standard deviation of split frequencies: 0.009020 610500 -- [-1740.427] (-1743.433) (-1741.000) (-1741.210) * [-1741.276] (-1742.967) (-1743.605) (-1742.436) -- 0:00:28 611000 -- [-1743.838] (-1743.004) (-1740.682) (-1742.352) * (-1741.661) [-1741.424] (-1745.389) (-1746.887) -- 0:00:28 611500 -- (-1740.804) (-1742.017) [-1741.404] (-1744.310) * (-1745.316) [-1740.778] (-1741.348) (-1743.310) -- 0:00:27 612000 -- [-1741.459] (-1743.340) (-1742.328) (-1742.271) * (-1743.647) (-1741.019) [-1747.091] (-1744.494) -- 0:00:27 612500 -- (-1741.785) [-1744.744] (-1743.150) (-1742.732) * [-1745.689] (-1742.571) (-1746.093) (-1742.384) -- 0:00:27 613000 -- (-1744.553) (-1746.101) (-1743.819) [-1741.251] * (-1742.922) (-1741.197) [-1744.415] (-1742.422) -- 0:00:27 613500 -- (-1742.150) (-1740.527) [-1745.141] (-1743.543) * (-1744.883) (-1745.124) (-1742.622) [-1742.241] -- 0:00:27 614000 -- [-1742.170] (-1740.885) (-1742.305) (-1743.856) * [-1748.513] (-1749.477) (-1742.761) (-1743.172) -- 0:00:27 614500 -- [-1743.955] (-1743.423) (-1742.128) (-1741.769) * [-1741.716] (-1744.854) (-1741.330) (-1740.629) -- 0:00:27 615000 -- (-1743.610) (-1745.295) [-1741.986] (-1741.159) * (-1742.407) (-1743.107) [-1743.001] (-1741.377) -- 0:00:27 Average standard deviation of split frequencies: 0.009344 615500 -- (-1743.754) (-1743.268) (-1741.707) [-1743.805] * (-1742.675) [-1741.995] (-1741.300) (-1741.227) -- 0:00:27 616000 -- [-1743.573] (-1745.105) (-1742.782) (-1745.394) * (-1744.668) [-1746.710] (-1744.087) (-1741.187) -- 0:00:27 616500 -- (-1741.724) [-1742.366] (-1743.259) (-1746.110) * (-1746.556) [-1742.701] (-1743.659) (-1741.817) -- 0:00:27 617000 -- (-1741.208) (-1743.268) (-1744.143) [-1741.683] * [-1741.183] (-1742.557) (-1745.701) (-1742.104) -- 0:00:27 617500 -- (-1741.483) [-1741.138] (-1742.550) (-1743.792) * [-1741.800] (-1743.882) (-1743.939) (-1742.069) -- 0:00:27 618000 -- [-1743.345] (-1741.686) (-1746.950) (-1743.097) * (-1742.335) (-1741.841) (-1743.372) [-1742.965] -- 0:00:27 618500 -- [-1740.702] (-1748.450) (-1744.288) (-1741.863) * (-1745.943) [-1746.551] (-1743.158) (-1742.314) -- 0:00:27 619000 -- [-1740.748] (-1741.339) (-1745.740) (-1747.255) * (-1742.337) (-1742.778) [-1744.320] (-1743.804) -- 0:00:27 619500 -- (-1742.178) [-1741.342] (-1744.990) (-1742.687) * [-1742.450] (-1741.828) (-1741.829) (-1742.753) -- 0:00:27 620000 -- (-1742.194) [-1744.035] (-1743.818) (-1742.715) * (-1747.657) [-1741.900] (-1741.081) (-1742.890) -- 0:00:27 Average standard deviation of split frequencies: 0.010193 620500 -- [-1741.925] (-1742.578) (-1742.038) (-1742.796) * (-1743.180) (-1742.310) [-1741.081] (-1741.198) -- 0:00:27 621000 -- (-1740.919) (-1741.042) [-1741.851] (-1741.229) * (-1742.533) (-1745.622) (-1744.310) [-1746.416] -- 0:00:27 621500 -- (-1740.944) [-1745.454] (-1745.428) (-1747.987) * [-1742.547] (-1746.800) (-1742.069) (-1742.525) -- 0:00:27 622000 -- (-1740.929) (-1744.974) [-1741.883] (-1744.033) * (-1740.927) (-1745.685) [-1741.058] (-1741.428) -- 0:00:27 622500 -- (-1744.305) (-1740.859) (-1741.554) [-1742.821] * (-1741.723) (-1743.813) [-1741.267] (-1741.916) -- 0:00:27 623000 -- (-1741.231) (-1741.016) [-1743.432] (-1740.688) * (-1746.603) (-1744.907) [-1741.267] (-1742.065) -- 0:00:27 623500 -- (-1743.557) (-1742.140) [-1742.529] (-1743.663) * (-1744.898) [-1742.894] (-1743.660) (-1742.900) -- 0:00:27 624000 -- (-1741.320) (-1745.481) (-1742.752) [-1742.197] * (-1742.633) (-1742.032) [-1742.240] (-1742.528) -- 0:00:27 624500 -- [-1740.717] (-1742.595) (-1741.519) (-1742.182) * (-1742.738) (-1743.184) [-1741.652] (-1743.551) -- 0:00:27 625000 -- (-1744.705) [-1741.902] (-1744.346) (-1743.881) * (-1740.360) (-1743.275) (-1740.697) [-1741.345] -- 0:00:27 Average standard deviation of split frequencies: 0.008953 625500 -- (-1743.129) (-1744.084) [-1741.126] (-1746.893) * (-1741.111) (-1742.923) (-1742.616) [-1741.239] -- 0:00:26 626000 -- (-1742.714) [-1742.795] (-1742.232) (-1742.418) * (-1744.596) (-1742.606) [-1743.662] (-1742.494) -- 0:00:26 626500 -- (-1746.089) (-1748.513) (-1745.797) [-1741.737] * [-1744.815] (-1740.592) (-1740.822) (-1741.839) -- 0:00:26 627000 -- (-1742.186) (-1740.957) [-1745.593] (-1740.876) * [-1744.415] (-1740.502) (-1742.046) (-1747.704) -- 0:00:26 627500 -- (-1741.758) (-1741.086) [-1748.595] (-1741.167) * (-1744.583) (-1742.040) (-1741.281) [-1741.926] -- 0:00:26 628000 -- (-1743.162) [-1742.742] (-1742.828) (-1741.398) * (-1741.540) (-1740.467) [-1741.291] (-1741.007) -- 0:00:26 628500 -- [-1741.634] (-1744.722) (-1743.466) (-1741.299) * [-1742.482] (-1743.060) (-1743.561) (-1742.791) -- 0:00:26 629000 -- [-1742.577] (-1743.131) (-1741.639) (-1741.579) * (-1742.627) (-1742.165) (-1743.254) [-1741.266] -- 0:00:26 629500 -- [-1741.713] (-1742.668) (-1742.225) (-1744.417) * (-1742.046) (-1743.158) (-1742.416) [-1741.933] -- 0:00:26 630000 -- (-1742.133) (-1743.176) [-1743.450] (-1743.638) * (-1745.775) [-1741.969] (-1740.964) (-1744.875) -- 0:00:26 Average standard deviation of split frequencies: 0.008928 630500 -- (-1743.654) (-1741.792) (-1744.004) [-1743.398] * (-1741.985) (-1741.814) (-1747.559) [-1742.158] -- 0:00:26 631000 -- (-1745.650) [-1741.471] (-1743.648) (-1749.758) * (-1742.662) (-1744.224) (-1741.539) [-1744.485] -- 0:00:26 631500 -- (-1748.127) (-1745.110) (-1740.683) [-1746.732] * (-1742.627) (-1741.701) (-1741.921) [-1744.737] -- 0:00:26 632000 -- (-1742.309) (-1741.198) [-1742.603] (-1744.209) * (-1744.669) [-1742.546] (-1743.710) (-1743.665) -- 0:00:26 632500 -- [-1741.986] (-1744.006) (-1743.693) (-1741.251) * (-1741.263) (-1744.627) [-1743.286] (-1743.584) -- 0:00:26 633000 -- [-1743.224] (-1745.620) (-1745.769) (-1742.315) * (-1740.608) (-1742.990) [-1741.831] (-1742.427) -- 0:00:26 633500 -- (-1744.274) [-1744.643] (-1743.254) (-1741.590) * [-1744.714] (-1743.977) (-1743.520) (-1743.169) -- 0:00:26 634000 -- (-1741.683) (-1746.469) [-1741.714] (-1741.637) * [-1742.347] (-1743.038) (-1741.460) (-1741.568) -- 0:00:26 634500 -- (-1742.075) [-1742.667] (-1743.795) (-1742.517) * (-1741.631) (-1743.319) [-1741.257] (-1742.639) -- 0:00:26 635000 -- (-1741.611) (-1744.029) (-1745.005) [-1741.108] * [-1743.468] (-1741.774) (-1746.766) (-1741.662) -- 0:00:26 Average standard deviation of split frequencies: 0.008894 635500 -- (-1746.134) (-1741.766) (-1742.438) [-1742.080] * (-1744.154) [-1742.271] (-1740.434) (-1741.337) -- 0:00:26 636000 -- [-1741.855] (-1740.885) (-1741.757) (-1743.814) * [-1742.344] (-1742.856) (-1741.423) (-1744.813) -- 0:00:26 636500 -- (-1742.440) (-1741.020) (-1741.692) [-1742.174] * [-1741.884] (-1743.276) (-1744.795) (-1745.573) -- 0:00:26 637000 -- (-1742.175) (-1745.881) (-1742.599) [-1740.887] * (-1740.545) (-1744.385) [-1745.937] (-1741.733) -- 0:00:26 637500 -- [-1741.108] (-1742.364) (-1741.453) (-1742.860) * (-1740.978) [-1745.016] (-1743.061) (-1741.687) -- 0:00:26 638000 -- (-1741.355) [-1741.054] (-1744.899) (-1741.855) * (-1743.192) [-1742.492] (-1745.635) (-1741.554) -- 0:00:26 638500 -- (-1741.441) [-1742.429] (-1746.655) (-1741.362) * [-1743.239] (-1746.382) (-1743.009) (-1742.256) -- 0:00:26 639000 -- (-1745.855) (-1745.040) (-1742.538) [-1742.509] * (-1742.195) [-1744.177] (-1745.135) (-1741.362) -- 0:00:25 639500 -- (-1746.161) (-1744.141) (-1742.898) [-1743.596] * (-1742.555) [-1744.454] (-1742.103) (-1742.684) -- 0:00:25 640000 -- (-1744.442) (-1742.027) (-1742.600) [-1741.290] * (-1742.061) (-1745.745) [-1745.136] (-1742.889) -- 0:00:25 Average standard deviation of split frequencies: 0.008916 640500 -- (-1742.829) [-1743.621] (-1746.546) (-1740.842) * (-1748.767) (-1742.375) [-1743.145] (-1742.758) -- 0:00:25 641000 -- (-1742.368) [-1741.349] (-1743.344) (-1742.882) * (-1742.943) [-1741.614] (-1741.732) (-1741.640) -- 0:00:25 641500 -- (-1740.823) [-1741.907] (-1742.445) (-1743.915) * (-1742.938) (-1741.839) (-1741.937) [-1745.031] -- 0:00:25 642000 -- (-1742.117) (-1741.235) (-1744.582) [-1742.700] * (-1740.757) (-1744.769) (-1741.440) [-1742.970] -- 0:00:25 642500 -- (-1742.971) (-1742.504) (-1744.386) [-1742.550] * (-1741.456) [-1750.892] (-1741.149) (-1746.751) -- 0:00:25 643000 -- (-1743.910) (-1743.011) [-1741.240] (-1740.997) * [-1742.437] (-1746.242) (-1742.664) (-1746.396) -- 0:00:25 643500 -- (-1741.853) (-1744.661) (-1743.739) [-1742.267] * (-1741.058) (-1747.916) (-1742.954) [-1743.775] -- 0:00:25 644000 -- (-1741.217) (-1742.156) [-1741.516] (-1746.782) * [-1743.970] (-1745.578) (-1746.357) (-1744.702) -- 0:00:25 644500 -- (-1743.381) (-1743.121) [-1741.731] (-1741.931) * [-1744.136] (-1741.418) (-1740.837) (-1746.230) -- 0:00:25 645000 -- (-1741.039) [-1742.056] (-1740.616) (-1741.263) * (-1744.316) (-1741.746) [-1742.281] (-1746.536) -- 0:00:25 Average standard deviation of split frequencies: 0.008413 645500 -- [-1743.061] (-1744.140) (-1742.221) (-1740.518) * (-1742.815) (-1743.171) (-1742.063) [-1741.280] -- 0:00:25 646000 -- [-1742.280] (-1745.938) (-1742.218) (-1740.498) * (-1744.137) (-1741.152) [-1742.538] (-1740.546) -- 0:00:25 646500 -- (-1742.360) (-1740.955) (-1741.525) [-1742.539] * (-1741.671) [-1741.113] (-1740.490) (-1742.259) -- 0:00:25 647000 -- [-1741.225] (-1740.799) (-1742.553) (-1741.390) * (-1741.907) (-1741.573) [-1741.434] (-1743.883) -- 0:00:25 647500 -- (-1741.163) (-1740.916) (-1741.634) [-1742.503] * [-1742.317] (-1742.529) (-1743.005) (-1743.302) -- 0:00:25 648000 -- [-1740.937] (-1742.753) (-1742.177) (-1741.309) * [-1741.778] (-1742.934) (-1743.691) (-1744.006) -- 0:00:25 648500 -- (-1743.281) (-1744.550) (-1742.563) [-1740.996] * (-1741.205) [-1741.399] (-1743.691) (-1742.086) -- 0:00:25 649000 -- (-1744.850) (-1744.326) [-1742.376] (-1742.671) * [-1742.209] (-1742.138) (-1741.456) (-1742.685) -- 0:00:25 649500 -- (-1744.655) (-1744.403) [-1742.678] (-1741.072) * (-1741.906) (-1743.282) [-1742.153] (-1749.137) -- 0:00:25 650000 -- (-1744.871) (-1744.401) (-1741.262) [-1743.006] * (-1740.978) (-1742.748) [-1741.694] (-1748.448) -- 0:00:25 Average standard deviation of split frequencies: 0.008050 650500 -- (-1741.735) [-1743.834] (-1742.614) (-1742.757) * (-1741.213) [-1740.993] (-1742.209) (-1743.505) -- 0:00:25 651000 -- (-1743.155) (-1740.928) [-1742.025] (-1742.084) * (-1743.544) (-1741.997) [-1743.278] (-1745.773) -- 0:00:25 651500 -- (-1743.816) [-1740.934] (-1742.586) (-1741.579) * (-1740.922) [-1742.543] (-1742.469) (-1742.419) -- 0:00:25 652000 -- (-1741.721) (-1741.123) [-1744.775] (-1741.063) * (-1742.647) [-1741.797] (-1742.428) (-1741.835) -- 0:00:25 652500 -- (-1744.055) [-1744.042] (-1743.803) (-1741.910) * [-1743.642] (-1741.431) (-1743.302) (-1745.192) -- 0:00:25 653000 -- [-1741.634] (-1742.346) (-1743.054) (-1745.987) * (-1745.142) [-1741.414] (-1742.980) (-1748.237) -- 0:00:24 653500 -- (-1743.190) [-1744.064] (-1741.188) (-1741.016) * (-1742.851) [-1741.577] (-1741.126) (-1742.082) -- 0:00:24 654000 -- (-1742.741) (-1744.882) [-1741.589] (-1742.482) * (-1743.474) [-1743.554] (-1741.509) (-1743.508) -- 0:00:24 654500 -- (-1742.370) (-1743.256) [-1742.534] (-1742.414) * (-1740.855) (-1744.481) (-1741.201) [-1741.283] -- 0:00:24 655000 -- (-1744.822) (-1743.068) [-1741.017] (-1741.905) * (-1742.118) (-1742.372) (-1741.108) [-1742.882] -- 0:00:24 Average standard deviation of split frequencies: 0.008424 655500 -- (-1741.057) (-1743.456) (-1747.300) [-1744.158] * [-1742.212] (-1742.370) (-1748.012) (-1747.729) -- 0:00:24 656000 -- (-1745.226) (-1743.327) (-1742.140) [-1742.372] * (-1742.759) (-1742.561) [-1741.773] (-1747.960) -- 0:00:24 656500 -- (-1743.000) (-1743.917) (-1740.966) [-1742.721] * (-1742.778) (-1744.924) (-1741.344) [-1743.093] -- 0:00:24 657000 -- (-1742.551) [-1744.472] (-1742.319) (-1742.912) * [-1741.669] (-1744.515) (-1742.330) (-1741.757) -- 0:00:24 657500 -- [-1741.294] (-1745.331) (-1741.385) (-1741.669) * (-1741.869) [-1743.593] (-1743.770) (-1744.771) -- 0:00:24 658000 -- (-1741.259) [-1741.243] (-1743.429) (-1746.282) * [-1741.520] (-1743.375) (-1743.094) (-1743.421) -- 0:00:24 658500 -- (-1741.289) (-1745.839) (-1742.827) [-1743.631] * [-1743.470] (-1742.552) (-1744.807) (-1744.268) -- 0:00:24 659000 -- [-1741.436] (-1743.761) (-1742.890) (-1745.433) * [-1742.026] (-1742.563) (-1742.511) (-1746.177) -- 0:00:24 659500 -- (-1742.993) (-1744.490) [-1741.687] (-1743.996) * (-1741.705) (-1742.156) [-1741.243] (-1750.468) -- 0:00:24 660000 -- (-1743.949) (-1745.616) (-1746.641) [-1749.193] * (-1743.094) [-1742.461] (-1745.839) (-1741.622) -- 0:00:24 Average standard deviation of split frequencies: 0.008898 660500 -- (-1743.203) (-1746.042) (-1743.871) [-1744.531] * (-1742.783) (-1742.123) (-1743.859) [-1740.890] -- 0:00:24 661000 -- (-1740.538) [-1742.576] (-1742.330) (-1743.532) * (-1742.896) [-1741.112] (-1742.565) (-1742.890) -- 0:00:24 661500 -- (-1743.419) [-1741.671] (-1744.039) (-1743.073) * (-1743.932) (-1743.171) [-1742.592] (-1741.576) -- 0:00:24 662000 -- [-1741.243] (-1744.711) (-1745.716) (-1741.703) * (-1744.236) (-1743.005) [-1744.092] (-1745.349) -- 0:00:24 662500 -- (-1746.692) (-1747.772) (-1741.698) [-1740.432] * [-1741.030] (-1741.553) (-1742.935) (-1741.493) -- 0:00:24 663000 -- [-1744.052] (-1747.364) (-1743.249) (-1741.609) * (-1742.508) (-1741.191) (-1742.332) [-1742.075] -- 0:00:24 663500 -- (-1743.826) (-1747.246) [-1742.599] (-1743.234) * (-1743.742) (-1742.690) [-1740.754] (-1745.553) -- 0:00:24 664000 -- [-1743.931] (-1741.481) (-1741.731) (-1742.452) * (-1743.634) [-1741.536] (-1745.568) (-1745.434) -- 0:00:24 664500 -- [-1741.341] (-1743.434) (-1741.028) (-1743.030) * (-1742.595) [-1742.255] (-1743.172) (-1742.438) -- 0:00:24 665000 -- (-1742.291) (-1744.825) [-1741.289] (-1743.965) * (-1744.342) (-1741.137) [-1740.556] (-1742.076) -- 0:00:24 Average standard deviation of split frequencies: 0.008660 665500 -- (-1741.403) (-1744.509) (-1741.951) [-1741.396] * (-1741.744) (-1743.953) (-1741.410) [-1742.816] -- 0:00:24 666000 -- (-1742.576) (-1743.293) (-1742.448) [-1742.029] * (-1743.813) (-1746.262) (-1741.142) [-1743.210] -- 0:00:24 666500 -- (-1742.994) [-1745.074] (-1745.470) (-1743.169) * (-1744.729) (-1742.667) [-1743.749] (-1742.543) -- 0:00:24 667000 -- (-1742.771) [-1743.549] (-1747.612) (-1745.522) * [-1742.648] (-1740.822) (-1744.925) (-1741.639) -- 0:00:23 667500 -- [-1741.508] (-1741.490) (-1746.383) (-1744.198) * (-1742.759) (-1744.422) [-1741.096] (-1740.869) -- 0:00:23 668000 -- [-1741.932] (-1744.065) (-1743.506) (-1744.485) * (-1741.509) (-1745.581) (-1741.320) [-1743.643] -- 0:00:23 668500 -- [-1741.461] (-1745.244) (-1744.224) (-1742.133) * (-1741.238) [-1743.487] (-1741.979) (-1741.949) -- 0:00:23 669000 -- (-1742.382) (-1743.030) (-1742.382) [-1745.370] * (-1740.904) [-1744.036] (-1742.379) (-1741.047) -- 0:00:23 669500 -- [-1742.551] (-1741.195) (-1741.112) (-1743.993) * (-1742.670) (-1743.167) [-1740.635] (-1741.047) -- 0:00:23 670000 -- (-1740.984) (-1741.664) [-1742.380] (-1747.341) * [-1740.809] (-1743.078) (-1742.421) (-1740.867) -- 0:00:23 Average standard deviation of split frequencies: 0.008435 670500 -- (-1741.429) (-1743.530) [-1742.649] (-1744.022) * (-1742.142) [-1741.170] (-1741.509) (-1745.396) -- 0:00:23 671000 -- [-1742.111] (-1743.929) (-1742.188) (-1746.002) * (-1744.829) (-1741.162) [-1742.196] (-1745.425) -- 0:00:23 671500 -- (-1741.300) [-1742.787] (-1740.906) (-1742.640) * (-1742.199) [-1744.751] (-1741.423) (-1743.895) -- 0:00:23 672000 -- (-1741.548) [-1741.663] (-1742.581) (-1745.998) * (-1742.379) [-1746.657] (-1741.772) (-1748.128) -- 0:00:23 672500 -- (-1742.860) [-1741.545] (-1741.379) (-1743.375) * [-1741.304] (-1741.499) (-1743.344) (-1747.776) -- 0:00:23 673000 -- (-1744.647) [-1742.053] (-1746.600) (-1742.450) * (-1742.222) [-1742.269] (-1741.424) (-1742.382) -- 0:00:23 673500 -- (-1743.295) (-1747.265) (-1742.852) [-1743.184] * [-1743.506] (-1750.438) (-1741.835) (-1744.826) -- 0:00:23 674000 -- (-1741.752) (-1744.208) [-1741.815] (-1742.481) * (-1743.636) (-1747.022) [-1742.396] (-1745.268) -- 0:00:23 674500 -- (-1742.006) (-1741.457) [-1742.009] (-1744.109) * [-1743.314] (-1748.318) (-1742.918) (-1741.696) -- 0:00:23 675000 -- (-1741.226) (-1741.602) [-1743.891] (-1742.676) * [-1741.710] (-1750.243) (-1742.746) (-1742.259) -- 0:00:23 Average standard deviation of split frequencies: 0.008655 675500 -- (-1742.716) [-1740.980] (-1741.877) (-1741.147) * (-1741.541) [-1743.656] (-1743.152) (-1742.337) -- 0:00:23 676000 -- (-1742.125) (-1741.506) [-1741.595] (-1743.696) * (-1744.786) (-1744.507) (-1744.452) [-1740.833] -- 0:00:23 676500 -- (-1742.037) (-1740.854) (-1743.159) [-1742.667] * [-1741.493] (-1744.590) (-1741.903) (-1743.956) -- 0:00:23 677000 -- (-1743.726) (-1741.339) [-1741.271] (-1741.101) * (-1741.585) [-1744.380] (-1742.736) (-1744.070) -- 0:00:23 677500 -- (-1741.705) (-1741.934) [-1741.215] (-1742.763) * (-1742.282) (-1745.345) (-1743.046) [-1743.932] -- 0:00:23 678000 -- (-1742.834) [-1741.709] (-1744.765) (-1741.838) * [-1742.941] (-1744.501) (-1744.351) (-1747.510) -- 0:00:23 678500 -- (-1744.129) (-1743.600) [-1744.275] (-1744.442) * (-1741.509) [-1742.630] (-1742.993) (-1743.941) -- 0:00:23 679000 -- (-1742.891) [-1742.325] (-1743.445) (-1745.529) * (-1744.596) (-1743.845) (-1748.173) [-1742.759] -- 0:00:23 679500 -- (-1741.776) (-1742.397) (-1743.263) [-1741.160] * (-1741.831) [-1741.026] (-1743.542) (-1743.365) -- 0:00:23 680000 -- (-1740.976) (-1747.848) (-1745.678) [-1743.506] * (-1745.922) [-1741.381] (-1741.750) (-1741.914) -- 0:00:23 Average standard deviation of split frequencies: 0.008963 680500 -- (-1741.341) (-1743.248) [-1741.134] (-1742.410) * (-1741.637) (-1743.890) [-1742.749] (-1742.596) -- 0:00:23 681000 -- (-1741.421) (-1742.636) [-1741.637] (-1745.011) * (-1741.334) (-1742.246) (-1743.998) [-1742.100] -- 0:00:22 681500 -- (-1743.205) (-1743.500) [-1741.190] (-1745.534) * (-1744.572) (-1742.581) (-1743.131) [-1742.135] -- 0:00:22 682000 -- (-1741.498) (-1743.169) [-1744.148] (-1745.306) * (-1742.296) (-1744.494) [-1742.604] (-1742.192) -- 0:00:22 682500 -- [-1741.462] (-1744.706) (-1742.313) (-1745.546) * (-1745.862) (-1744.120) [-1743.126] (-1740.314) -- 0:00:22 683000 -- [-1741.881] (-1742.856) (-1743.706) (-1743.713) * (-1745.027) (-1742.993) [-1742.405] (-1744.712) -- 0:00:22 683500 -- (-1743.046) (-1741.408) [-1751.862] (-1742.917) * (-1742.261) (-1742.563) [-1743.118] (-1741.449) -- 0:00:22 684000 -- (-1743.065) [-1740.395] (-1743.944) (-1742.376) * (-1743.989) [-1748.815] (-1743.137) (-1742.599) -- 0:00:22 684500 -- (-1740.751) [-1741.158] (-1742.412) (-1745.036) * [-1741.210] (-1745.224) (-1743.999) (-1743.768) -- 0:00:22 685000 -- [-1740.718] (-1741.308) (-1742.148) (-1744.346) * (-1741.840) [-1746.335] (-1745.423) (-1744.087) -- 0:00:22 Average standard deviation of split frequencies: 0.008933 685500 -- [-1741.028] (-1741.820) (-1744.031) (-1745.422) * (-1741.402) [-1745.035] (-1745.702) (-1745.338) -- 0:00:22 686000 -- [-1741.883] (-1742.155) (-1742.921) (-1742.278) * (-1743.362) (-1742.406) [-1741.676] (-1744.457) -- 0:00:22 686500 -- [-1742.410] (-1742.541) (-1744.504) (-1743.407) * (-1742.076) (-1742.936) [-1740.503] (-1743.608) -- 0:00:22 687000 -- [-1742.682] (-1744.434) (-1746.214) (-1740.958) * (-1741.860) [-1744.805] (-1749.262) (-1742.635) -- 0:00:22 687500 -- (-1744.651) [-1745.237] (-1741.203) (-1741.412) * [-1741.564] (-1745.735) (-1746.310) (-1741.149) -- 0:00:22 688000 -- [-1744.577] (-1743.073) (-1741.850) (-1741.096) * (-1743.809) [-1742.433] (-1747.134) (-1741.709) -- 0:00:22 688500 -- (-1741.396) (-1741.748) [-1744.075] (-1741.103) * (-1741.211) (-1743.659) (-1743.183) [-1741.953] -- 0:00:22 689000 -- (-1743.141) (-1741.669) (-1742.893) [-1741.708] * (-1741.398) (-1751.064) (-1744.497) [-1741.157] -- 0:00:22 689500 -- (-1741.513) (-1742.297) [-1742.105] (-1744.352) * (-1742.952) (-1746.686) [-1741.334] (-1741.248) -- 0:00:22 690000 -- (-1742.236) (-1741.921) (-1741.892) [-1743.468] * (-1742.859) [-1744.767] (-1741.766) (-1745.756) -- 0:00:22 Average standard deviation of split frequencies: 0.008753 690500 -- [-1742.229] (-1741.349) (-1746.059) (-1744.443) * (-1741.205) (-1745.147) [-1742.172] (-1741.545) -- 0:00:22 691000 -- (-1742.807) (-1744.016) (-1743.042) [-1742.463] * (-1741.993) (-1741.660) (-1743.850) [-1742.658] -- 0:00:22 691500 -- (-1741.498) (-1744.304) [-1742.330] (-1747.498) * [-1741.355] (-1744.991) (-1743.341) (-1743.020) -- 0:00:22 692000 -- [-1740.982] (-1741.939) (-1741.909) (-1746.305) * (-1744.999) [-1743.055] (-1744.046) (-1749.085) -- 0:00:22 692500 -- [-1741.685] (-1742.402) (-1741.633) (-1746.707) * (-1740.886) [-1742.303] (-1744.382) (-1742.317) -- 0:00:22 693000 -- (-1742.161) (-1743.242) [-1742.341] (-1745.065) * (-1740.766) (-1741.388) [-1742.738] (-1746.125) -- 0:00:22 693500 -- [-1744.074] (-1745.357) (-1745.106) (-1745.670) * (-1741.030) [-1746.744] (-1742.188) (-1741.189) -- 0:00:22 694000 -- (-1744.868) (-1745.178) (-1741.640) [-1744.618] * [-1741.710] (-1744.872) (-1746.077) (-1743.351) -- 0:00:22 694500 -- (-1741.178) (-1741.915) [-1743.592] (-1744.248) * (-1741.336) [-1740.818] (-1740.742) (-1741.136) -- 0:00:21 695000 -- [-1741.632] (-1741.213) (-1743.480) (-1742.206) * (-1742.291) [-1742.805] (-1741.043) (-1743.016) -- 0:00:21 Average standard deviation of split frequencies: 0.008885 695500 -- (-1743.867) (-1742.788) (-1742.187) [-1741.638] * (-1741.382) (-1743.406) [-1741.224] (-1743.134) -- 0:00:21 696000 -- (-1743.481) (-1740.771) (-1745.368) [-1742.680] * (-1741.878) [-1743.488] (-1742.745) (-1742.637) -- 0:00:21 696500 -- [-1747.472] (-1741.660) (-1742.457) (-1742.599) * (-1741.053) (-1744.435) (-1744.445) [-1742.228] -- 0:00:21 697000 -- [-1744.915] (-1741.002) (-1740.813) (-1745.897) * (-1747.153) (-1741.612) (-1751.529) [-1743.552] -- 0:00:21 697500 -- (-1745.014) [-1741.250] (-1740.629) (-1742.990) * (-1746.420) [-1742.324] (-1749.793) (-1744.103) -- 0:00:21 698000 -- (-1743.171) (-1742.924) (-1742.560) [-1741.176] * (-1744.081) (-1742.531) (-1747.300) [-1747.458] -- 0:00:21 698500 -- (-1750.996) (-1745.542) [-1741.478] (-1742.300) * (-1749.096) (-1742.922) (-1743.230) [-1742.418] -- 0:00:21 699000 -- (-1742.939) (-1743.350) (-1742.941) [-1742.491] * [-1742.951] (-1743.377) (-1744.061) (-1741.662) -- 0:00:21 699500 -- (-1741.020) (-1742.595) (-1742.510) [-1742.341] * (-1742.428) (-1740.793) (-1741.530) [-1741.135] -- 0:00:21 700000 -- (-1742.413) [-1741.404] (-1742.233) (-1743.268) * (-1740.626) [-1741.790] (-1742.458) (-1740.818) -- 0:00:21 Average standard deviation of split frequencies: 0.009577 700500 -- [-1746.687] (-1745.661) (-1742.712) (-1743.155) * (-1741.849) (-1741.673) [-1742.021] (-1742.616) -- 0:00:21 701000 -- (-1742.684) (-1744.788) [-1741.118] (-1741.590) * (-1743.387) [-1740.377] (-1741.649) (-1741.562) -- 0:00:21 701500 -- [-1743.212] (-1741.396) (-1742.210) (-1741.825) * (-1743.353) (-1742.795) [-1742.528] (-1741.959) -- 0:00:21 702000 -- (-1743.806) (-1741.444) [-1742.710] (-1741.804) * (-1744.026) (-1743.387) [-1744.829] (-1744.862) -- 0:00:21 702500 -- (-1748.596) (-1745.560) (-1744.125) [-1742.073] * (-1742.740) [-1741.754] (-1742.165) (-1742.845) -- 0:00:21 703000 -- (-1742.649) (-1742.516) (-1743.297) [-1743.324] * (-1744.977) (-1741.615) (-1744.627) [-1742.944] -- 0:00:21 703500 -- (-1742.731) [-1742.066] (-1742.609) (-1740.958) * (-1747.009) (-1741.166) (-1742.459) [-1742.199] -- 0:00:21 704000 -- (-1747.687) [-1740.923] (-1741.831) (-1743.051) * (-1747.953) [-1745.163] (-1740.801) (-1742.266) -- 0:00:21 704500 -- (-1744.152) (-1744.187) (-1742.142) [-1742.194] * (-1742.775) [-1740.660] (-1743.557) (-1746.112) -- 0:00:20 705000 -- (-1741.138) (-1740.694) [-1741.806] (-1742.883) * [-1742.644] (-1744.591) (-1742.519) (-1743.009) -- 0:00:21 Average standard deviation of split frequencies: 0.009544 705500 -- (-1741.244) (-1740.595) (-1743.456) [-1742.946] * (-1748.294) (-1744.737) (-1741.430) [-1741.982] -- 0:00:21 706000 -- [-1741.312] (-1741.302) (-1745.694) (-1742.429) * [-1742.138] (-1741.952) (-1740.788) (-1745.272) -- 0:00:21 706500 -- [-1742.782] (-1741.472) (-1742.454) (-1742.471) * (-1746.847) (-1744.044) [-1742.719] (-1746.547) -- 0:00:21 707000 -- (-1748.221) (-1743.844) (-1741.919) [-1743.760] * (-1742.469) (-1743.752) [-1740.969] (-1743.695) -- 0:00:21 707500 -- (-1744.838) (-1742.529) [-1741.697] (-1741.738) * (-1741.196) (-1740.696) [-1742.364] (-1742.351) -- 0:00:21 708000 -- (-1744.437) (-1743.284) (-1741.562) [-1741.906] * (-1741.500) (-1740.629) (-1743.763) [-1742.023] -- 0:00:21 708500 -- (-1749.030) (-1741.810) [-1746.168] (-1744.258) * (-1742.983) [-1740.782] (-1743.459) (-1744.258) -- 0:00:20 709000 -- (-1741.960) [-1741.577] (-1742.114) (-1744.407) * (-1747.383) [-1742.937] (-1743.388) (-1744.944) -- 0:00:20 709500 -- (-1740.959) (-1744.992) [-1742.761] (-1743.625) * [-1748.661] (-1745.033) (-1742.102) (-1741.894) -- 0:00:20 710000 -- [-1740.704] (-1743.636) (-1742.439) (-1742.111) * (-1746.864) [-1744.006] (-1743.264) (-1745.748) -- 0:00:20 Average standard deviation of split frequencies: 0.009131 710500 -- (-1742.208) (-1742.816) (-1743.867) [-1742.599] * (-1746.881) [-1741.786] (-1742.913) (-1741.305) -- 0:00:20 711000 -- [-1742.233] (-1741.499) (-1742.402) (-1741.842) * (-1741.190) (-1746.247) [-1742.947] (-1741.301) -- 0:00:20 711500 -- (-1741.371) [-1742.245] (-1743.711) (-1740.925) * [-1740.707] (-1747.219) (-1747.763) (-1746.991) -- 0:00:20 712000 -- (-1740.898) (-1741.343) (-1743.311) [-1742.756] * (-1741.058) (-1741.288) [-1744.196] (-1746.092) -- 0:00:20 712500 -- [-1741.669] (-1741.810) (-1743.312) (-1743.363) * (-1745.960) (-1747.496) (-1744.637) [-1742.652] -- 0:00:20 713000 -- [-1745.682] (-1743.373) (-1743.982) (-1741.624) * (-1741.275) (-1743.351) [-1741.931] (-1746.212) -- 0:00:20 713500 -- [-1743.465] (-1742.058) (-1744.225) (-1740.959) * (-1746.065) [-1743.764] (-1740.946) (-1748.955) -- 0:00:20 714000 -- [-1741.172] (-1742.366) (-1742.258) (-1741.018) * [-1743.702] (-1743.594) (-1741.962) (-1745.608) -- 0:00:20 714500 -- (-1741.724) (-1742.533) [-1742.374] (-1744.855) * [-1742.044] (-1742.681) (-1741.587) (-1742.754) -- 0:00:20 715000 -- (-1740.947) [-1742.787] (-1745.356) (-1743.080) * (-1743.262) (-1742.311) [-1743.766] (-1742.393) -- 0:00:20 Average standard deviation of split frequencies: 0.009256 715500 -- (-1743.802) (-1742.318) [-1743.938] (-1745.987) * (-1741.830) (-1741.576) (-1742.483) [-1741.454] -- 0:00:20 716000 -- (-1742.402) (-1745.576) (-1745.165) [-1743.227] * [-1740.786] (-1741.631) (-1743.583) (-1744.758) -- 0:00:20 716500 -- (-1742.851) (-1744.995) [-1742.334] (-1743.420) * (-1740.973) [-1741.377] (-1743.343) (-1742.105) -- 0:00:20 717000 -- [-1741.669] (-1746.523) (-1747.253) (-1740.867) * [-1741.297] (-1741.132) (-1743.382) (-1741.749) -- 0:00:20 717500 -- [-1745.558] (-1743.640) (-1742.225) (-1741.459) * [-1743.322] (-1741.169) (-1741.799) (-1741.609) -- 0:00:20 718000 -- (-1742.718) (-1745.553) [-1740.957] (-1746.764) * (-1741.108) [-1744.979] (-1742.788) (-1741.689) -- 0:00:20 718500 -- (-1748.525) [-1744.719] (-1741.125) (-1741.976) * [-1742.056] (-1747.454) (-1743.522) (-1743.076) -- 0:00:20 719000 -- (-1754.002) (-1744.236) [-1742.914] (-1746.185) * (-1743.200) [-1742.067] (-1741.270) (-1740.541) -- 0:00:20 719500 -- (-1750.737) [-1741.508] (-1742.466) (-1741.624) * (-1743.210) (-1741.908) (-1743.855) [-1744.092] -- 0:00:20 720000 -- [-1741.333] (-1742.907) (-1745.864) (-1743.003) * (-1742.721) (-1741.309) [-1742.643] (-1744.945) -- 0:00:20 Average standard deviation of split frequencies: 0.009312 720500 -- (-1740.430) (-1745.855) (-1743.696) [-1744.013] * (-1741.700) (-1742.492) (-1743.603) [-1742.663] -- 0:00:20 721000 -- (-1740.412) (-1744.886) [-1740.398] (-1740.644) * (-1745.798) (-1742.100) (-1743.460) [-1741.796] -- 0:00:20 721500 -- (-1742.597) (-1740.920) [-1740.415] (-1743.208) * (-1740.849) (-1744.478) (-1745.799) [-1740.477] -- 0:00:20 722000 -- (-1744.611) [-1740.775] (-1742.554) (-1741.952) * (-1740.912) [-1741.405] (-1741.199) (-1745.496) -- 0:00:20 722500 -- (-1744.248) (-1744.279) (-1740.635) [-1742.613] * (-1743.989) [-1741.508] (-1742.292) (-1742.312) -- 0:00:19 723000 -- (-1741.813) (-1745.298) [-1744.816] (-1742.782) * (-1745.038) (-1741.132) (-1745.450) [-1742.062] -- 0:00:19 723500 -- (-1741.841) (-1741.564) (-1747.288) [-1742.134] * [-1744.987] (-1741.003) (-1744.155) (-1741.200) -- 0:00:19 724000 -- (-1744.820) (-1741.222) (-1743.329) [-1741.792] * [-1740.749] (-1741.048) (-1742.164) (-1742.007) -- 0:00:19 724500 -- (-1744.985) [-1743.608] (-1742.950) (-1740.817) * (-1743.302) [-1741.047] (-1741.098) (-1741.960) -- 0:00:19 725000 -- (-1741.475) [-1744.809] (-1740.990) (-1744.446) * (-1744.424) (-1741.240) (-1743.613) [-1741.598] -- 0:00:19 Average standard deviation of split frequencies: 0.009893 725500 -- (-1743.330) (-1742.319) [-1741.049] (-1743.326) * (-1744.038) [-1742.526] (-1743.460) (-1741.638) -- 0:00:19 726000 -- [-1742.368] (-1746.164) (-1742.474) (-1743.358) * [-1743.242] (-1741.255) (-1740.957) (-1743.982) -- 0:00:19 726500 -- (-1740.578) (-1742.818) [-1742.013] (-1744.774) * (-1742.542) [-1741.316] (-1743.677) (-1741.856) -- 0:00:19 727000 -- (-1740.483) [-1743.500] (-1742.899) (-1744.194) * (-1744.997) (-1742.593) (-1743.662) [-1744.130] -- 0:00:19 727500 -- [-1740.581] (-1745.220) (-1742.375) (-1741.869) * [-1742.441] (-1742.704) (-1746.537) (-1744.177) -- 0:00:19 728000 -- (-1740.521) (-1741.084) [-1742.124] (-1748.620) * [-1741.842] (-1743.022) (-1744.423) (-1746.499) -- 0:00:19 728500 -- (-1742.409) (-1740.797) (-1742.565) [-1745.440] * [-1741.960] (-1743.340) (-1741.411) (-1743.426) -- 0:00:19 729000 -- (-1744.213) (-1741.699) [-1745.804] (-1744.785) * (-1744.113) [-1742.872] (-1744.374) (-1743.571) -- 0:00:19 729500 -- [-1740.868] (-1742.206) (-1745.789) (-1741.122) * [-1742.437] (-1741.905) (-1744.158) (-1741.267) -- 0:00:19 730000 -- (-1742.643) (-1742.640) (-1743.822) [-1741.524] * (-1744.432) (-1742.963) (-1744.818) [-1742.240] -- 0:00:19 Average standard deviation of split frequencies: 0.009488 730500 -- (-1743.923) (-1743.605) (-1746.230) [-1741.626] * (-1744.473) (-1744.332) (-1740.386) [-1743.653] -- 0:00:19 731000 -- (-1744.347) (-1741.989) [-1741.501] (-1741.381) * [-1741.276] (-1743.800) (-1741.232) (-1743.667) -- 0:00:19 731500 -- (-1745.631) (-1744.736) [-1744.270] (-1743.128) * (-1743.807) [-1742.227] (-1743.522) (-1743.566) -- 0:00:19 732000 -- (-1741.076) [-1744.291] (-1745.735) (-1743.393) * (-1743.618) [-1742.026] (-1746.408) (-1743.570) -- 0:00:19 732500 -- (-1744.302) (-1741.376) [-1741.129] (-1741.610) * (-1741.680) (-1742.132) [-1748.044] (-1744.214) -- 0:00:18 733000 -- (-1742.740) (-1741.201) (-1741.247) [-1744.343] * [-1744.074] (-1744.147) (-1743.852) (-1741.767) -- 0:00:19 733500 -- (-1742.254) (-1741.179) (-1740.471) [-1744.495] * (-1740.889) [-1741.538] (-1742.257) (-1740.657) -- 0:00:19 734000 -- (-1743.934) (-1741.474) (-1742.824) [-1744.519] * (-1743.414) (-1741.504) [-1744.009] (-1741.982) -- 0:00:19 734500 -- (-1743.845) (-1744.863) (-1743.108) [-1742.925] * (-1746.376) (-1745.391) (-1743.238) [-1740.836] -- 0:00:19 735000 -- [-1742.859] (-1745.475) (-1743.908) (-1742.613) * (-1743.346) (-1743.522) [-1745.671] (-1741.959) -- 0:00:19 Average standard deviation of split frequencies: 0.009871 735500 -- (-1744.384) (-1745.472) (-1744.679) [-1741.512] * (-1744.286) (-1742.549) (-1744.028) [-1740.765] -- 0:00:19 736000 -- (-1745.064) (-1743.073) (-1747.925) [-1741.420] * (-1743.733) [-1741.980] (-1742.311) (-1742.056) -- 0:00:19 736500 -- [-1744.897] (-1744.129) (-1743.535) (-1743.421) * (-1743.108) (-1740.362) (-1742.385) [-1741.405] -- 0:00:18 737000 -- (-1745.780) (-1741.270) (-1742.220) [-1742.702] * [-1744.182] (-1742.729) (-1740.731) (-1742.685) -- 0:00:18 737500 -- (-1743.327) (-1740.823) (-1743.660) [-1742.381] * (-1745.638) (-1741.644) (-1744.338) [-1743.589] -- 0:00:18 738000 -- [-1743.211] (-1744.569) (-1744.273) (-1741.136) * [-1744.829] (-1741.559) (-1742.286) (-1743.375) -- 0:00:18 738500 -- (-1742.935) (-1745.726) [-1740.882] (-1742.287) * (-1744.538) (-1745.820) (-1741.628) [-1743.067] -- 0:00:18 739000 -- (-1742.391) (-1742.428) (-1741.388) [-1744.858] * (-1741.655) (-1743.342) (-1741.078) [-1743.623] -- 0:00:18 739500 -- (-1742.522) (-1741.253) (-1741.965) [-1743.646] * (-1745.173) (-1741.946) [-1741.138] (-1741.081) -- 0:00:18 740000 -- (-1741.969) (-1742.268) (-1743.476) [-1741.647] * (-1745.292) [-1742.737] (-1741.484) (-1741.491) -- 0:00:18 Average standard deviation of split frequencies: 0.009360 740500 -- (-1748.657) (-1740.752) (-1741.620) [-1746.606] * (-1742.914) (-1742.617) (-1743.238) [-1741.694] -- 0:00:18 741000 -- [-1745.412] (-1740.688) (-1742.229) (-1741.561) * (-1741.444) [-1742.498] (-1742.501) (-1744.554) -- 0:00:18 741500 -- (-1740.426) (-1742.368) (-1744.160) [-1741.863] * (-1742.540) [-1745.453] (-1744.066) (-1744.410) -- 0:00:18 742000 -- (-1743.260) [-1742.553] (-1742.509) (-1740.827) * (-1747.859) (-1742.565) [-1743.332] (-1741.168) -- 0:00:18 742500 -- [-1741.038] (-1743.062) (-1743.368) (-1740.900) * [-1741.585] (-1741.499) (-1741.851) (-1742.925) -- 0:00:18 743000 -- [-1741.593] (-1743.875) (-1741.023) (-1748.367) * (-1741.958) [-1741.825] (-1744.808) (-1742.040) -- 0:00:18 743500 -- (-1741.461) [-1742.620] (-1747.867) (-1747.081) * [-1742.002] (-1743.719) (-1741.659) (-1745.074) -- 0:00:18 744000 -- (-1741.868) (-1745.067) (-1743.735) [-1744.153] * (-1744.109) [-1742.756] (-1741.010) (-1740.939) -- 0:00:18 744500 -- (-1745.827) [-1742.725] (-1743.677) (-1744.532) * (-1741.401) (-1746.653) [-1741.182] (-1742.357) -- 0:00:18 745000 -- (-1744.178) [-1742.436] (-1744.558) (-1744.467) * [-1742.693] (-1745.411) (-1744.704) (-1745.298) -- 0:00:18 Average standard deviation of split frequencies: 0.008921 745500 -- (-1741.280) [-1742.431] (-1748.068) (-1741.373) * [-1741.717] (-1744.691) (-1742.393) (-1748.170) -- 0:00:18 746000 -- (-1746.539) [-1742.240] (-1748.005) (-1741.626) * [-1740.942] (-1741.386) (-1741.862) (-1742.427) -- 0:00:18 746500 -- (-1744.466) (-1747.743) [-1744.430] (-1740.395) * (-1744.184) (-1741.261) (-1742.457) [-1745.733] -- 0:00:18 747000 -- (-1743.145) (-1744.370) [-1744.539] (-1741.542) * [-1742.693] (-1741.869) (-1742.760) (-1745.902) -- 0:00:18 747500 -- (-1743.203) (-1742.444) (-1744.202) [-1741.512] * (-1742.242) [-1740.893] (-1741.950) (-1747.618) -- 0:00:18 748000 -- [-1741.625] (-1741.315) (-1746.061) (-1747.052) * (-1742.050) (-1743.424) (-1742.746) [-1742.971] -- 0:00:18 748500 -- (-1740.823) (-1741.912) (-1752.831) [-1742.244] * (-1744.857) [-1742.203] (-1742.154) (-1744.074) -- 0:00:18 749000 -- [-1741.579] (-1744.254) (-1741.997) (-1745.038) * (-1742.671) (-1745.064) (-1743.130) [-1745.160] -- 0:00:18 749500 -- [-1741.506] (-1744.600) (-1741.856) (-1745.534) * (-1741.261) (-1741.519) [-1742.433] (-1741.343) -- 0:00:18 750000 -- [-1741.773] (-1743.380) (-1741.391) (-1743.564) * (-1743.322) (-1742.799) [-1742.106] (-1742.504) -- 0:00:18 Average standard deviation of split frequencies: 0.008939 750500 -- [-1742.324] (-1740.767) (-1741.337) (-1741.058) * [-1742.194] (-1742.179) (-1742.266) (-1744.586) -- 0:00:17 751000 -- (-1743.349) (-1744.063) (-1741.337) [-1741.926] * (-1741.837) (-1741.821) [-1743.426] (-1742.187) -- 0:00:17 751500 -- (-1741.961) (-1744.070) [-1741.384] (-1742.610) * (-1742.692) (-1741.815) [-1742.856] (-1745.163) -- 0:00:17 752000 -- [-1743.019] (-1741.274) (-1741.515) (-1742.361) * (-1744.091) (-1742.370) [-1743.546] (-1748.301) -- 0:00:17 752500 -- [-1742.730] (-1742.383) (-1741.477) (-1741.971) * [-1740.839] (-1743.965) (-1744.378) (-1745.546) -- 0:00:17 753000 -- [-1741.341] (-1740.288) (-1740.870) (-1745.105) * (-1742.839) [-1742.839] (-1744.212) (-1744.263) -- 0:00:17 753500 -- (-1741.001) (-1741.623) (-1740.967) [-1743.154] * (-1745.028) [-1741.276] (-1743.134) (-1743.877) -- 0:00:17 754000 -- (-1741.045) (-1743.023) [-1742.883] (-1741.794) * (-1746.206) (-1741.617) (-1742.590) [-1743.434] -- 0:00:17 754500 -- (-1741.308) (-1742.005) [-1741.209] (-1741.628) * (-1745.740) (-1741.227) [-1743.738] (-1741.376) -- 0:00:17 755000 -- (-1746.818) (-1740.745) (-1741.337) [-1742.731] * (-1752.295) (-1744.315) (-1746.448) [-1741.128] -- 0:00:17 Average standard deviation of split frequencies: 0.008574 755500 -- (-1741.651) [-1743.282] (-1741.396) (-1741.605) * (-1746.407) (-1741.968) [-1746.370] (-1741.869) -- 0:00:17 756000 -- (-1744.035) [-1742.173] (-1740.656) (-1741.205) * (-1741.918) [-1742.627] (-1744.465) (-1744.926) -- 0:00:17 756500 -- [-1743.656] (-1744.119) (-1740.649) (-1748.225) * (-1743.222) [-1745.048] (-1743.213) (-1746.607) -- 0:00:17 757000 -- (-1744.713) [-1747.227] (-1741.635) (-1743.410) * (-1744.660) (-1743.749) [-1742.704] (-1743.826) -- 0:00:17 757500 -- [-1743.766] (-1744.098) (-1744.125) (-1744.741) * (-1741.362) (-1741.805) (-1742.588) [-1740.790] -- 0:00:17 758000 -- [-1741.692] (-1741.681) (-1743.865) (-1745.706) * (-1740.748) (-1745.788) [-1743.440] (-1741.710) -- 0:00:17 758500 -- (-1747.463) (-1741.724) [-1742.624] (-1742.192) * [-1742.031] (-1742.936) (-1745.574) (-1744.959) -- 0:00:17 759000 -- (-1743.439) (-1742.595) [-1741.803] (-1741.172) * (-1743.949) (-1741.733) [-1742.142] (-1741.772) -- 0:00:17 759500 -- (-1747.237) (-1741.222) (-1744.023) [-1744.492] * [-1744.984] (-1740.830) (-1743.762) (-1741.925) -- 0:00:17 760000 -- (-1745.125) (-1743.846) (-1745.489) [-1743.865] * (-1741.679) (-1742.674) [-1743.157] (-1742.272) -- 0:00:17 Average standard deviation of split frequencies: 0.009150 760500 -- [-1741.363] (-1742.408) (-1742.893) (-1742.647) * [-1741.790] (-1744.311) (-1743.100) (-1741.754) -- 0:00:17 761000 -- [-1746.462] (-1743.385) (-1742.459) (-1744.624) * [-1741.925] (-1744.416) (-1743.525) (-1741.657) -- 0:00:17 761500 -- (-1743.966) [-1744.438] (-1743.135) (-1744.771) * (-1741.310) (-1742.331) [-1742.132] (-1740.849) -- 0:00:17 762000 -- (-1742.166) (-1744.891) (-1740.374) [-1743.010] * [-1741.602] (-1743.744) (-1741.563) (-1741.641) -- 0:00:17 762500 -- [-1743.788] (-1741.806) (-1742.134) (-1743.210) * (-1743.351) (-1745.035) [-1744.657] (-1743.533) -- 0:00:17 763000 -- (-1747.267) [-1742.757] (-1740.764) (-1741.875) * [-1742.951] (-1742.620) (-1741.655) (-1742.498) -- 0:00:17 763500 -- (-1741.088) (-1743.353) (-1744.394) [-1741.040] * [-1744.140] (-1740.892) (-1743.876) (-1741.312) -- 0:00:17 764000 -- [-1741.704] (-1743.542) (-1745.411) (-1741.227) * (-1747.452) (-1740.678) [-1743.194] (-1740.793) -- 0:00:16 764500 -- [-1741.960] (-1741.912) (-1743.538) (-1742.737) * (-1745.327) (-1744.513) [-1743.368] (-1743.876) -- 0:00:16 765000 -- [-1747.153] (-1742.208) (-1747.546) (-1741.075) * (-1741.553) [-1743.956] (-1744.263) (-1745.545) -- 0:00:16 Average standard deviation of split frequencies: 0.008942 765500 -- (-1746.315) [-1743.220] (-1743.856) (-1741.304) * [-1741.505] (-1744.906) (-1746.943) (-1747.068) -- 0:00:16 766000 -- [-1742.066] (-1742.306) (-1745.254) (-1746.354) * (-1742.507) [-1743.459] (-1743.852) (-1743.172) -- 0:00:16 766500 -- (-1741.719) (-1742.823) [-1741.951] (-1741.881) * (-1744.043) (-1745.012) (-1740.895) [-1741.563] -- 0:00:16 767000 -- [-1741.250] (-1741.208) (-1748.522) (-1745.827) * (-1744.917) (-1743.401) (-1742.975) [-1741.354] -- 0:00:16 767500 -- (-1741.026) (-1745.681) [-1741.627] (-1741.605) * [-1740.972] (-1743.770) (-1741.732) (-1741.228) -- 0:00:16 768000 -- (-1742.701) [-1743.575] (-1747.670) (-1740.992) * (-1740.475) (-1741.083) (-1745.661) [-1741.329] -- 0:00:16 768500 -- (-1744.242) [-1743.031] (-1746.765) (-1741.365) * (-1740.508) (-1742.479) (-1744.065) [-1745.644] -- 0:00:16 769000 -- (-1744.919) [-1742.560] (-1741.864) (-1741.128) * [-1741.528] (-1746.928) (-1743.399) (-1744.731) -- 0:00:16 769500 -- (-1744.605) (-1743.853) [-1742.387] (-1740.393) * (-1742.933) (-1748.317) (-1743.581) [-1744.157] -- 0:00:16 770000 -- (-1746.097) [-1746.688] (-1743.760) (-1741.229) * (-1742.036) [-1743.719] (-1742.288) (-1742.965) -- 0:00:16 Average standard deviation of split frequencies: 0.008602 770500 -- (-1744.662) (-1746.189) [-1742.595] (-1741.314) * (-1743.992) [-1743.792] (-1745.659) (-1743.691) -- 0:00:16 771000 -- [-1742.879] (-1744.195) (-1741.199) (-1741.612) * (-1746.188) (-1741.717) [-1741.476] (-1740.950) -- 0:00:16 771500 -- (-1741.648) (-1742.851) (-1742.262) [-1741.054] * (-1742.545) (-1741.472) (-1742.796) [-1742.816] -- 0:00:16 772000 -- (-1744.784) (-1743.586) (-1744.570) [-1744.496] * (-1741.175) (-1742.330) (-1742.000) [-1743.820] -- 0:00:16 772500 -- [-1744.757] (-1740.931) (-1743.363) (-1744.281) * (-1746.516) [-1747.183] (-1742.517) (-1742.492) -- 0:00:16 773000 -- (-1741.046) [-1740.930] (-1748.324) (-1745.914) * [-1742.814] (-1748.319) (-1742.512) (-1743.855) -- 0:00:16 773500 -- (-1744.005) (-1745.992) (-1742.836) [-1743.122] * (-1743.652) [-1741.063] (-1741.157) (-1746.204) -- 0:00:16 774000 -- (-1741.368) [-1741.916] (-1744.016) (-1745.456) * [-1742.606] (-1741.722) (-1742.085) (-1750.304) -- 0:00:16 774500 -- (-1741.944) [-1742.986] (-1742.482) (-1741.211) * (-1742.929) (-1743.308) [-1741.878] (-1747.187) -- 0:00:16 775000 -- [-1742.863] (-1747.782) (-1741.486) (-1741.106) * (-1741.884) [-1743.496] (-1742.964) (-1743.004) -- 0:00:16 Average standard deviation of split frequencies: 0.008315 775500 -- (-1743.637) [-1741.723] (-1742.168) (-1742.641) * (-1744.271) (-1743.232) [-1742.939] (-1741.939) -- 0:00:16 776000 -- (-1742.764) (-1741.472) (-1744.558) [-1742.628] * (-1743.788) (-1744.472) [-1741.786] (-1744.270) -- 0:00:16 776500 -- (-1745.137) (-1743.440) [-1742.224] (-1741.951) * (-1743.388) [-1742.458] (-1741.645) (-1743.278) -- 0:00:16 777000 -- (-1741.438) [-1741.174] (-1742.445) (-1742.944) * [-1742.271] (-1741.308) (-1740.930) (-1742.475) -- 0:00:16 777500 -- [-1741.830] (-1741.175) (-1741.243) (-1741.485) * (-1741.425) (-1740.721) [-1740.581] (-1743.137) -- 0:00:16 778000 -- [-1741.649] (-1741.554) (-1742.470) (-1742.643) * [-1742.557] (-1742.617) (-1740.388) (-1741.897) -- 0:00:15 778500 -- (-1742.696) (-1743.293) (-1744.569) [-1740.916] * (-1744.375) (-1744.026) (-1742.031) [-1741.868] -- 0:00:15 779000 -- (-1742.051) [-1741.144] (-1742.724) (-1741.054) * (-1741.779) (-1743.854) (-1741.921) [-1742.030] -- 0:00:15 779500 -- (-1744.202) [-1740.955] (-1741.859) (-1745.361) * (-1743.073) (-1744.015) (-1743.570) [-1743.922] -- 0:00:15 780000 -- (-1742.919) [-1742.055] (-1744.262) (-1747.281) * (-1742.890) (-1743.843) [-1745.448] (-1741.306) -- 0:00:15 Average standard deviation of split frequencies: 0.008869 780500 -- (-1744.445) (-1742.528) (-1741.891) [-1743.095] * (-1740.670) [-1743.154] (-1745.369) (-1740.709) -- 0:00:15 781000 -- [-1740.790] (-1742.530) (-1741.220) (-1741.478) * [-1740.705] (-1747.835) (-1747.564) (-1740.609) -- 0:00:15 781500 -- (-1746.988) [-1741.657] (-1741.032) (-1740.451) * (-1743.007) (-1742.444) (-1741.709) [-1741.867] -- 0:00:15 782000 -- (-1743.766) (-1741.853) [-1741.188] (-1742.857) * [-1743.748] (-1742.623) (-1743.571) (-1741.318) -- 0:00:15 782500 -- (-1742.910) (-1748.214) (-1741.958) [-1743.579] * (-1743.233) [-1743.967] (-1744.698) (-1742.436) -- 0:00:15 783000 -- (-1743.484) (-1744.294) (-1744.485) [-1741.919] * (-1740.404) (-1742.087) [-1742.043] (-1741.763) -- 0:00:15 783500 -- (-1743.291) (-1743.928) [-1744.486] (-1742.805) * [-1741.390] (-1741.943) (-1746.194) (-1741.774) -- 0:00:15 784000 -- (-1740.889) (-1740.905) (-1743.769) [-1741.437] * (-1742.113) [-1742.149] (-1746.030) (-1741.413) -- 0:00:15 784500 -- (-1744.222) (-1741.285) [-1741.158] (-1743.292) * (-1742.629) (-1742.744) [-1742.953] (-1743.342) -- 0:00:15 785000 -- [-1742.572] (-1741.516) (-1741.484) (-1744.671) * [-1744.564] (-1741.979) (-1743.157) (-1744.126) -- 0:00:15 Average standard deviation of split frequencies: 0.008921 785500 -- (-1744.388) [-1741.837] (-1745.171) (-1745.504) * (-1743.861) [-1740.589] (-1745.687) (-1742.608) -- 0:00:15 786000 -- (-1741.663) (-1742.856) (-1742.114) [-1741.465] * (-1741.777) (-1741.084) [-1741.442] (-1747.728) -- 0:00:15 786500 -- (-1741.314) [-1742.045] (-1745.004) (-1741.600) * (-1749.856) (-1743.427) [-1742.826] (-1741.555) -- 0:00:15 787000 -- (-1743.582) (-1742.460) (-1741.101) [-1742.163] * (-1741.937) (-1743.958) [-1742.730] (-1743.530) -- 0:00:15 787500 -- (-1747.158) [-1741.713] (-1744.709) (-1741.521) * (-1744.113) (-1745.129) (-1740.774) [-1740.635] -- 0:00:15 788000 -- [-1741.708] (-1743.878) (-1742.055) (-1742.933) * (-1745.088) (-1745.254) [-1741.714] (-1741.811) -- 0:00:15 788500 -- (-1741.736) (-1742.924) [-1740.984] (-1742.305) * (-1743.809) (-1743.568) (-1740.904) [-1741.883] -- 0:00:15 789000 -- (-1740.690) (-1743.073) (-1750.633) [-1742.633] * (-1742.756) (-1742.607) (-1744.223) [-1740.548] -- 0:00:15 789500 -- [-1742.928] (-1743.697) (-1743.212) (-1743.520) * [-1741.369] (-1744.499) (-1744.013) (-1741.281) -- 0:00:15 790000 -- (-1742.380) [-1743.253] (-1745.925) (-1742.487) * (-1745.493) [-1743.239] (-1744.274) (-1745.650) -- 0:00:15 Average standard deviation of split frequencies: 0.008698 790500 -- [-1743.329] (-1744.617) (-1742.037) (-1745.295) * (-1742.598) (-1745.409) (-1741.043) [-1741.406] -- 0:00:15 791000 -- (-1742.426) (-1742.782) (-1746.524) [-1744.513] * (-1742.668) (-1743.049) (-1744.182) [-1743.702] -- 0:00:15 791500 -- (-1742.764) (-1744.009) [-1742.305] (-1743.114) * (-1741.789) (-1743.885) [-1740.904] (-1743.173) -- 0:00:15 792000 -- (-1745.641) (-1743.761) [-1742.796] (-1745.861) * (-1744.889) (-1743.983) [-1744.745] (-1742.376) -- 0:00:14 792500 -- [-1746.006] (-1741.709) (-1745.697) (-1741.084) * (-1747.801) [-1743.406] (-1743.990) (-1742.578) -- 0:00:14 793000 -- (-1745.118) (-1742.692) (-1740.583) [-1740.697] * (-1742.499) (-1746.147) [-1743.033] (-1744.658) -- 0:00:14 793500 -- (-1741.549) (-1742.249) [-1741.428] (-1741.510) * (-1744.097) (-1743.990) (-1741.176) [-1741.235] -- 0:00:14 794000 -- (-1741.082) (-1742.442) (-1742.041) [-1743.460] * (-1743.183) (-1744.353) (-1743.861) [-1743.192] -- 0:00:14 794500 -- (-1744.621) [-1741.218] (-1742.404) (-1743.407) * (-1741.428) [-1743.752] (-1744.324) (-1741.236) -- 0:00:14 795000 -- (-1742.807) [-1743.081] (-1741.909) (-1744.520) * (-1742.596) (-1743.582) [-1741.027] (-1742.367) -- 0:00:14 Average standard deviation of split frequencies: 0.008361 795500 -- [-1742.080] (-1742.137) (-1743.258) (-1746.269) * (-1747.141) (-1742.024) [-1741.251] (-1742.830) -- 0:00:14 796000 -- (-1741.721) [-1742.094] (-1742.422) (-1743.071) * (-1743.619) (-1741.903) (-1741.213) [-1743.192] -- 0:00:14 796500 -- (-1742.311) [-1742.253] (-1741.700) (-1743.676) * [-1744.917] (-1741.622) (-1741.125) (-1745.181) -- 0:00:14 797000 -- (-1740.862) [-1740.357] (-1742.163) (-1741.184) * (-1742.083) [-1742.208] (-1744.680) (-1740.795) -- 0:00:14 797500 -- (-1741.300) [-1741.043] (-1741.922) (-1742.131) * (-1740.455) [-1744.295] (-1741.984) (-1741.961) -- 0:00:14 798000 -- [-1741.491] (-1741.034) (-1740.810) (-1742.303) * (-1747.272) (-1743.745) [-1741.691] (-1741.384) -- 0:00:14 798500 -- (-1743.141) [-1743.173] (-1741.238) (-1743.564) * [-1742.765] (-1743.651) (-1741.211) (-1741.781) -- 0:00:14 799000 -- [-1744.021] (-1742.096) (-1743.784) (-1743.606) * (-1741.099) (-1743.252) [-1743.458] (-1743.659) -- 0:00:14 799500 -- (-1744.416) (-1741.732) (-1746.426) [-1744.196] * (-1747.145) (-1741.807) (-1742.466) [-1741.557] -- 0:00:14 800000 -- (-1744.657) [-1741.920] (-1744.782) (-1742.742) * (-1744.675) (-1742.767) [-1741.328] (-1743.770) -- 0:00:14 Average standard deviation of split frequencies: 0.008684 800500 -- (-1742.616) (-1744.560) (-1743.810) [-1742.029] * [-1741.954] (-1743.744) (-1742.775) (-1742.116) -- 0:00:14 801000 -- [-1744.834] (-1743.709) (-1743.453) (-1740.789) * [-1744.557] (-1742.648) (-1742.735) (-1744.585) -- 0:00:14 801500 -- (-1741.230) (-1746.403) [-1741.155] (-1741.506) * (-1742.130) [-1742.322] (-1748.330) (-1743.722) -- 0:00:14 802000 -- (-1741.466) [-1744.291] (-1742.514) (-1740.627) * (-1745.139) [-1741.129] (-1742.781) (-1744.876) -- 0:00:14 802500 -- (-1743.081) (-1743.814) [-1741.288] (-1742.117) * (-1747.034) (-1741.522) [-1741.978] (-1748.743) -- 0:00:14 803000 -- (-1742.410) (-1741.592) [-1741.866] (-1741.678) * (-1742.652) (-1742.373) [-1743.526] (-1742.247) -- 0:00:14 803500 -- (-1745.084) (-1741.717) [-1742.083] (-1741.784) * (-1743.684) (-1743.996) [-1740.832] (-1743.306) -- 0:00:14 804000 -- (-1744.754) (-1742.323) (-1740.827) [-1741.784] * (-1746.769) (-1744.088) (-1743.335) [-1743.545] -- 0:00:14 804500 -- [-1744.972] (-1742.847) (-1741.630) (-1742.278) * (-1744.116) [-1740.906] (-1741.689) (-1741.714) -- 0:00:14 805000 -- (-1742.363) [-1745.297] (-1741.820) (-1742.566) * (-1742.366) (-1745.564) (-1741.877) [-1742.987] -- 0:00:14 Average standard deviation of split frequencies: 0.008257 805500 -- (-1748.077) (-1742.819) [-1742.423] (-1742.626) * (-1741.843) (-1742.166) [-1742.311] (-1743.786) -- 0:00:14 806000 -- (-1743.982) (-1741.545) (-1743.206) [-1741.484] * (-1740.993) [-1741.671] (-1742.942) (-1745.068) -- 0:00:13 806500 -- (-1742.826) [-1741.277] (-1744.781) (-1742.762) * (-1741.047) (-1742.468) (-1742.779) [-1742.542] -- 0:00:13 807000 -- (-1741.887) (-1741.826) (-1743.392) [-1741.559] * (-1741.059) (-1741.709) [-1744.016] (-1742.734) -- 0:00:13 807500 -- [-1742.225] (-1744.103) (-1742.399) (-1740.938) * (-1741.924) (-1745.917) (-1745.156) [-1742.425] -- 0:00:13 808000 -- (-1740.937) [-1742.939] (-1741.463) (-1741.440) * (-1740.775) (-1748.495) [-1744.152] (-1744.286) -- 0:00:13 808500 -- (-1740.806) (-1742.181) [-1742.574] (-1742.933) * [-1744.235] (-1743.069) (-1745.749) (-1741.867) -- 0:00:13 809000 -- (-1746.044) (-1742.808) (-1740.833) [-1741.636] * (-1743.655) [-1741.774] (-1740.760) (-1742.897) -- 0:00:13 809500 -- [-1742.186] (-1744.246) (-1740.802) (-1744.620) * [-1742.554] (-1744.252) (-1741.581) (-1742.341) -- 0:00:13 810000 -- [-1742.938] (-1746.365) (-1742.084) (-1744.630) * (-1745.039) [-1742.213] (-1742.281) (-1741.958) -- 0:00:13 Average standard deviation of split frequencies: 0.008586 810500 -- (-1744.591) (-1742.324) (-1745.020) [-1743.210] * (-1743.962) [-1743.850] (-1742.909) (-1743.253) -- 0:00:13 811000 -- (-1744.978) (-1741.697) [-1742.892] (-1743.270) * (-1744.078) (-1740.804) (-1742.451) [-1741.750] -- 0:00:13 811500 -- (-1742.656) (-1743.511) [-1743.819] (-1745.185) * (-1742.896) (-1742.802) [-1742.344] (-1743.290) -- 0:00:13 812000 -- [-1743.368] (-1742.521) (-1742.632) (-1743.107) * [-1746.405] (-1740.766) (-1741.562) (-1742.082) -- 0:00:13 812500 -- (-1745.927) (-1743.008) (-1741.687) [-1741.539] * [-1741.917] (-1740.946) (-1743.706) (-1741.803) -- 0:00:13 813000 -- (-1750.033) (-1746.388) [-1743.480] (-1746.494) * (-1741.233) [-1743.060] (-1741.412) (-1740.603) -- 0:00:13 813500 -- [-1744.774] (-1742.392) (-1748.053) (-1744.136) * (-1741.072) (-1744.411) [-1743.642] (-1743.616) -- 0:00:13 814000 -- [-1742.382] (-1741.706) (-1751.482) (-1747.263) * (-1747.754) (-1743.615) (-1741.081) [-1743.783] -- 0:00:13 814500 -- [-1744.484] (-1740.761) (-1751.085) (-1745.245) * (-1745.721) (-1742.168) [-1740.704] (-1743.560) -- 0:00:13 815000 -- (-1741.363) (-1742.245) (-1744.391) [-1741.597] * (-1747.132) (-1750.423) [-1742.850] (-1743.247) -- 0:00:13 Average standard deviation of split frequencies: 0.008733 815500 -- [-1746.388] (-1742.488) (-1741.340) (-1741.569) * (-1745.563) (-1742.335) [-1743.251] (-1743.102) -- 0:00:13 816000 -- (-1741.771) (-1741.352) (-1741.320) [-1743.725] * (-1743.923) (-1741.421) (-1743.014) [-1741.279] -- 0:00:13 816500 -- (-1742.456) (-1740.967) [-1741.740] (-1742.308) * (-1742.347) (-1741.208) [-1741.308] (-1741.645) -- 0:00:13 817000 -- (-1741.461) (-1743.414) (-1742.003) [-1742.642] * (-1743.005) [-1741.879] (-1742.142) (-1744.540) -- 0:00:13 817500 -- (-1745.784) (-1742.659) (-1742.166) [-1741.652] * (-1743.062) (-1741.320) [-1741.785] (-1745.098) -- 0:00:13 818000 -- [-1742.417] (-1741.837) (-1747.034) (-1745.352) * (-1743.331) (-1748.764) (-1742.788) [-1746.549] -- 0:00:13 818500 -- (-1741.280) (-1741.039) [-1743.827] (-1743.621) * (-1743.394) (-1745.316) (-1742.887) [-1741.760] -- 0:00:13 819000 -- (-1741.545) (-1742.694) (-1743.807) [-1744.320] * (-1742.075) (-1741.524) [-1740.594] (-1742.253) -- 0:00:13 819500 -- [-1744.361] (-1741.300) (-1745.023) (-1742.745) * (-1743.525) (-1745.660) (-1740.539) [-1740.447] -- 0:00:12 820000 -- (-1742.472) (-1741.895) [-1748.056] (-1744.653) * (-1741.350) [-1743.079] (-1740.749) (-1740.458) -- 0:00:12 Average standard deviation of split frequencies: 0.008549 820500 -- (-1743.091) [-1743.679] (-1743.492) (-1742.554) * (-1740.892) (-1741.095) [-1743.184] (-1743.520) -- 0:00:12 821000 -- (-1741.132) (-1744.725) [-1741.949] (-1741.583) * (-1745.591) [-1741.214] (-1744.081) (-1742.419) -- 0:00:12 821500 -- (-1750.127) (-1744.367) [-1745.288] (-1741.297) * (-1742.318) [-1741.817] (-1741.775) (-1741.878) -- 0:00:12 822000 -- (-1741.754) [-1742.055] (-1746.486) (-1743.780) * (-1743.480) [-1740.876] (-1741.030) (-1741.918) -- 0:00:12 822500 -- (-1742.195) (-1742.429) [-1741.412] (-1747.323) * (-1741.248) (-1742.799) [-1742.114] (-1745.271) -- 0:00:12 823000 -- (-1741.010) (-1743.579) [-1740.465] (-1741.743) * (-1744.478) (-1741.096) [-1742.025] (-1745.815) -- 0:00:12 823500 -- (-1744.938) (-1741.304) (-1741.190) [-1741.986] * [-1743.452] (-1742.034) (-1743.948) (-1742.596) -- 0:00:12 824000 -- (-1744.534) (-1743.024) [-1741.592] (-1744.540) * (-1743.885) [-1741.292] (-1740.924) (-1745.982) -- 0:00:12 824500 -- [-1741.414] (-1743.956) (-1741.525) (-1743.287) * (-1744.550) [-1740.933] (-1740.953) (-1744.487) -- 0:00:12 825000 -- (-1741.424) (-1742.488) [-1742.254] (-1743.464) * (-1744.336) [-1740.450] (-1740.558) (-1745.467) -- 0:00:12 Average standard deviation of split frequencies: 0.008796 825500 -- [-1741.049] (-1742.256) (-1742.060) (-1742.077) * (-1740.913) [-1740.499] (-1745.149) (-1746.642) -- 0:00:12 826000 -- [-1741.340] (-1742.000) (-1744.769) (-1740.720) * [-1743.168] (-1741.208) (-1745.745) (-1745.914) -- 0:00:12 826500 -- (-1741.487) (-1742.524) [-1742.314] (-1744.377) * (-1742.941) [-1741.293] (-1740.922) (-1743.454) -- 0:00:12 827000 -- [-1741.619] (-1741.855) (-1741.768) (-1745.773) * (-1741.623) [-1740.602] (-1740.725) (-1741.671) -- 0:00:12 827500 -- [-1743.246] (-1743.635) (-1744.959) (-1743.539) * (-1741.379) (-1740.870) (-1746.274) [-1742.530] -- 0:00:12 828000 -- (-1748.221) (-1745.777) (-1746.331) [-1744.025] * [-1743.772] (-1741.803) (-1744.629) (-1741.202) -- 0:00:12 828500 -- (-1742.172) (-1745.943) (-1741.417) [-1742.945] * (-1741.841) [-1741.926] (-1745.082) (-1741.645) -- 0:00:12 829000 -- (-1741.020) (-1743.969) [-1741.319] (-1740.505) * (-1741.735) [-1740.634] (-1746.515) (-1743.876) -- 0:00:12 829500 -- [-1740.978] (-1743.104) (-1742.639) (-1742.047) * [-1741.910] (-1741.487) (-1741.346) (-1748.366) -- 0:00:12 830000 -- (-1749.356) (-1741.329) (-1742.568) [-1742.247] * (-1744.444) (-1741.376) [-1741.171] (-1745.367) -- 0:00:12 Average standard deviation of split frequencies: 0.008713 830500 -- (-1741.238) [-1741.710] (-1745.381) (-1741.945) * [-1742.101] (-1742.722) (-1743.343) (-1745.682) -- 0:00:12 831000 -- (-1747.041) (-1747.560) [-1743.472] (-1742.856) * [-1740.837] (-1740.866) (-1743.984) (-1742.336) -- 0:00:12 831500 -- [-1742.739] (-1745.760) (-1744.383) (-1742.567) * (-1740.834) [-1741.562] (-1743.633) (-1742.378) -- 0:00:12 832000 -- (-1741.752) (-1744.894) (-1743.962) [-1748.856] * (-1743.044) (-1744.525) (-1740.629) [-1742.329] -- 0:00:12 832500 -- [-1743.679] (-1746.090) (-1740.356) (-1743.830) * (-1740.876) (-1744.701) (-1741.631) [-1741.159] -- 0:00:12 833000 -- (-1743.395) (-1744.214) [-1740.481] (-1746.288) * (-1744.241) [-1743.351] (-1743.145) (-1742.680) -- 0:00:12 833500 -- (-1742.451) [-1741.440] (-1741.701) (-1744.252) * [-1741.945] (-1750.766) (-1745.438) (-1742.382) -- 0:00:11 834000 -- (-1742.532) (-1741.075) [-1740.693] (-1745.707) * (-1742.447) (-1742.642) (-1742.206) [-1742.779] -- 0:00:11 834500 -- (-1743.249) (-1744.759) [-1740.712] (-1743.652) * (-1741.382) (-1743.061) [-1740.887] (-1741.167) -- 0:00:11 835000 -- (-1742.914) [-1741.710] (-1742.269) (-1748.857) * (-1742.805) (-1741.618) (-1741.449) [-1740.693] -- 0:00:11 Average standard deviation of split frequencies: 0.008956 835500 -- [-1744.595] (-1742.800) (-1742.441) (-1741.973) * [-1743.549] (-1740.594) (-1744.603) (-1742.749) -- 0:00:11 836000 -- (-1742.411) [-1742.158] (-1744.837) (-1750.138) * (-1741.436) (-1742.527) [-1744.083] (-1742.739) -- 0:00:11 836500 -- (-1742.034) (-1744.415) [-1741.757] (-1747.855) * (-1741.301) (-1742.579) (-1746.000) [-1741.000] -- 0:00:11 837000 -- [-1743.465] (-1742.730) (-1743.050) (-1742.696) * (-1747.457) (-1742.882) [-1741.719] (-1742.013) -- 0:00:11 837500 -- (-1744.886) (-1741.735) [-1741.893] (-1741.907) * (-1742.970) (-1741.463) (-1742.056) [-1744.527] -- 0:00:11 838000 -- [-1743.475] (-1740.492) (-1742.483) (-1742.296) * (-1743.378) (-1742.836) (-1744.302) [-1744.329] -- 0:00:11 838500 -- [-1742.002] (-1741.363) (-1741.817) (-1743.082) * (-1741.519) [-1742.954] (-1742.280) (-1749.029) -- 0:00:11 839000 -- (-1744.689) (-1741.037) (-1742.905) [-1741.538] * (-1741.813) (-1741.093) (-1742.115) [-1740.627] -- 0:00:11 839500 -- [-1743.114] (-1741.725) (-1741.504) (-1746.354) * (-1747.752) (-1741.082) (-1744.508) [-1742.072] -- 0:00:11 840000 -- (-1748.231) [-1748.003] (-1745.457) (-1743.847) * (-1742.830) (-1740.953) [-1744.591] (-1743.856) -- 0:00:11 Average standard deviation of split frequencies: 0.009467 840500 -- [-1741.917] (-1747.480) (-1746.356) (-1741.705) * (-1745.136) [-1742.091] (-1747.774) (-1741.512) -- 0:00:11 841000 -- (-1743.316) (-1740.694) (-1744.391) [-1741.681] * [-1743.828] (-1742.594) (-1746.534) (-1743.842) -- 0:00:11 841500 -- (-1744.094) [-1741.064] (-1741.037) (-1742.696) * (-1741.487) [-1744.331] (-1748.205) (-1741.702) -- 0:00:11 842000 -- [-1741.103] (-1740.486) (-1740.647) (-1742.121) * [-1742.276] (-1747.446) (-1742.558) (-1741.474) -- 0:00:11 842500 -- (-1742.101) (-1743.184) (-1741.178) [-1741.835] * [-1741.537] (-1743.655) (-1745.975) (-1742.186) -- 0:00:11 843000 -- (-1741.686) [-1740.653] (-1741.839) (-1741.481) * (-1742.044) (-1744.231) [-1745.692] (-1744.993) -- 0:00:11 843500 -- (-1743.116) (-1741.402) (-1742.174) [-1740.668] * (-1741.734) (-1744.953) (-1740.871) [-1742.239] -- 0:00:11 844000 -- (-1744.357) [-1740.908] (-1747.019) (-1742.381) * (-1742.312) (-1745.075) (-1741.429) [-1741.006] -- 0:00:11 844500 -- (-1742.392) (-1741.618) [-1744.727] (-1745.954) * (-1745.595) (-1742.514) [-1744.273] (-1742.653) -- 0:00:11 845000 -- (-1740.529) [-1741.158] (-1744.975) (-1742.713) * (-1744.239) (-1745.080) [-1743.495] (-1745.196) -- 0:00:11 Average standard deviation of split frequencies: 0.009407 845500 -- (-1741.731) (-1741.991) (-1744.312) [-1742.515] * (-1741.766) (-1742.668) [-1744.774] (-1743.419) -- 0:00:11 846000 -- [-1742.279] (-1742.283) (-1742.789) (-1742.666) * (-1742.413) (-1742.664) (-1747.546) [-1741.095] -- 0:00:11 846500 -- (-1742.297) (-1743.778) (-1746.213) [-1742.914] * [-1744.785] (-1745.675) (-1744.507) (-1748.022) -- 0:00:11 847000 -- (-1740.565) [-1743.540] (-1749.810) (-1743.961) * (-1745.710) (-1748.475) (-1746.820) [-1744.376] -- 0:00:11 847500 -- (-1741.421) (-1744.040) (-1744.444) [-1742.635] * [-1743.483] (-1741.006) (-1745.671) (-1743.275) -- 0:00:10 848000 -- (-1742.883) (-1742.668) (-1742.367) [-1742.220] * [-1741.530] (-1742.644) (-1741.803) (-1742.990) -- 0:00:10 848500 -- (-1746.081) (-1742.494) [-1743.149] (-1743.129) * [-1744.156] (-1742.042) (-1741.306) (-1742.566) -- 0:00:10 849000 -- [-1741.527] (-1741.860) (-1742.227) (-1745.741) * [-1747.812] (-1741.996) (-1743.092) (-1743.952) -- 0:00:10 849500 -- (-1741.044) (-1743.936) (-1745.291) [-1741.619] * (-1746.048) (-1742.287) (-1743.891) [-1744.710] -- 0:00:10 850000 -- (-1744.634) (-1749.616) [-1743.786] (-1746.744) * [-1744.652] (-1742.552) (-1745.459) (-1742.267) -- 0:00:10 Average standard deviation of split frequencies: 0.009594 850500 -- (-1742.676) (-1748.041) [-1742.976] (-1742.097) * (-1742.572) (-1740.751) (-1742.967) [-1742.192] -- 0:00:10 851000 -- [-1741.832] (-1748.690) (-1742.651) (-1740.927) * [-1743.196] (-1742.411) (-1742.833) (-1741.646) -- 0:00:10 851500 -- (-1744.786) [-1741.534] (-1743.257) (-1741.610) * [-1742.304] (-1742.628) (-1743.615) (-1742.734) -- 0:00:10 852000 -- (-1741.511) (-1741.108) [-1740.799] (-1744.089) * (-1742.055) (-1742.812) (-1742.886) [-1741.766] -- 0:00:10 852500 -- (-1740.473) [-1741.163] (-1748.530) (-1747.361) * (-1740.943) (-1740.779) [-1743.023] (-1742.698) -- 0:00:10 853000 -- [-1743.144] (-1746.185) (-1745.263) (-1744.641) * [-1740.894] (-1743.852) (-1743.601) (-1741.523) -- 0:00:10 853500 -- (-1743.566) (-1743.617) (-1741.883) [-1741.075] * (-1742.700) [-1743.232] (-1742.482) (-1745.142) -- 0:00:10 854000 -- (-1743.151) (-1743.351) [-1741.604] (-1741.532) * (-1741.439) (-1741.810) (-1743.963) [-1742.864] -- 0:00:10 854500 -- (-1742.937) (-1745.317) [-1742.088] (-1742.144) * (-1742.258) (-1745.679) (-1741.126) [-1742.535] -- 0:00:10 855000 -- (-1743.323) (-1742.129) (-1741.328) [-1741.727] * [-1742.359] (-1746.853) (-1741.126) (-1742.999) -- 0:00:10 Average standard deviation of split frequencies: 0.009396 855500 -- (-1743.095) (-1741.322) [-1743.683] (-1740.944) * (-1741.970) (-1743.343) [-1744.948] (-1745.467) -- 0:00:10 856000 -- (-1741.587) [-1741.343] (-1744.509) (-1744.090) * (-1742.695) (-1745.204) (-1741.446) [-1743.194] -- 0:00:10 856500 -- [-1743.021] (-1742.218) (-1742.677) (-1741.308) * (-1741.656) [-1742.235] (-1740.844) (-1743.426) -- 0:00:10 857000 -- [-1741.646] (-1741.024) (-1744.361) (-1741.925) * [-1743.228] (-1742.082) (-1742.458) (-1742.048) -- 0:00:10 857500 -- (-1744.595) [-1742.344] (-1741.205) (-1744.160) * (-1744.591) (-1743.051) [-1742.167] (-1744.660) -- 0:00:10 858000 -- [-1744.661] (-1740.511) (-1743.291) (-1743.443) * [-1743.842] (-1740.815) (-1740.833) (-1748.867) -- 0:00:10 858500 -- (-1743.965) (-1740.513) [-1743.250] (-1743.228) * (-1745.712) (-1744.210) (-1741.141) [-1745.210] -- 0:00:10 859000 -- [-1742.977] (-1742.682) (-1743.396) (-1742.741) * (-1743.206) (-1743.279) [-1741.129] (-1742.949) -- 0:00:10 859500 -- [-1743.365] (-1742.908) (-1741.852) (-1741.543) * (-1743.650) (-1742.404) [-1740.595] (-1742.816) -- 0:00:10 860000 -- [-1743.054] (-1741.256) (-1744.593) (-1742.679) * [-1743.543] (-1743.949) (-1741.426) (-1741.092) -- 0:00:10 Average standard deviation of split frequencies: 0.009414 860500 -- (-1742.945) (-1742.746) [-1744.970] (-1743.539) * (-1741.886) (-1741.581) (-1742.027) [-1741.569] -- 0:00:10 861000 -- (-1744.495) (-1741.166) [-1742.036] (-1741.987) * (-1741.030) [-1742.391] (-1742.484) (-1742.969) -- 0:00:10 861500 -- [-1747.540] (-1742.761) (-1744.868) (-1740.416) * (-1740.800) (-1743.353) [-1742.617] (-1744.435) -- 0:00:09 862000 -- (-1743.786) [-1748.783] (-1740.576) (-1749.059) * (-1740.630) [-1744.853] (-1743.077) (-1742.390) -- 0:00:09 862500 -- (-1743.267) (-1745.862) (-1744.919) [-1741.935] * (-1740.689) (-1744.606) [-1741.639] (-1740.619) -- 0:00:09 863000 -- (-1744.980) (-1747.266) (-1747.216) [-1743.642] * [-1741.383] (-1742.143) (-1744.041) (-1741.187) -- 0:00:09 863500 -- [-1742.898] (-1746.207) (-1744.781) (-1743.884) * (-1741.180) (-1742.924) (-1742.759) [-1744.139] -- 0:00:09 864000 -- (-1743.091) (-1741.605) (-1745.578) [-1743.420] * (-1741.674) (-1741.299) [-1740.572] (-1742.898) -- 0:00:09 864500 -- (-1741.624) [-1745.814] (-1745.876) (-1743.129) * (-1741.674) (-1741.552) [-1743.877] (-1741.587) -- 0:00:09 865000 -- (-1742.461) (-1743.102) (-1744.179) [-1743.262] * (-1743.550) [-1742.258] (-1740.675) (-1743.693) -- 0:00:09 Average standard deviation of split frequencies: 0.008838 865500 -- (-1743.855) (-1743.843) (-1745.025) [-1744.529] * (-1741.007) (-1745.010) [-1742.639] (-1741.834) -- 0:00:09 866000 -- (-1740.897) (-1748.538) (-1744.475) [-1742.635] * (-1740.981) (-1741.762) (-1742.605) [-1740.633] -- 0:00:09 866500 -- (-1742.540) (-1741.936) [-1741.946] (-1746.569) * (-1741.007) (-1743.284) (-1742.922) [-1743.981] -- 0:00:09 867000 -- [-1740.852] (-1741.452) (-1744.979) (-1742.905) * (-1741.007) (-1744.202) (-1740.968) [-1746.510] -- 0:00:09 867500 -- (-1740.412) [-1743.182] (-1745.847) (-1741.272) * [-1740.889] (-1741.702) (-1743.427) (-1745.337) -- 0:00:09 868000 -- [-1740.351] (-1743.919) (-1741.272) (-1742.116) * [-1741.329] (-1743.221) (-1747.165) (-1744.392) -- 0:00:09 868500 -- (-1741.441) [-1743.335] (-1741.444) (-1743.486) * (-1741.524) (-1746.213) [-1744.818] (-1744.930) -- 0:00:09 869000 -- (-1741.982) (-1744.239) (-1742.900) [-1741.225] * (-1742.387) (-1740.661) (-1748.056) [-1743.685] -- 0:00:09 869500 -- (-1740.866) (-1743.345) (-1740.799) [-1740.822] * (-1742.159) [-1742.800] (-1743.186) (-1742.565) -- 0:00:09 870000 -- (-1745.881) [-1743.400] (-1741.252) (-1743.428) * (-1741.825) (-1741.402) [-1741.417] (-1743.916) -- 0:00:09 Average standard deviation of split frequencies: 0.009441 870500 -- (-1745.777) (-1743.153) [-1741.127] (-1742.820) * (-1742.553) (-1740.799) [-1742.797] (-1742.480) -- 0:00:09 871000 -- (-1742.734) (-1743.711) (-1741.225) [-1741.733] * (-1742.074) (-1741.081) [-1743.210] (-1743.274) -- 0:00:09 871500 -- [-1742.604] (-1740.963) (-1744.435) (-1744.506) * (-1742.316) [-1740.313] (-1742.802) (-1744.463) -- 0:00:09 872000 -- (-1742.256) (-1743.154) (-1747.310) [-1741.912] * (-1741.542) (-1741.434) (-1742.072) [-1742.639] -- 0:00:09 872500 -- (-1742.336) (-1746.320) [-1741.328] (-1745.295) * (-1742.171) (-1740.712) [-1742.393] (-1740.375) -- 0:00:09 873000 -- [-1743.124] (-1746.197) (-1740.452) (-1744.044) * [-1742.759] (-1743.208) (-1741.950) (-1741.263) -- 0:00:09 873500 -- [-1743.984] (-1743.394) (-1741.167) (-1741.594) * (-1743.759) [-1743.642] (-1742.688) (-1742.360) -- 0:00:08 874000 -- (-1741.662) (-1742.294) [-1742.400] (-1741.866) * [-1744.436] (-1744.382) (-1744.280) (-1745.493) -- 0:00:09 874500 -- (-1741.696) (-1742.163) (-1742.323) [-1741.706] * (-1743.944) (-1745.939) [-1741.941] (-1744.029) -- 0:00:09 875000 -- [-1744.571] (-1741.752) (-1740.482) (-1744.693) * (-1743.067) (-1745.340) [-1743.035] (-1743.453) -- 0:00:09 Average standard deviation of split frequencies: 0.009249 875500 -- (-1741.937) (-1742.779) [-1741.104] (-1742.802) * (-1747.850) (-1744.520) [-1741.675] (-1740.652) -- 0:00:08 876000 -- (-1743.709) [-1741.272] (-1740.533) (-1744.237) * (-1741.097) (-1743.556) (-1744.135) [-1742.012] -- 0:00:08 876500 -- (-1743.266) (-1742.693) [-1744.429] (-1746.241) * (-1743.420) (-1744.203) [-1742.069] (-1743.460) -- 0:00:08 877000 -- [-1741.569] (-1745.903) (-1742.560) (-1744.237) * (-1743.326) [-1745.249] (-1742.697) (-1741.197) -- 0:00:08 877500 -- (-1743.087) (-1743.853) [-1741.832] (-1743.560) * (-1742.750) [-1741.091] (-1744.939) (-1741.436) -- 0:00:08 878000 -- (-1746.470) [-1742.695] (-1742.227) (-1742.525) * (-1746.709) (-1747.150) (-1744.777) [-1741.368] -- 0:00:08 878500 -- (-1741.732) (-1741.056) [-1743.658] (-1741.714) * (-1747.224) (-1745.481) [-1744.996] (-1743.748) -- 0:00:08 879000 -- (-1742.407) (-1741.281) (-1744.038) [-1743.652] * (-1742.735) [-1741.447] (-1743.213) (-1742.627) -- 0:00:08 879500 -- (-1743.600) [-1743.228] (-1742.572) (-1741.257) * (-1741.168) (-1741.135) (-1744.822) [-1741.566] -- 0:00:08 880000 -- (-1741.614) (-1742.372) (-1745.365) [-1741.962] * (-1742.666) (-1742.587) [-1743.017] (-1741.697) -- 0:00:08 Average standard deviation of split frequencies: 0.009066 880500 -- (-1741.402) [-1744.265] (-1747.261) (-1744.727) * (-1745.222) (-1741.368) [-1741.824] (-1742.206) -- 0:00:08 881000 -- (-1741.836) (-1745.155) (-1746.169) [-1742.090] * (-1745.091) (-1741.665) [-1740.808] (-1744.151) -- 0:00:08 881500 -- (-1746.374) (-1743.638) (-1747.287) [-1742.700] * (-1743.360) (-1741.687) (-1743.975) [-1741.148] -- 0:00:08 882000 -- (-1741.640) [-1744.599] (-1741.110) (-1742.666) * [-1743.069] (-1741.396) (-1744.932) (-1742.512) -- 0:00:08 882500 -- (-1740.881) [-1743.912] (-1742.362) (-1742.680) * (-1744.350) (-1747.244) [-1745.808] (-1742.972) -- 0:00:08 883000 -- (-1742.494) [-1741.548] (-1741.343) (-1744.052) * (-1743.244) (-1740.521) (-1743.903) [-1741.470] -- 0:00:08 883500 -- (-1742.980) [-1741.375] (-1742.295) (-1743.471) * (-1743.972) (-1741.209) (-1746.836) [-1742.287] -- 0:00:08 884000 -- (-1741.862) (-1741.511) (-1741.397) [-1743.399] * [-1742.250] (-1741.310) (-1743.295) (-1742.412) -- 0:00:08 884500 -- (-1740.977) (-1744.766) [-1741.067] (-1742.714) * (-1741.488) (-1741.786) (-1742.004) [-1742.475] -- 0:00:08 885000 -- [-1743.365] (-1746.761) (-1742.096) (-1742.639) * (-1742.047) [-1742.284] (-1745.516) (-1742.373) -- 0:00:08 Average standard deviation of split frequencies: 0.009233 885500 -- (-1744.255) (-1742.275) (-1745.493) [-1740.895] * (-1743.090) (-1742.953) (-1742.083) [-1746.106] -- 0:00:08 886000 -- (-1743.806) (-1741.658) [-1741.394] (-1740.841) * (-1743.047) [-1744.873] (-1742.253) (-1747.195) -- 0:00:08 886500 -- (-1744.521) (-1741.447) [-1741.537] (-1742.369) * (-1742.253) [-1743.894] (-1741.710) (-1753.245) -- 0:00:08 887000 -- (-1744.649) (-1741.528) (-1745.207) [-1741.207] * [-1743.715] (-1743.220) (-1741.972) (-1742.630) -- 0:00:08 887500 -- [-1744.709] (-1741.816) (-1741.222) (-1740.494) * (-1741.698) [-1746.915] (-1743.310) (-1743.926) -- 0:00:07 888000 -- (-1745.944) [-1741.324] (-1742.674) (-1743.231) * [-1740.854] (-1746.198) (-1744.443) (-1743.569) -- 0:00:07 888500 -- (-1743.032) (-1747.984) [-1741.250] (-1742.147) * (-1742.394) [-1747.369] (-1746.115) (-1752.405) -- 0:00:08 889000 -- (-1742.254) (-1743.426) [-1741.994] (-1743.649) * (-1745.500) [-1744.089] (-1743.993) (-1743.677) -- 0:00:07 889500 -- (-1743.347) [-1742.134] (-1743.309) (-1743.880) * (-1743.741) (-1742.191) (-1743.889) [-1740.541] -- 0:00:07 890000 -- (-1743.318) [-1742.064] (-1746.739) (-1743.445) * (-1740.674) (-1742.423) [-1742.702] (-1740.822) -- 0:00:07 Average standard deviation of split frequencies: 0.009527 890500 -- (-1742.516) [-1745.501] (-1750.210) (-1743.763) * [-1747.519] (-1743.660) (-1747.590) (-1742.227) -- 0:00:07 891000 -- (-1742.810) (-1743.142) (-1742.969) [-1743.854] * (-1743.264) [-1741.517] (-1741.061) (-1743.305) -- 0:00:07 891500 -- (-1751.355) (-1745.267) [-1741.554] (-1742.335) * (-1743.196) [-1743.541] (-1740.277) (-1743.151) -- 0:00:07 892000 -- (-1741.487) (-1743.502) [-1742.528] (-1743.083) * (-1742.227) (-1741.863) [-1740.447] (-1751.087) -- 0:00:07 892500 -- (-1743.846) (-1745.159) (-1742.333) [-1742.685] * (-1742.501) (-1743.035) [-1744.706] (-1746.725) -- 0:00:07 893000 -- (-1747.081) (-1744.336) [-1741.615] (-1743.242) * (-1746.755) (-1746.963) [-1743.377] (-1742.548) -- 0:00:07 893500 -- (-1741.880) (-1747.468) [-1741.710] (-1741.117) * [-1744.241] (-1742.167) (-1741.515) (-1741.619) -- 0:00:07 894000 -- (-1745.075) (-1746.852) [-1740.942] (-1743.262) * [-1743.292] (-1743.124) (-1747.441) (-1741.277) -- 0:00:07 894500 -- [-1741.689] (-1752.010) (-1741.995) (-1742.694) * [-1745.971] (-1743.474) (-1746.449) (-1741.377) -- 0:00:07 895000 -- [-1743.177] (-1751.436) (-1741.188) (-1742.612) * [-1742.280] (-1741.875) (-1743.584) (-1742.477) -- 0:00:07 Average standard deviation of split frequencies: 0.009625 895500 -- (-1741.384) (-1742.354) [-1740.721] (-1741.487) * (-1748.199) (-1745.378) (-1741.023) [-1742.455] -- 0:00:07 896000 -- (-1742.871) (-1741.051) [-1741.446] (-1741.789) * (-1742.423) (-1741.157) [-1745.567] (-1745.862) -- 0:00:07 896500 -- (-1746.623) (-1742.918) [-1744.164] (-1741.555) * (-1742.215) [-1743.840] (-1744.305) (-1742.258) -- 0:00:07 897000 -- (-1743.408) (-1740.864) (-1743.784) [-1746.553] * [-1744.245] (-1747.226) (-1743.924) (-1744.227) -- 0:00:07 897500 -- (-1743.893) (-1746.631) [-1741.466] (-1746.166) * (-1743.317) (-1740.638) [-1746.091] (-1741.050) -- 0:00:07 898000 -- (-1741.908) [-1742.361] (-1743.304) (-1743.506) * (-1741.825) (-1743.583) (-1749.710) [-1741.617] -- 0:00:07 898500 -- [-1741.639] (-1741.747) (-1743.566) (-1743.079) * (-1740.530) (-1744.246) [-1743.390] (-1741.652) -- 0:00:07 899000 -- [-1741.425] (-1747.790) (-1745.931) (-1743.070) * (-1741.162) (-1743.870) (-1746.064) [-1742.084] -- 0:00:07 899500 -- (-1742.257) [-1747.122] (-1744.832) (-1742.810) * [-1740.508] (-1741.726) (-1745.439) (-1747.934) -- 0:00:07 900000 -- (-1743.316) (-1743.576) (-1743.665) [-1743.879] * (-1740.475) (-1741.781) (-1742.430) [-1742.346] -- 0:00:07 Average standard deviation of split frequencies: 0.010043 900500 -- (-1742.432) (-1744.152) [-1743.341] (-1744.088) * (-1740.567) (-1743.718) [-1743.816] (-1745.028) -- 0:00:07 901000 -- (-1741.349) (-1744.600) [-1742.243] (-1741.338) * (-1744.949) (-1743.419) [-1745.485] (-1752.999) -- 0:00:07 901500 -- [-1746.949] (-1746.383) (-1743.441) (-1742.482) * (-1745.501) (-1741.402) (-1745.386) [-1743.439] -- 0:00:06 902000 -- (-1745.005) [-1742.294] (-1745.791) (-1741.653) * (-1745.450) (-1741.111) [-1741.411] (-1744.665) -- 0:00:06 902500 -- (-1742.428) [-1742.071] (-1745.431) (-1744.179) * (-1740.704) [-1742.671] (-1742.303) (-1750.025) -- 0:00:06 903000 -- [-1743.816] (-1741.469) (-1745.418) (-1743.954) * (-1741.868) [-1744.326] (-1741.407) (-1746.936) -- 0:00:06 903500 -- (-1743.013) (-1741.366) [-1744.334] (-1741.618) * (-1744.638) [-1742.579] (-1745.180) (-1746.068) -- 0:00:06 904000 -- (-1742.575) [-1744.237] (-1741.217) (-1742.726) * [-1741.369] (-1742.740) (-1742.384) (-1743.192) -- 0:00:06 904500 -- [-1743.868] (-1741.317) (-1741.341) (-1742.894) * (-1742.714) (-1743.626) (-1744.578) [-1742.306] -- 0:00:06 905000 -- (-1743.539) [-1744.939] (-1741.693) (-1743.983) * [-1744.498] (-1742.238) (-1742.984) (-1742.314) -- 0:00:06 Average standard deviation of split frequencies: 0.010341 905500 -- (-1749.110) (-1743.049) [-1743.931] (-1741.450) * (-1748.358) (-1741.182) [-1743.476] (-1743.872) -- 0:00:06 906000 -- (-1745.172) (-1741.773) [-1745.939] (-1743.192) * [-1741.898] (-1741.247) (-1741.568) (-1742.597) -- 0:00:06 906500 -- (-1745.160) [-1742.128] (-1741.211) (-1742.835) * (-1741.643) (-1742.176) [-1740.623] (-1742.354) -- 0:00:06 907000 -- (-1741.638) [-1740.629] (-1741.835) (-1741.385) * (-1743.797) [-1743.848] (-1745.556) (-1740.367) -- 0:00:06 907500 -- [-1744.060] (-1742.337) (-1743.134) (-1741.328) * (-1745.061) [-1742.080] (-1744.653) (-1743.568) -- 0:00:06 908000 -- [-1741.170] (-1741.964) (-1743.068) (-1744.739) * (-1743.967) (-1742.474) (-1741.547) [-1747.793] -- 0:00:06 908500 -- (-1744.610) (-1750.626) (-1741.863) [-1744.338] * (-1746.256) (-1741.396) (-1745.677) [-1744.791] -- 0:00:06 909000 -- (-1742.384) (-1741.856) (-1746.576) [-1743.906] * (-1746.126) (-1743.593) (-1743.905) [-1742.080] -- 0:00:06 909500 -- (-1743.136) (-1746.325) (-1743.567) [-1743.179] * [-1743.178] (-1741.794) (-1741.242) (-1740.651) -- 0:00:06 910000 -- (-1742.652) (-1744.408) [-1742.022] (-1744.407) * [-1741.648] (-1742.251) (-1742.099) (-1743.096) -- 0:00:06 Average standard deviation of split frequencies: 0.010385 910500 -- (-1741.584) (-1742.759) [-1744.742] (-1744.658) * (-1743.824) [-1741.314] (-1742.186) (-1742.750) -- 0:00:06 911000 -- (-1741.785) [-1743.088] (-1743.771) (-1744.897) * (-1743.884) [-1741.512] (-1744.949) (-1743.163) -- 0:00:06 911500 -- (-1744.701) [-1744.630] (-1743.385) (-1744.053) * (-1742.424) (-1741.687) (-1744.944) [-1746.568] -- 0:00:06 912000 -- (-1743.219) (-1743.525) (-1744.861) [-1744.401] * (-1742.055) (-1741.186) (-1744.080) [-1743.967] -- 0:00:06 912500 -- (-1740.511) [-1742.765] (-1745.492) (-1743.641) * (-1740.393) (-1742.874) (-1742.812) [-1743.204] -- 0:00:06 913000 -- [-1742.318] (-1741.733) (-1745.682) (-1742.635) * [-1741.866] (-1744.983) (-1747.651) (-1743.531) -- 0:00:06 913500 -- [-1741.129] (-1742.310) (-1742.247) (-1743.219) * (-1742.036) (-1742.520) (-1742.955) [-1745.529] -- 0:00:06 914000 -- [-1741.701] (-1741.599) (-1742.652) (-1742.970) * (-1744.366) (-1744.511) (-1743.406) [-1741.203] -- 0:00:06 914500 -- (-1743.074) (-1742.604) [-1743.615] (-1741.779) * (-1745.950) (-1751.002) [-1741.595] (-1742.577) -- 0:00:06 915000 -- (-1745.611) [-1741.511] (-1743.994) (-1742.491) * (-1744.326) (-1741.387) (-1741.241) [-1746.102] -- 0:00:06 Average standard deviation of split frequencies: 0.009939 915500 -- (-1745.012) [-1743.183] (-1741.941) (-1747.128) * (-1741.484) (-1744.695) [-1743.668] (-1742.850) -- 0:00:05 916000 -- (-1743.995) (-1742.777) [-1742.021] (-1748.500) * (-1740.861) (-1752.416) (-1745.514) [-1743.600] -- 0:00:06 916500 -- (-1741.137) [-1742.271] (-1741.819) (-1744.567) * (-1740.861) (-1749.909) [-1741.840] (-1742.873) -- 0:00:06 917000 -- (-1742.017) (-1743.736) (-1742.187) [-1744.122] * (-1743.324) (-1742.792) (-1741.092) [-1744.059] -- 0:00:05 917500 -- [-1741.251] (-1742.560) (-1741.771) (-1745.256) * (-1741.005) [-1744.355] (-1748.249) (-1744.881) -- 0:00:05 918000 -- [-1743.273] (-1742.516) (-1743.701) (-1742.574) * (-1745.658) [-1743.885] (-1746.835) (-1742.050) -- 0:00:05 918500 -- [-1741.257] (-1741.826) (-1742.942) (-1742.221) * (-1744.202) (-1746.748) (-1743.324) [-1741.307] -- 0:00:05 919000 -- (-1747.062) [-1743.593] (-1743.743) (-1745.150) * (-1744.617) (-1743.018) [-1744.915] (-1740.677) -- 0:00:05 919500 -- (-1743.147) [-1741.911] (-1746.420) (-1741.270) * (-1740.463) (-1742.993) (-1749.545) [-1744.787] -- 0:00:05 920000 -- [-1742.307] (-1742.490) (-1746.098) (-1742.316) * (-1740.471) [-1741.437] (-1745.642) (-1741.626) -- 0:00:05 Average standard deviation of split frequencies: 0.009952 920500 -- (-1743.889) (-1743.959) (-1744.302) [-1745.742] * (-1740.801) [-1743.712] (-1745.435) (-1747.140) -- 0:00:05 921000 -- (-1746.218) (-1745.400) (-1742.609) [-1743.397] * [-1742.118] (-1740.693) (-1741.477) (-1744.044) -- 0:00:05 921500 -- (-1742.691) (-1742.011) (-1742.082) [-1744.585] * (-1741.166) [-1742.110] (-1741.872) (-1742.386) -- 0:00:05 922000 -- (-1743.252) (-1743.832) (-1741.302) [-1741.931] * (-1740.827) [-1744.597] (-1742.316) (-1743.950) -- 0:00:05 922500 -- (-1745.494) (-1742.542) [-1742.154] (-1742.698) * (-1740.792) (-1743.971) (-1743.806) [-1742.419] -- 0:00:05 923000 -- (-1741.777) (-1742.653) [-1740.637] (-1743.708) * [-1740.910] (-1742.204) (-1742.507) (-1741.281) -- 0:00:05 923500 -- [-1744.142] (-1745.592) (-1744.954) (-1745.088) * (-1746.112) (-1741.852) (-1744.824) [-1743.437] -- 0:00:05 924000 -- (-1743.790) [-1740.525] (-1741.707) (-1741.537) * (-1745.879) (-1742.602) (-1743.045) [-1743.289] -- 0:00:05 924500 -- (-1744.676) [-1741.771] (-1740.629) (-1741.334) * [-1740.557] (-1742.059) (-1741.750) (-1743.294) -- 0:00:05 925000 -- (-1743.399) (-1741.091) [-1740.864] (-1743.500) * (-1742.600) (-1743.901) (-1742.439) [-1743.062] -- 0:00:05 Average standard deviation of split frequencies: 0.010182 925500 -- (-1742.577) [-1741.533] (-1740.714) (-1742.829) * (-1744.247) [-1742.224] (-1741.572) (-1741.536) -- 0:00:05 926000 -- (-1745.774) [-1742.506] (-1744.264) (-1741.719) * [-1743.788] (-1742.431) (-1744.526) (-1744.757) -- 0:00:05 926500 -- [-1742.421] (-1742.419) (-1744.326) (-1742.036) * (-1743.570) [-1742.320] (-1743.673) (-1748.649) -- 0:00:05 927000 -- (-1742.476) (-1743.397) (-1746.993) [-1740.938] * (-1745.475) (-1744.007) (-1740.672) [-1743.215] -- 0:00:05 927500 -- [-1742.608] (-1741.618) (-1742.975) (-1741.739) * [-1741.851] (-1743.803) (-1742.256) (-1744.516) -- 0:00:05 928000 -- [-1742.391] (-1742.243) (-1741.934) (-1744.242) * (-1740.730) [-1741.190] (-1745.037) (-1741.821) -- 0:00:05 928500 -- (-1742.368) (-1741.198) [-1741.101] (-1741.810) * (-1742.436) [-1741.305] (-1742.402) (-1741.241) -- 0:00:05 929000 -- (-1746.432) (-1741.817) (-1742.204) [-1744.421] * (-1743.629) (-1741.429) [-1740.796] (-1743.903) -- 0:00:05 929500 -- (-1744.803) (-1747.232) (-1741.799) [-1742.013] * (-1745.705) [-1741.429] (-1741.929) (-1741.554) -- 0:00:05 930000 -- (-1746.420) (-1743.989) [-1742.269] (-1743.004) * [-1742.377] (-1741.295) (-1741.389) (-1743.002) -- 0:00:04 Average standard deviation of split frequencies: 0.010257 930500 -- (-1743.244) [-1742.423] (-1740.988) (-1742.405) * (-1742.325) (-1741.872) [-1742.003] (-1742.017) -- 0:00:05 931000 -- [-1745.724] (-1742.089) (-1742.697) (-1741.655) * (-1741.315) (-1741.543) (-1745.220) [-1740.979] -- 0:00:04 931500 -- (-1743.037) (-1744.482) (-1740.522) [-1742.209] * (-1741.716) [-1741.373] (-1747.816) (-1742.864) -- 0:00:04 932000 -- (-1744.772) (-1742.688) (-1741.447) [-1741.572] * (-1741.308) (-1742.029) (-1744.776) [-1741.660] -- 0:00:04 932500 -- (-1742.822) (-1743.459) [-1740.636] (-1743.041) * (-1742.218) (-1743.386) (-1742.248) [-1742.590] -- 0:00:04 933000 -- [-1742.183] (-1742.188) (-1741.789) (-1743.290) * (-1741.555) (-1744.369) [-1742.046] (-1744.748) -- 0:00:04 933500 -- [-1741.172] (-1743.056) (-1743.274) (-1741.140) * [-1741.134] (-1741.673) (-1742.627) (-1743.093) -- 0:00:04 934000 -- [-1741.368] (-1741.692) (-1741.843) (-1743.232) * (-1744.300) [-1746.142] (-1742.271) (-1742.153) -- 0:00:04 934500 -- (-1742.105) (-1742.283) (-1743.763) [-1741.606] * [-1743.567] (-1743.458) (-1741.896) (-1742.885) -- 0:00:04 935000 -- (-1740.716) [-1742.723] (-1743.642) (-1741.527) * (-1741.122) (-1745.361) [-1744.685] (-1745.104) -- 0:00:04 Average standard deviation of split frequencies: 0.010140 935500 -- (-1741.366) (-1742.825) [-1742.023] (-1745.559) * (-1741.585) [-1741.583] (-1741.018) (-1747.085) -- 0:00:04 936000 -- (-1742.924) [-1744.974] (-1745.831) (-1744.199) * (-1741.859) [-1743.958] (-1740.906) (-1744.267) -- 0:00:04 936500 -- (-1743.425) (-1743.633) (-1740.719) [-1744.133] * (-1741.986) (-1742.861) [-1741.330] (-1742.311) -- 0:00:04 937000 -- (-1746.703) (-1746.124) [-1740.645] (-1744.164) * [-1742.686] (-1748.344) (-1743.322) (-1746.844) -- 0:00:04 937500 -- (-1742.117) (-1741.960) (-1741.707) [-1744.127] * [-1740.786] (-1745.171) (-1745.277) (-1742.640) -- 0:00:04 938000 -- [-1741.372] (-1742.559) (-1740.511) (-1742.016) * (-1741.141) (-1741.409) [-1740.380] (-1742.756) -- 0:00:04 938500 -- (-1740.706) [-1742.558] (-1741.615) (-1741.774) * (-1741.646) (-1742.759) (-1741.646) [-1745.371] -- 0:00:04 939000 -- (-1742.529) (-1741.861) [-1740.916] (-1741.119) * (-1742.148) (-1746.686) (-1742.078) [-1742.757] -- 0:00:04 939500 -- (-1741.132) (-1740.682) [-1742.659] (-1742.021) * (-1744.483) (-1746.098) (-1740.916) [-1742.026] -- 0:00:04 940000 -- (-1743.871) [-1741.158] (-1743.019) (-1742.036) * [-1743.234] (-1747.123) (-1743.468) (-1742.508) -- 0:00:04 Average standard deviation of split frequencies: 0.010223 940500 -- (-1742.874) (-1741.277) (-1744.040) [-1742.660] * (-1743.164) [-1741.477] (-1744.172) (-1742.441) -- 0:00:04 941000 -- (-1742.812) (-1748.323) [-1743.567] (-1740.480) * [-1742.803] (-1746.467) (-1743.015) (-1742.980) -- 0:00:04 941500 -- (-1744.039) (-1741.688) [-1742.576] (-1742.429) * (-1744.345) (-1748.897) [-1741.593] (-1742.723) -- 0:00:04 942000 -- (-1742.746) [-1743.380] (-1743.749) (-1742.629) * (-1745.456) (-1745.631) [-1742.108] (-1743.961) -- 0:00:04 942500 -- (-1742.054) (-1743.042) (-1741.296) [-1743.015] * (-1742.933) (-1741.667) [-1742.931] (-1743.825) -- 0:00:04 943000 -- (-1741.831) (-1741.688) (-1742.025) [-1746.424] * (-1745.272) (-1741.917) [-1742.542] (-1743.135) -- 0:00:04 943500 -- (-1740.610) (-1741.156) [-1741.579] (-1747.406) * (-1744.269) (-1742.533) (-1742.696) [-1742.620] -- 0:00:04 944000 -- (-1741.744) [-1743.728] (-1741.579) (-1740.795) * (-1743.774) (-1746.485) (-1741.783) [-1740.909] -- 0:00:03 944500 -- [-1741.921] (-1745.990) (-1743.030) (-1744.803) * (-1741.884) (-1742.279) [-1743.603] (-1741.830) -- 0:00:03 945000 -- [-1743.524] (-1742.877) (-1740.790) (-1742.639) * [-1740.563] (-1741.314) (-1742.007) (-1741.781) -- 0:00:03 Average standard deviation of split frequencies: 0.010265 945500 -- [-1741.517] (-1741.596) (-1743.296) (-1743.708) * [-1741.976] (-1741.533) (-1741.878) (-1742.050) -- 0:00:03 946000 -- [-1744.337] (-1744.790) (-1740.798) (-1742.230) * [-1740.942] (-1742.878) (-1742.008) (-1741.254) -- 0:00:03 946500 -- (-1744.331) (-1743.666) (-1742.642) [-1748.770] * [-1741.570] (-1743.680) (-1741.271) (-1741.131) -- 0:00:03 947000 -- [-1742.986] (-1743.159) (-1740.384) (-1740.950) * (-1742.170) (-1743.837) (-1745.141) [-1741.179] -- 0:00:03 947500 -- (-1745.644) (-1742.523) (-1741.426) [-1741.530] * (-1740.987) (-1743.259) (-1742.147) [-1741.773] -- 0:00:03 948000 -- (-1742.684) (-1743.514) [-1741.573] (-1741.347) * (-1740.804) [-1741.551] (-1747.795) (-1741.241) -- 0:00:03 948500 -- (-1741.552) (-1740.786) [-1747.628] (-1741.468) * [-1742.168] (-1746.516) (-1745.860) (-1740.771) -- 0:00:03 949000 -- (-1741.658) [-1741.269] (-1743.049) (-1743.796) * (-1746.296) [-1740.978] (-1741.512) (-1741.781) -- 0:00:03 949500 -- [-1742.589] (-1742.270) (-1742.020) (-1744.954) * (-1743.747) (-1741.464) (-1741.770) [-1742.131] -- 0:00:03 950000 -- (-1746.951) (-1747.146) [-1742.638] (-1741.413) * (-1741.103) (-1742.091) (-1741.275) [-1741.506] -- 0:00:03 Average standard deviation of split frequencies: 0.009851 950500 -- (-1741.583) (-1742.582) [-1741.214] (-1743.592) * [-1740.823] (-1742.247) (-1740.642) (-1744.636) -- 0:00:03 951000 -- [-1742.171] (-1744.056) (-1742.429) (-1745.365) * (-1741.541) (-1741.772) [-1740.575] (-1744.766) -- 0:00:03 951500 -- (-1741.532) (-1743.281) [-1742.362] (-1743.320) * (-1741.507) (-1743.342) [-1740.703] (-1741.229) -- 0:00:03 952000 -- [-1741.345] (-1743.289) (-1741.489) (-1744.065) * (-1741.321) (-1742.190) (-1741.287) [-1743.244] -- 0:00:03 952500 -- (-1743.597) (-1741.905) (-1742.000) [-1747.073] * [-1741.321] (-1747.261) (-1741.378) (-1745.226) -- 0:00:03 953000 -- [-1741.102] (-1742.228) (-1745.281) (-1748.491) * [-1741.944] (-1742.134) (-1742.710) (-1744.482) -- 0:00:03 953500 -- (-1740.732) (-1742.278) (-1747.092) [-1746.613] * (-1742.233) [-1741.541] (-1744.916) (-1744.158) -- 0:00:03 954000 -- (-1744.755) (-1741.457) [-1746.970] (-1744.738) * (-1742.274) [-1743.436] (-1742.500) (-1743.556) -- 0:00:03 954500 -- (-1744.773) [-1742.135] (-1743.674) (-1740.417) * [-1741.433] (-1743.808) (-1741.790) (-1741.350) -- 0:00:03 955000 -- [-1744.520] (-1744.665) (-1742.074) (-1742.108) * (-1741.737) (-1742.854) (-1744.797) [-1742.423] -- 0:00:03 Average standard deviation of split frequencies: 0.009665 955500 -- [-1741.752] (-1741.981) (-1741.214) (-1742.739) * (-1741.804) (-1740.698) (-1744.183) [-1740.862] -- 0:00:03 956000 -- [-1743.277] (-1740.700) (-1743.401) (-1741.772) * (-1741.866) (-1740.766) [-1744.019] (-1743.684) -- 0:00:03 956500 -- [-1742.518] (-1741.103) (-1741.866) (-1749.705) * [-1741.036] (-1743.549) (-1742.825) (-1742.191) -- 0:00:03 957000 -- (-1742.528) (-1741.276) (-1743.488) [-1743.433] * (-1744.070) (-1741.075) (-1742.238) [-1740.934] -- 0:00:03 957500 -- (-1741.652) (-1743.927) (-1744.311) [-1744.496] * (-1744.537) [-1743.464] (-1744.866) (-1745.915) -- 0:00:03 958000 -- (-1742.387) (-1742.469) (-1744.738) [-1744.660] * (-1743.416) (-1741.553) [-1742.217] (-1741.895) -- 0:00:02 958500 -- (-1742.827) (-1744.188) (-1740.717) [-1741.102] * (-1741.444) [-1745.149] (-1743.320) (-1744.557) -- 0:00:02 959000 -- (-1742.639) (-1743.636) (-1742.838) [-1742.103] * (-1742.875) (-1742.585) (-1741.979) [-1743.093] -- 0:00:02 959500 -- (-1741.787) (-1742.877) [-1742.190] (-1741.421) * [-1742.178] (-1744.848) (-1742.749) (-1743.180) -- 0:00:02 960000 -- (-1742.986) (-1743.161) (-1740.753) [-1744.633] * (-1744.314) (-1746.332) [-1746.229] (-1742.754) -- 0:00:02 Average standard deviation of split frequencies: 0.009225 960500 -- (-1742.069) (-1741.365) [-1742.197] (-1742.802) * (-1741.082) (-1744.466) (-1745.347) [-1741.873] -- 0:00:02 961000 -- (-1741.667) (-1743.181) (-1742.159) [-1744.276] * (-1742.059) (-1742.223) (-1745.965) [-1743.097] -- 0:00:02 961500 -- [-1745.722] (-1743.309) (-1742.780) (-1743.211) * (-1743.312) [-1741.600] (-1742.245) (-1742.511) -- 0:00:02 962000 -- (-1747.154) (-1744.221) (-1743.207) [-1742.283] * (-1741.856) [-1747.522] (-1742.146) (-1744.198) -- 0:00:02 962500 -- (-1745.413) (-1744.259) [-1742.854] (-1741.063) * [-1743.459] (-1740.939) (-1743.669) (-1741.985) -- 0:00:02 963000 -- (-1744.138) (-1751.455) (-1747.665) [-1741.416] * (-1741.773) (-1743.000) [-1741.517] (-1744.282) -- 0:00:02 963500 -- [-1744.857] (-1744.372) (-1740.799) (-1742.592) * (-1741.140) (-1744.202) [-1741.980] (-1742.259) -- 0:00:02 964000 -- (-1742.820) (-1746.952) (-1740.616) [-1742.962] * (-1743.155) (-1742.171) (-1744.011) [-1741.797] -- 0:00:02 964500 -- (-1745.970) (-1742.419) (-1740.628) [-1743.042] * (-1746.281) (-1743.208) [-1743.285] (-1742.863) -- 0:00:02 965000 -- (-1743.565) (-1744.782) [-1741.272] (-1742.896) * [-1742.055] (-1745.166) (-1745.397) (-1743.083) -- 0:00:02 Average standard deviation of split frequencies: 0.009272 965500 -- (-1742.180) [-1741.553] (-1742.527) (-1744.771) * (-1744.650) (-1741.857) [-1741.160] (-1741.273) -- 0:00:02 966000 -- [-1741.384] (-1747.211) (-1745.073) (-1742.000) * (-1743.784) (-1742.001) [-1740.765] (-1740.742) -- 0:00:02 966500 -- (-1742.347) [-1745.222] (-1742.128) (-1741.461) * (-1744.877) [-1742.081] (-1746.119) (-1741.417) -- 0:00:02 967000 -- (-1742.084) (-1743.010) [-1743.922] (-1745.450) * (-1742.602) (-1741.700) (-1748.082) [-1742.578] -- 0:00:02 967500 -- (-1742.639) [-1742.491] (-1742.106) (-1741.694) * (-1744.857) [-1742.559] (-1744.038) (-1742.466) -- 0:00:02 968000 -- (-1744.301) (-1743.105) (-1741.913) [-1742.228] * (-1743.584) [-1741.664] (-1742.441) (-1742.861) -- 0:00:02 968500 -- (-1745.918) (-1741.735) (-1745.386) [-1743.691] * (-1747.651) (-1742.074) [-1742.102] (-1741.235) -- 0:00:02 969000 -- [-1741.035] (-1741.763) (-1742.045) (-1742.578) * (-1742.900) (-1742.604) [-1741.882] (-1741.565) -- 0:00:02 969500 -- (-1744.469) (-1741.233) [-1741.998] (-1741.671) * (-1745.636) [-1743.548] (-1740.775) (-1745.208) -- 0:00:02 970000 -- (-1741.137) (-1741.160) [-1741.696] (-1741.820) * (-1742.024) (-1741.173) [-1742.175] (-1743.701) -- 0:00:02 Average standard deviation of split frequencies: 0.008742 970500 -- (-1741.279) (-1745.567) (-1741.952) [-1742.299] * (-1741.665) (-1744.151) [-1741.390] (-1745.601) -- 0:00:02 971000 -- (-1744.740) (-1742.447) [-1741.864] (-1742.299) * (-1742.894) (-1743.019) [-1744.555] (-1744.520) -- 0:00:02 971500 -- (-1741.600) (-1740.782) (-1741.514) [-1741.690] * (-1743.998) (-1742.312) (-1743.297) [-1743.158] -- 0:00:02 972000 -- (-1741.075) (-1744.863) (-1748.534) [-1741.220] * (-1745.272) (-1741.735) (-1741.620) [-1741.587] -- 0:00:01 972500 -- (-1744.692) [-1741.773] (-1751.276) (-1744.247) * (-1742.842) (-1743.246) (-1742.954) [-1742.979] -- 0:00:01 973000 -- (-1747.539) (-1741.636) [-1742.870] (-1741.843) * [-1742.655] (-1743.117) (-1745.859) (-1741.309) -- 0:00:01 973500 -- [-1741.230] (-1741.086) (-1745.629) (-1741.824) * (-1742.488) (-1744.207) [-1742.167] (-1742.163) -- 0:00:01 974000 -- (-1744.486) (-1744.838) [-1746.680] (-1742.488) * (-1741.217) [-1742.110] (-1743.582) (-1742.576) -- 0:00:01 974500 -- (-1740.899) (-1742.603) (-1743.046) [-1741.333] * (-1740.556) [-1742.829] (-1741.096) (-1744.403) -- 0:00:01 975000 -- (-1747.135) (-1742.162) [-1740.540] (-1741.570) * (-1742.106) (-1745.948) (-1741.021) [-1741.881] -- 0:00:01 Average standard deviation of split frequencies: 0.008630 975500 -- (-1745.768) (-1741.195) (-1741.971) [-1742.096] * (-1741.648) [-1743.450] (-1743.320) (-1744.306) -- 0:00:01 976000 -- [-1746.455] (-1742.763) (-1743.061) (-1742.875) * (-1740.397) [-1741.111] (-1741.237) (-1741.978) -- 0:00:01 976500 -- [-1742.215] (-1742.815) (-1741.477) (-1742.666) * [-1743.647] (-1741.239) (-1740.480) (-1740.962) -- 0:00:01 977000 -- [-1742.472] (-1742.733) (-1742.848) (-1742.055) * (-1742.582) (-1740.849) [-1740.833] (-1740.565) -- 0:00:01 977500 -- (-1742.472) (-1743.870) [-1742.554] (-1742.564) * (-1743.171) (-1740.976) [-1742.830] (-1740.533) -- 0:00:01 978000 -- [-1742.756] (-1744.240) (-1750.957) (-1742.920) * (-1743.531) (-1741.627) (-1741.033) [-1741.426] -- 0:00:01 978500 -- (-1741.410) [-1742.586] (-1745.438) (-1742.279) * [-1742.212] (-1741.625) (-1741.399) (-1745.109) -- 0:00:01 979000 -- (-1743.202) (-1740.875) [-1744.792] (-1742.994) * (-1744.273) [-1740.362] (-1744.036) (-1743.000) -- 0:00:01 979500 -- (-1742.728) [-1741.460] (-1742.066) (-1742.024) * (-1743.929) [-1742.306] (-1742.296) (-1743.218) -- 0:00:01 980000 -- (-1744.597) (-1741.759) (-1745.435) [-1742.247] * (-1741.278) (-1740.524) (-1742.330) [-1743.760] -- 0:00:01 Average standard deviation of split frequencies: 0.008236 980500 -- (-1743.464) (-1740.756) [-1742.873] (-1741.307) * (-1749.230) [-1741.377] (-1746.101) (-1743.240) -- 0:00:01 981000 -- (-1744.619) (-1744.066) [-1742.615] (-1741.336) * (-1743.826) (-1740.985) (-1744.463) [-1745.023] -- 0:00:01 981500 -- [-1741.644] (-1742.631) (-1744.253) (-1744.283) * (-1742.685) (-1742.448) (-1742.195) [-1742.108] -- 0:00:01 982000 -- (-1742.493) (-1749.047) (-1745.205) [-1746.324] * (-1742.618) [-1740.694] (-1753.227) (-1742.087) -- 0:00:01 982500 -- (-1742.421) [-1749.858] (-1742.831) (-1750.140) * [-1743.096] (-1741.153) (-1743.261) (-1743.025) -- 0:00:01 983000 -- [-1743.958] (-1741.936) (-1742.907) (-1747.945) * (-1745.304) [-1741.075] (-1743.893) (-1744.472) -- 0:00:01 983500 -- [-1740.970] (-1741.609) (-1745.229) (-1747.781) * (-1742.612) [-1742.699] (-1743.400) (-1743.283) -- 0:00:01 984000 -- (-1740.890) (-1741.724) [-1743.582] (-1743.319) * (-1742.267) (-1742.612) [-1741.590] (-1742.092) -- 0:00:01 984500 -- (-1743.678) (-1748.212) [-1741.768] (-1742.460) * (-1742.292) [-1745.343] (-1743.071) (-1742.156) -- 0:00:01 985000 -- (-1748.505) (-1741.796) (-1742.565) [-1741.793] * [-1741.398] (-1746.055) (-1743.372) (-1742.502) -- 0:00:01 Average standard deviation of split frequencies: 0.008160 985500 -- (-1755.732) (-1743.784) [-1742.005] (-1742.475) * (-1741.813) [-1741.447] (-1741.644) (-1741.971) -- 0:00:01 986000 -- (-1742.242) (-1741.429) [-1740.882] (-1742.311) * (-1743.165) (-1741.431) [-1742.480] (-1741.619) -- 0:00:00 986500 -- (-1741.911) (-1745.858) (-1743.649) [-1741.947] * (-1741.690) (-1742.842) [-1740.441] (-1743.918) -- 0:00:00 987000 -- [-1744.101] (-1742.461) (-1741.824) (-1743.790) * [-1742.838] (-1746.813) (-1744.201) (-1746.682) -- 0:00:00 987500 -- (-1742.919) (-1742.684) [-1742.370] (-1746.332) * (-1742.495) [-1742.572] (-1742.230) (-1746.000) -- 0:00:00 988000 -- (-1743.447) (-1744.617) [-1742.612] (-1745.465) * (-1744.499) (-1743.538) [-1744.973] (-1743.491) -- 0:00:00 988500 -- [-1743.088] (-1744.577) (-1743.530) (-1742.164) * [-1742.619] (-1743.138) (-1742.471) (-1743.842) -- 0:00:00 989000 -- (-1741.245) (-1745.570) (-1743.520) [-1742.091] * (-1743.416) (-1743.214) [-1743.234] (-1747.576) -- 0:00:00 989500 -- [-1740.894] (-1744.717) (-1741.633) (-1743.224) * (-1745.397) [-1747.724] (-1742.334) (-1742.062) -- 0:00:00 990000 -- [-1742.028] (-1743.285) (-1741.629) (-1746.880) * [-1743.599] (-1743.748) (-1740.556) (-1745.949) -- 0:00:00 Average standard deviation of split frequencies: 0.008216 990500 -- (-1741.491) [-1748.600] (-1741.976) (-1741.697) * (-1744.635) (-1741.943) [-1742.555] (-1742.503) -- 0:00:00 991000 -- (-1742.768) [-1742.449] (-1749.109) (-1740.597) * (-1745.124) (-1746.391) [-1741.662] (-1741.291) -- 0:00:00 991500 -- [-1744.094] (-1744.940) (-1748.356) (-1741.352) * [-1743.352] (-1742.602) (-1746.300) (-1741.414) -- 0:00:00 992000 -- [-1743.964] (-1742.317) (-1742.434) (-1741.723) * [-1741.774] (-1742.757) (-1741.494) (-1743.429) -- 0:00:00 992500 -- (-1744.716) (-1740.882) [-1742.537] (-1743.113) * (-1741.127) (-1747.506) (-1740.816) [-1741.650] -- 0:00:00 993000 -- [-1744.056] (-1745.134) (-1742.083) (-1743.383) * (-1741.255) [-1741.002] (-1741.278) (-1741.216) -- 0:00:00 993500 -- (-1742.407) (-1743.262) (-1743.348) [-1741.885] * (-1741.553) (-1741.799) [-1741.778] (-1740.870) -- 0:00:00 994000 -- (-1742.312) (-1743.436) [-1741.045] (-1743.833) * (-1741.993) (-1745.359) (-1740.864) [-1741.414] -- 0:00:00 994500 -- (-1744.693) (-1744.848) (-1741.848) [-1741.956] * (-1741.965) (-1742.047) [-1747.982] (-1741.645) -- 0:00:00 995000 -- [-1743.199] (-1741.510) (-1741.337) (-1741.709) * (-1741.001) (-1742.616) (-1743.740) [-1742.240] -- 0:00:00 Average standard deviation of split frequencies: 0.007888 995500 -- (-1743.594) (-1743.252) [-1745.534] (-1744.277) * (-1744.836) [-1741.736] (-1744.395) (-1741.908) -- 0:00:00 996000 -- (-1743.959) (-1745.339) (-1743.505) [-1740.582] * (-1743.256) (-1742.960) (-1742.599) [-1746.367] -- 0:00:00 996500 -- (-1747.651) (-1743.984) (-1747.176) [-1740.771] * (-1743.158) (-1741.903) [-1741.669] (-1743.614) -- 0:00:00 997000 -- (-1743.337) (-1743.929) (-1744.257) [-1742.435] * (-1741.582) (-1742.202) (-1742.182) [-1742.483] -- 0:00:00 997500 -- [-1740.887] (-1743.641) (-1743.427) (-1744.623) * (-1744.709) (-1742.931) (-1742.844) [-1742.349] -- 0:00:00 998000 -- (-1743.764) (-1744.482) [-1742.246] (-1742.921) * (-1745.115) (-1744.748) (-1741.258) [-1746.439] -- 0:00:00 998500 -- (-1741.714) [-1744.671] (-1741.714) (-1741.693) * [-1744.560] (-1742.694) (-1741.213) (-1743.628) -- 0:00:00 999000 -- [-1743.163] (-1744.244) (-1743.825) (-1743.776) * (-1740.701) (-1743.021) (-1743.021) [-1742.809] -- 0:00:00 999500 -- (-1742.909) (-1741.351) [-1740.861] (-1743.137) * (-1741.194) [-1741.229] (-1740.865) (-1742.038) -- 0:00:00 1000000 -- (-1742.825) (-1741.130) [-1741.437] (-1745.312) * [-1741.891] (-1743.394) (-1742.480) (-1743.661) -- 0:00:00 Average standard deviation of split frequencies: 0.007506 Analysis completed in 1 mins 11 seconds Analysis used 70.22 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1740.22 Likelihood of best state for "cold" chain of run 2 was -1740.22 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.6 % ( 65 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.0 % ( 26 %) Dirichlet(Pi{all}) 26.9 % ( 34 %) Slider(Pi{all}) 78.5 % ( 48 %) Multiplier(Alpha{1,2}) 77.9 % ( 54 %) Multiplier(Alpha{3}) 15.0 % ( 27 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 69.9 % ( 74 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 85 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 27 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.5 % ( 23 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.3 % ( 70 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 24.2 % ( 28 %) Dirichlet(Pi{all}) 26.6 % ( 20 %) Slider(Pi{all}) 78.9 % ( 55 %) Multiplier(Alpha{1,2}) 77.8 % ( 57 %) Multiplier(Alpha{3}) 15.1 % ( 16 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 65 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 94 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 28 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.4 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 165954 0.83 0.67 3 | 166665 166795 0.84 4 | 166844 166815 166927 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166772 0.82 0.67 3 | 166480 165802 0.84 4 | 167013 167265 166668 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1741.84 | 1 2 | | 2 1 2 | | 2 1 1 1 12 2 | | 1 2 2 1 2 | | 1 2 1 1 1 2 1 2 2 | |11 1 1 2 22 1 * 1 2* 1 11 1 21 | | 1 2 22111* * 2 1 221 1 1 | | 2 1 1 2 1 2 222 2 2 1| |2 1 2 2 11 * 1 1 1 2 2 | | 22 2 2 2 21 2 21 1 12 1 1 | | 2 1 2 1 | | 1 2 2 2 2| | 2 1 1 | | 1 2 | | 21 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1743.61 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1741.90 -1745.58 2 -1741.91 -1744.91 -------------------------------------- TOTAL -1741.91 -1745.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892609 0.090621 0.376092 1.499346 0.862304 1501.00 1501.00 1.000 r(A<->C){all} 0.167465 0.019251 0.000325 0.451616 0.131001 133.54 176.27 1.002 r(A<->G){all} 0.172965 0.020550 0.000075 0.449949 0.138593 171.71 215.68 1.001 r(A<->T){all} 0.166291 0.019788 0.000123 0.447315 0.127109 210.93 237.24 1.001 r(C<->G){all} 0.176521 0.018964 0.000032 0.441579 0.144619 198.58 233.72 1.005 r(C<->T){all} 0.154995 0.017359 0.000007 0.425802 0.119639 247.19 277.72 1.002 r(G<->T){all} 0.161763 0.018743 0.000017 0.438707 0.123377 283.58 296.99 1.005 pi(A){all} 0.182981 0.000114 0.163109 0.204994 0.182883 1234.20 1279.10 1.000 pi(C){all} 0.294045 0.000153 0.269543 0.317642 0.294062 916.83 1065.35 1.000 pi(G){all} 0.320808 0.000165 0.296321 0.345925 0.320760 1329.11 1364.75 1.001 pi(T){all} 0.202166 0.000123 0.180595 0.223715 0.201950 982.27 1169.76 1.000 alpha{1,2} 0.434463 0.230023 0.000237 1.389144 0.275668 977.70 985.94 1.000 alpha{3} 0.446450 0.227939 0.000151 1.404990 0.290641 1407.38 1450.14 1.000 pinvar{all} 0.998887 0.000002 0.996507 0.999999 0.999290 958.09 982.71 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .****. 8 -- .*...* 9 -- .**... 10 -- ...**. 11 -- ..**.. 12 -- .*..*. 13 -- ..*..* 14 -- ..*.*. 15 -- ....** 16 -- .***.* 17 -- .*.*.. 18 -- ..**** 19 -- ...*.* 20 -- .*.*** 21 -- .**.** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 468 0.155896 0.004711 0.152565 0.159227 2 8 453 0.150899 0.002355 0.149234 0.152565 2 9 452 0.150566 0.006595 0.145903 0.155230 2 10 446 0.148568 0.014133 0.138574 0.158561 2 11 437 0.145570 0.004240 0.142572 0.148568 2 12 430 0.143238 0.000000 0.143238 0.143238 2 13 428 0.142572 0.005653 0.138574 0.146569 2 14 423 0.140906 0.010835 0.133245 0.148568 2 15 420 0.139907 0.019786 0.125916 0.153897 2 16 420 0.139907 0.003769 0.137242 0.142572 2 17 416 0.138574 0.009422 0.131912 0.145237 2 18 413 0.137575 0.008951 0.131246 0.143904 2 19 411 0.136909 0.002355 0.135243 0.138574 2 20 402 0.133911 0.007537 0.128581 0.139241 2 21 392 0.130580 0.012248 0.121919 0.139241 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.100979 0.010732 0.000001 0.314040 0.070062 1.000 2 length{all}[2] 0.099101 0.009630 0.000029 0.299952 0.068307 1.000 2 length{all}[3] 0.098950 0.009665 0.000111 0.296243 0.068446 1.000 2 length{all}[4] 0.098269 0.009484 0.000004 0.294001 0.069412 1.001 2 length{all}[5] 0.099872 0.010024 0.000075 0.297483 0.067738 1.000 2 length{all}[6] 0.099784 0.010071 0.000001 0.295041 0.069076 1.000 2 length{all}[7] 0.095534 0.010458 0.000360 0.297400 0.063060 0.998 2 length{all}[8] 0.104010 0.012087 0.000084 0.328755 0.071524 0.999 2 length{all}[9] 0.100113 0.009561 0.000239 0.282296 0.072514 0.998 2 length{all}[10] 0.099416 0.008334 0.000015 0.303649 0.074235 0.999 2 length{all}[11] 0.097216 0.009580 0.000842 0.267003 0.068190 0.998 2 length{all}[12] 0.106201 0.011209 0.000721 0.338654 0.072457 0.999 2 length{all}[13] 0.086425 0.008074 0.000195 0.282748 0.056049 0.999 2 length{all}[14] 0.101831 0.011721 0.000082 0.313685 0.065772 1.001 2 length{all}[15] 0.104380 0.011117 0.000025 0.313687 0.072660 0.998 2 length{all}[16] 0.097185 0.008514 0.000201 0.285486 0.068900 1.010 2 length{all}[17] 0.093503 0.008275 0.000321 0.275832 0.064433 1.000 2 length{all}[18] 0.095434 0.009542 0.000244 0.249342 0.068065 1.003 2 length{all}[19] 0.103320 0.008492 0.000069 0.289360 0.077426 0.999 2 length{all}[20] 0.098625 0.011147 0.000255 0.300187 0.073832 1.001 2 length{all}[21] 0.093854 0.008177 0.000241 0.258926 0.068208 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.007506 Maximum standard deviation of split frequencies = 0.019786 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.010 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /------------------------------------------------------------------------ C1 (1) | |---------------------------------------------------------------------- C2 (2) | |---------------------------------------------------------------------- C3 (3) + |----------------------------------------------------------------------- C4 (4) | |---------------------------------------------------------------------- C5 (5) | \----------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1281 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 60 patterns at 427 / 427 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 60 patterns at 427 / 427 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 58560 bytes for conP 5280 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.096918 0.050750 0.084631 0.098001 0.036703 0.077295 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1855.404187 Iterating by ming2 Initial: fx= 1855.404187 x= 0.09692 0.05075 0.08463 0.09800 0.03670 0.07729 0.30000 1.30000 1 h-m-p 0.0000 0.0001 1020.1911 ++ 1764.030209 m 0.0001 13 | 1/8 2 h-m-p 0.0008 0.0041 76.8712 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 936.5002 ++ 1734.543124 m 0.0000 44 | 2/8 4 h-m-p 0.0006 0.0072 46.5597 -----------.. | 2/8 5 h-m-p 0.0000 0.0001 838.6400 ++ 1689.575861 m 0.0001 75 | 3/8 6 h-m-p 0.0016 0.0137 28.5593 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 729.4237 ++ 1680.177503 m 0.0000 106 | 4/8 8 h-m-p 0.0006 0.0412 16.7230 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 595.9196 ++ 1669.641631 m 0.0000 137 | 5/8 10 h-m-p 0.0012 0.1358 10.6926 -----------.. | 5/8 11 h-m-p 0.0000 0.0000 422.3273 ++ 1669.175702 m 0.0000 168 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 Y 1669.175702 0 0.0160 179 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 --------C 1669.175702 0 0.0000 200 Out.. lnL = -1669.175702 201 lfun, 201 eigenQcodon, 1206 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.076053 0.095974 0.062567 0.030475 0.068978 0.082542 0.299918 0.635277 0.448345 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.783989 np = 9 lnL0 = -1840.305282 Iterating by ming2 Initial: fx= 1840.305282 x= 0.07605 0.09597 0.06257 0.03047 0.06898 0.08254 0.29992 0.63528 0.44834 1 h-m-p 0.0000 0.0001 982.7038 ++ 1766.797517 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0002 609.6966 ++ 1699.938988 m 0.0002 26 | 2/9 3 h-m-p 0.0000 0.0000 5431.3411 ++ 1688.806968 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 985.0264 ++ 1679.365079 m 0.0001 50 | 4/9 5 h-m-p 0.0000 0.0000 402933.2826 ++ 1674.099173 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 108786.8030 ++ 1669.175653 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1669.175653 m 8.0000 86 | 6/9 8 h-m-p 0.0162 8.0000 0.0513 ----------Y 1669.175653 0 0.0000 111 | 6/9 9 h-m-p 0.0160 8.0000 0.0003 +++++ 1669.175653 m 8.0000 129 | 6/9 10 h-m-p 0.0044 0.0890 0.5952 ------------.. | 6/9 11 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175652 m 8.0000 172 | 6/9 12 h-m-p 0.0071 3.5514 0.2384 --------C 1669.175652 0 0.0000 195 | 6/9 13 h-m-p 0.0004 0.2075 0.1693 +++++ 1669.175646 m 0.2075 213 | 7/9 14 h-m-p 0.1341 3.3591 0.2307 ---------------.. | 7/9 15 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175646 m 8.0000 258 | 7/9 16 h-m-p 0.0050 2.4858 0.3059 -----------C 1669.175646 0 0.0000 283 | 7/9 17 h-m-p 0.0160 8.0000 0.0004 +++++ 1669.175645 m 8.0000 300 | 7/9 18 h-m-p 0.0092 1.9801 0.3431 ---------Y 1669.175645 0 0.0000 323 | 7/9 19 h-m-p 0.0160 8.0000 0.0001 ---C 1669.175645 0 0.0001 340 | 7/9 20 h-m-p 0.0160 8.0000 0.0027 +++++ 1669.175642 m 8.0000 357 | 7/9 21 h-m-p 0.0623 2.0203 0.3474 ----------C 1669.175642 0 0.0000 381 | 7/9 22 h-m-p 0.0160 8.0000 0.0008 --------Y 1669.175642 0 0.0000 403 | 7/9 23 h-m-p 0.0160 8.0000 0.0000 +++++ 1669.175642 m 8.0000 420 | 7/9 24 h-m-p 0.0040 2.0038 0.3471 --------C 1669.175642 0 0.0000 442 | 7/9 25 h-m-p 0.0160 8.0000 0.0002 ------Y 1669.175642 0 0.0000 462 | 7/9 26 h-m-p 0.0160 8.0000 0.0000 +++++ 1669.175642 m 8.0000 479 | 7/9 27 h-m-p 0.0047 2.3715 0.2965 ------------.. | 7/9 28 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175642 m 8.0000 520 | 7/9 29 h-m-p 0.0054 2.7000 0.2919 ------------.. | 7/9 30 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175642 m 8.0000 561 | 7/9 31 h-m-p 0.0054 2.6890 0.2936 ---------Y 1669.175642 0 0.0000 584 | 7/9 32 h-m-p 0.0160 8.0000 0.0010 +++++ 1669.175641 m 8.0000 601 | 7/9 33 h-m-p 0.0254 2.3250 0.3037 -----------Y 1669.175641 0 0.0000 626 | 7/9 34 h-m-p 0.0160 8.0000 0.0016 --------Y 1669.175641 0 0.0000 648 | 7/9 35 h-m-p 0.0160 8.0000 0.0000 +++++ 1669.175640 m 8.0000 665 | 7/9 36 h-m-p 0.0040 2.0130 0.3529 ------------.. | 7/9 37 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175640 m 8.0000 706 | 7/9 38 h-m-p 0.0055 2.7509 0.2904 ---------Y 1669.175640 0 0.0000 729 | 7/9 39 h-m-p 0.0160 8.0000 0.0004 +++++ 1669.175640 m 8.0000 746 | 7/9 40 h-m-p 0.0089 2.2372 0.3192 ---------C 1669.175640 0 0.0000 769 | 7/9 41 h-m-p 0.0160 8.0000 0.0043 +++++ 1669.175634 m 8.0000 786 | 7/9 42 h-m-p 0.1077 2.3513 0.3166 -----------C 1669.175634 0 0.0000 811 | 7/9 43 h-m-p 0.0160 8.0000 0.0001 +++++ 1669.175634 m 8.0000 828 | 7/9 44 h-m-p 0.0055 2.7383 0.2751 --------Y 1669.175634 0 0.0000 850 | 7/9 45 h-m-p 0.0160 8.0000 0.0062 +++++ 1669.175623 m 8.0000 867 | 7/9 46 h-m-p 0.1717 2.7447 0.2906 -------------Y 1669.175623 0 0.0000 894 | 7/9 47 h-m-p 0.0160 8.0000 0.0000 ----Y 1669.175623 0 0.0000 912 | 7/9 48 h-m-p 0.0160 8.0000 0.0001 +++++ 1669.175623 m 8.0000 929 | 7/9 49 h-m-p 0.0033 1.6357 0.3405 ---------C 1669.175623 0 0.0000 952 | 7/9 50 h-m-p 0.0160 8.0000 0.0001 +++++ 1669.175623 m 8.0000 969 | 7/9 51 h-m-p 0.0031 1.5533 0.3390 ---------N 1669.175623 0 0.0000 992 | 7/9 52 h-m-p 0.0160 8.0000 0.0049 +++++ 1669.175617 m 8.0000 1009 | 7/9 53 h-m-p 0.1138 1.5971 0.3478 ---------------.. | 7/9 54 h-m-p 0.0160 8.0000 0.0003 +++++ 1669.175616 m 8.0000 1053 | 7/9 55 h-m-p 0.0094 3.8590 0.2396 ---------C 1669.175616 0 0.0000 1076 | 7/9 56 h-m-p 0.0160 8.0000 0.0014 +++++ 1669.175613 m 8.0000 1093 | 7/9 57 h-m-p 0.0358 4.5805 0.3117 --------------.. | 7/9 58 h-m-p 0.0160 8.0000 0.0003 +++++ 1669.175612 m 8.0000 1136 | 7/9 59 h-m-p 0.0100 3.9413 0.2364 ----------Y 1669.175612 0 0.0000 1160 | 7/9 60 h-m-p 0.0160 8.0000 0.0067 +++++ 1669.175595 m 8.0000 1177 | 7/9 61 h-m-p 0.2196 3.7410 0.2455 ------------N 1669.175595 0 0.0000 1203 | 7/9 62 h-m-p 0.0160 8.0000 0.0000 -----Y 1669.175595 0 0.0000 1222 | 7/9 63 h-m-p 0.0160 8.0000 0.0000 +++++ 1669.175594 m 8.0000 1239 | 7/9 64 h-m-p 0.0088 4.3902 0.2049 -------------.. | 7/9 65 h-m-p 0.0160 8.0000 0.0004 +++++ 1669.175593 m 8.0000 1281 | 7/9 66 h-m-p 0.0145 4.6420 0.2112 ------------Y 1669.175593 0 0.0000 1307 | 7/9 67 h-m-p 0.0160 8.0000 0.0070 +++++ 1669.175569 m 8.0000 1324 | 7/9 68 h-m-p 0.2548 4.3920 0.2203 ------------C 1669.175569 0 0.0000 1350 | 7/9 69 h-m-p 0.0160 8.0000 0.0004 +++++ 1669.175567 m 8.0000 1367 | 7/9 70 h-m-p 0.0191 5.4469 0.1792 -------------.. | 7/9 71 h-m-p 0.0160 8.0000 0.0005 +++++ 1669.175565 m 8.0000 1409 | 7/9 72 h-m-p 0.0231 5.6732 0.1821 ----------Y 1669.175565 0 0.0000 1433 | 7/9 73 h-m-p 0.0160 8.0000 0.0037 +++++ 1669.175549 m 8.0000 1450 | 7/9 74 h-m-p 0.1592 5.3683 0.1840 ---------------.. | 7/9 75 h-m-p 0.0160 8.0000 0.0006 +++++ 1669.175545 m 8.0000 1494 | 7/9 76 h-m-p 0.0307 6.3952 0.1659 -----------Y 1669.175545 0 0.0000 1519 | 7/9 77 h-m-p 0.0002 0.1033 0.0772 +++++ 1669.175540 m 0.1033 1536 | 8/9 78 h-m-p 0.0347 8.0000 0.0612 --------------.. | 8/9 79 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175540 m 8.0000 1578 | 8/9 80 h-m-p 0.0160 8.0000 0.9121 -----------C 1669.175540 0 0.0000 1602 | 8/9 81 h-m-p 0.0160 8.0000 0.0000 ----Y 1669.175540 0 0.0000 1619 | 8/9 82 h-m-p 0.0160 8.0000 0.0000 +++++ 1669.175540 m 8.0000 1635 | 8/9 83 h-m-p 0.0000 0.0172 12.2990 +++++ 1669.175483 m 0.0172 1651 | 9/9 84 h-m-p 0.0160 8.0000 0.0000 Y 1669.175483 0 0.0160 1663 | 9/9 85 h-m-p 0.0160 8.0000 0.0000 Y 1669.175483 0 0.0160 1675 Out.. lnL = -1669.175483 1676 lfun, 5028 eigenQcodon, 20112 P(t) Time used: 0:05 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.076575 0.054634 0.066394 0.091311 0.081165 0.015960 0.000100 1.171690 0.244706 0.258713 1.416396 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 11.341470 np = 11 lnL0 = -1821.260212 Iterating by ming2 Initial: fx= 1821.260212 x= 0.07657 0.05463 0.06639 0.09131 0.08117 0.01596 0.00011 1.17169 0.24471 0.25871 1.41640 1 h-m-p 0.0000 0.0000 907.6379 ++ 1820.163301 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 584.5853 ++ 1783.080242 m 0.0001 30 | 2/11 3 h-m-p 0.0001 0.0003 278.0356 ++ 1715.584176 m 0.0003 44 | 3/11 4 h-m-p 0.0005 0.0026 71.4735 ++ 1686.612429 m 0.0026 58 | 4/11 5 h-m-p 0.0000 0.0000 4909.7393 ++ 1683.449880 m 0.0000 72 | 5/11 6 h-m-p 0.0013 0.0067 16.4243 -----------.. | 5/11 7 h-m-p 0.0000 0.0000 705.9746 ++ 1675.619908 m 0.0000 109 | 6/11 8 h-m-p 0.0160 8.0000 8.2348 -------------.. | 6/11 9 h-m-p 0.0000 0.0000 585.2485 ++ 1672.570208 m 0.0000 148 | 7/11 10 h-m-p 0.0160 8.0000 4.6524 -------------.. | 7/11 11 h-m-p 0.0000 0.0000 415.9059 ++ 1669.175642 m 0.0000 187 | 8/11 12 h-m-p 0.0228 8.0000 0.0000 +++++ 1669.175642 m 8.0000 204 | 8/11 13 h-m-p 0.0510 8.0000 0.0032 ++++ 1669.175641 m 8.0000 223 | 8/11 14 h-m-p 0.0160 8.0000 2.5561 ----------Y 1669.175641 0 0.0000 250 | 8/11 15 h-m-p 0.0189 8.0000 0.0000 ---Y 1669.175641 0 0.0001 267 | 8/11 16 h-m-p 0.0160 8.0000 0.0000 ---Y 1669.175641 0 0.0001 287 Out.. lnL = -1669.175641 288 lfun, 1152 eigenQcodon, 5184 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1669.204559 S = -1669.170382 -0.013152 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:07 did 20 / 60 patterns 0:07 did 30 / 60 patterns 0:07 did 40 / 60 patterns 0:07 did 50 / 60 patterns 0:07 did 60 / 60 patterns 0:07 Time used: 0:07 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.020462 0.082693 0.057983 0.018492 0.038876 0.066651 0.000100 0.637948 1.608391 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 18.330042 np = 9 lnL0 = -1783.785395 Iterating by ming2 Initial: fx= 1783.785395 x= 0.02046 0.08269 0.05798 0.01849 0.03888 0.06665 0.00011 0.63795 1.60839 1 h-m-p 0.0000 0.0000 950.0620 ++ 1782.528742 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0077 82.9843 +++++ 1742.312389 m 0.0077 29 | 2/9 3 h-m-p 0.0000 0.0001 788.6471 ++ 1696.091909 m 0.0001 41 | 3/9 4 h-m-p 0.0016 0.0080 37.4468 ++ 1686.562761 m 0.0080 53 | 4/9 5 h-m-p 0.0000 0.0001 283.9379 ++ 1677.306231 m 0.0001 65 | 5/9 6 h-m-p 0.0000 0.0001 3300.8446 ++ 1671.976867 m 0.0001 77 | 6/9 7 h-m-p 0.0000 0.0000 1700.1316 ++ 1671.687498 m 0.0000 89 | 7/9 8 h-m-p 0.0023 0.0422 35.4794 ------------.. | 7/9 9 h-m-p 0.0000 0.0000 410.5313 ++ 1669.175483 m 0.0000 123 | 8/9 10 h-m-p 0.0160 8.0000 0.0000 N 1669.175483 0 0.0040 135 | 8/9 11 h-m-p 1.6000 8.0000 0.0000 N 1669.175483 0 0.2000 148 Out.. lnL = -1669.175483 149 lfun, 1639 eigenQcodon, 8940 P(t) Time used: 0:10 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.105696 0.057516 0.062851 0.092891 0.031005 0.023015 0.000100 0.900000 0.280275 1.535272 1.299957 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 18.849231 np = 11 lnL0 = -1809.033375 Iterating by ming2 Initial: fx= 1809.033375 x= 0.10570 0.05752 0.06285 0.09289 0.03101 0.02301 0.00011 0.90000 0.28028 1.53527 1.29996 1 h-m-p 0.0000 0.0000 838.3841 ++ 1808.553238 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0002 569.3180 +++ 1759.738525 m 0.0002 31 | 2/11 3 h-m-p 0.0000 0.0000 720.9294 ++ 1744.580313 m 0.0000 45 | 3/11 4 h-m-p 0.0001 0.0011 236.3570 ++ 1706.299391 m 0.0011 59 | 4/11 5 h-m-p 0.0002 0.0009 154.9789 ++ 1693.256085 m 0.0009 73 | 5/11 6 h-m-p 0.0000 0.0000 5700.0430 ++ 1682.553055 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0001 2048.4381 ++ 1675.335577 m 0.0001 101 | 7/11 8 h-m-p 0.0014 0.0072 15.1296 ++ 1669.175610 m 0.0072 115 | 8/11 9 h-m-p 1.6000 8.0000 0.0003 ++ 1669.175610 m 8.0000 129 | 8/11 10 h-m-p 0.0081 4.0500 0.5895 -------------.. | 8/11 11 h-m-p 0.0160 8.0000 0.0004 +++++ 1669.175608 m 8.0000 177 | 8/11 12 h-m-p 0.0173 4.5182 0.1856 ----------Y 1669.175608 0 0.0000 204 | 8/11 13 h-m-p 0.0160 8.0000 0.0002 +++++ 1669.175608 m 8.0000 224 | 8/11 14 h-m-p 0.0101 5.0550 0.1959 ----------C 1669.175608 0 0.0000 251 | 8/11 15 h-m-p 0.0160 8.0000 0.0003 +++++ 1669.175607 m 8.0000 271 | 8/11 16 h-m-p 0.0106 4.4342 0.2257 ----------Y 1669.175607 0 0.0000 298 | 8/11 17 h-m-p 0.0095 4.7274 0.0406 +++++ 1669.175483 m 4.7274 318 | 9/11 18 h-m-p 1.6000 8.0000 0.0000 ++ 1669.175483 m 8.0000 335 | 9/11 19 h-m-p 1.6000 8.0000 0.0001 ++ 1669.175483 m 8.0000 351 | 9/11 20 h-m-p 0.6872 8.0000 0.0017 --N 1669.175483 0 0.0107 369 | 9/11 21 h-m-p 0.2801 8.0000 0.0001 Y 1669.175483 0 0.2801 385 | 9/11 22 h-m-p 0.2720 8.0000 0.0001 C 1669.175483 0 0.2720 401 | 9/11 23 h-m-p 0.2627 8.0000 0.0001 ---Y 1669.175483 0 0.0010 420 | 9/11 24 h-m-p 0.1302 8.0000 0.0000 ---Y 1669.175483 0 0.0005 439 Out.. lnL = -1669.175483 440 lfun, 5280 eigenQcodon, 29040 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1669.282712 S = -1669.177177 -0.047466 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:17 did 20 / 60 patterns 0:17 did 30 / 60 patterns 0:17 did 40 / 60 patterns 0:17 did 50 / 60 patterns 0:17 did 60 / 60 patterns 0:18 Time used: 0:18 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=427 NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY NC_002677_1_NP_301876_1_748_ilvA MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR NC_002677_1_NP_301876_1_748_ilvA LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI NC_002677_1_NP_301876_1_748_ilvA SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG NC_002677_1_NP_301876_1_748_ilvA ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN NC_002677_1_NP_301876_1_748_ilvA MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV NC_002677_1_NP_301876_1_748_ilvA RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP NC_002677_1_NP_301876_1_748_ilvA AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV NC_002677_1_NP_301876_1_748_ilvA QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV ************************************************** NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 LLARMQGTEMHVETLQPGSPAYRYLLL NC_002677_1_NP_301876_1_748_ilvA LLARMQGTEMHVETLQPGSPAYRYLLL NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 LLARMQGTEMHVETLQPGSPAYRYLLL NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 LLARMQGTEMHVETLQPGSPAYRYLLL NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 LLARMQGTEMHVETLQPGSPAYRYLLL NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 LLARMQGTEMHVETLQPGSPAYRYLLL ***************************
>NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >NC_002677_1_NP_301876_1_748_ilvA ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT >NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 ATGTCCGCCGAACCTAGTAGAAACCCCAGGACCCCACCGGTGTCCGCGGT TGACATTGACGGTGCGGCGAAGCGGATCGCGCCGGTGGTCACGCCTACCC CGTTGCAACTTAGCGATCGGTTGTCGGCGATCACTGGTGCAGCGGTGTAC CTCAAGCGTGAAGACCTGCAGACGGTGCGCTCTTACAAACTGCGCGGCGC CTACAACCTGTTGGTGCAGCTGACCGACGAGGAGATCGCCGCCGGCGTTG TGTGCTCTTCGGCGGGTAACCATGCACAGGGTGTCGCGTATGCATGTCGG TCACTGGGTGTGCACGGCCGTGTCTATGTACCTGCCAAGACACCCAAACA AAAGTGGGATCGGATCCGCTACCATGGCGGGGCATTCATCGAGCTGATCG TCGGGAGATCGACCTACGATCTCGCCGCTGCCGCGGCGGTCGACGACATT GAACGCACCGGCGCGACGTTGGTACCTCCTTATGACGACGTCCGCGTCAT CGCTGGTCAGGGCACCATTGCCGTCGAGTTGCTGGAGCAACTCAACACCG AGCCTGACCTAGTGGTGGTCCCGGTGGGCGGCGGTGGCTGCATCGCCGGC ATGACCACTTACTTGGCCGAACGAACGGCGAACACTGCTGTGCTTGGTGT CGAGCCGGCTGGTGCCGCGGCTATGATGGCCGCGCTGGCCGCGGGTGAGC CGGTGACACTGGACTACGTCGATCAGTTCGTGGATGGCGCTGCGGTGAAC CGGGTGGGAACGTTGCCTTATGCCGCGTTGACTGCCGCAGGTGACATGGT GTCCATCACCACCGTCGACGAGGGGGCGGTGTGCACTGCGATGCTCGACC TTTACCAGAACGAGGGCATTATAGCTGAGCCGGCGGGCGCACTGTCAGTA GCTGGGCTGCTGGAAACTGACATTGAACCCGGGTCCACCGTGGTTTGCCT GATCTCGGGCGGCAACAACGACGTATTGCGCTACGGTGAGGTGTTGGAGC GTTCGCTGATCCACCTAGGTCTCAAACACTATTTCCTGGTAGACTTCCCC CAGAAGCCTGGTGCCTTGCGCCGTTTTCTTGACGAAGTGCTTGGACCCAA CGACGACATCACCTTGTTCGAGTACGTCAAGCGCAACAACCGAGAGACCG GCGAGGCGCTGGTAGGTATCCAGCTGGGGTCTGCTGTCGACTTAGACGTC CTGCTGGCCCGGATGCAGGGGACCGAAATGCACGTCGAAACCCTACAACC AGGTTCGCCGGCCTACCGCTACCTGTTGCTT
>NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >NC_002677_1_NP_301876_1_748_ilvA MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL >NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 MSAEPSRNPRTPPVSAVDIDGAAKRIAPVVTPTPLQLSDRLSAITGAAVY LKREDLQTVRSYKLRGAYNLLVQLTDEEIAAGVVCSSAGNHAQGVAYACR SLGVHGRVYVPAKTPKQKWDRIRYHGGAFIELIVGRSTYDLAAAAAVDDI ERTGATLVPPYDDVRVIAGQGTIAVELLEQLNTEPDLVVVPVGGGGCIAG MTTYLAERTANTAVLGVEPAGAAAMMAALAAGEPVTLDYVDQFVDGAAVN RVGTLPYAALTAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV AGLLETDIEPGSTVVCLISGGNNDVLRYGEVLERSLIHLGLKHYFLVDFP QKPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSAVDLDV LLARMQGTEMHVETLQPGSPAYRYLLL
#NEXUS [ID: 0787061544] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 NC_002677_1_NP_301876_1_748_ilvA NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 ; end; begin trees; translate 1 NC_011896_1_WP_010908197_1_1268_MLBR_RS05975, 2 NC_002677_1_NP_301876_1_748_ilvA, 3 NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725, 4 NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115, 5 NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550, 6 NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07006165,2:0.06830743,3:0.068446,4:0.06941155,5:0.06773792,6:0.06907639); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07006165,2:0.06830743,3:0.068446,4:0.06941155,5:0.06773792,6:0.06907639); end;
Estimated marginal likelihoods for runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1741.90 -1745.58 2 -1741.91 -1744.91 -------------------------------------- TOTAL -1741.91 -1745.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ilvA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.892609 0.090621 0.376092 1.499346 0.862304 1501.00 1501.00 1.000 r(A<->C){all} 0.167465 0.019251 0.000325 0.451616 0.131001 133.54 176.27 1.002 r(A<->G){all} 0.172965 0.020550 0.000075 0.449949 0.138593 171.71 215.68 1.001 r(A<->T){all} 0.166291 0.019788 0.000123 0.447315 0.127109 210.93 237.24 1.001 r(C<->G){all} 0.176521 0.018964 0.000032 0.441579 0.144619 198.58 233.72 1.005 r(C<->T){all} 0.154995 0.017359 0.000007 0.425802 0.119639 247.19 277.72 1.002 r(G<->T){all} 0.161763 0.018743 0.000017 0.438707 0.123377 283.58 296.99 1.005 pi(A){all} 0.182981 0.000114 0.163109 0.204994 0.182883 1234.20 1279.10 1.000 pi(C){all} 0.294045 0.000153 0.269543 0.317642 0.294062 916.83 1065.35 1.000 pi(G){all} 0.320808 0.000165 0.296321 0.345925 0.320760 1329.11 1364.75 1.001 pi(T){all} 0.202166 0.000123 0.180595 0.223715 0.201950 982.27 1169.76 1.000 alpha{1,2} 0.434463 0.230023 0.000237 1.389144 0.275668 977.70 985.94 1.000 alpha{3} 0.446450 0.227939 0.000151 1.404990 0.290641 1407.38 1450.14 1.000 pinvar{all} 0.998887 0.000002 0.996507 0.999999 0.999290 958.09 982.71 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/ilvA/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 427 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1 TTC 5 5 5 5 5 5 | TCC 4 4 4 4 4 4 | TAC 12 12 12 12 12 12 | TGC 4 4 4 4 4 4 Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 13 13 13 13 13 13 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 6 6 6 6 6 6 | Pro CCT 8 8 8 8 8 8 | His CAT 2 2 2 2 2 2 | Arg CGT 4 4 4 4 4 4 CTC 5 5 5 5 5 5 | CCC 5 5 5 5 5 5 | CAC 4 4 4 4 4 4 | CGC 9 9 9 9 9 9 CTA 3 3 3 3 3 3 | CCA 2 2 2 2 2 2 | Gln CAA 4 4 4 4 4 4 | CGA 2 2 2 2 2 2 CTG 20 20 20 20 20 20 | CCG 8 8 8 8 8 8 | CAG 9 9 9 9 9 9 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 6 6 6 6 6 6 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1 ATC 13 13 13 13 13 13 | ACC 15 15 15 15 15 15 | AAC 12 12 12 12 12 12 | AGC 1 1 1 1 1 1 ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 2 2 2 2 2 2 Met ATG 8 8 8 8 8 8 | ACG 5 5 5 5 5 5 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 9 9 9 9 9 9 | Asp GAT 5 5 5 5 5 5 | Gly GGT 16 16 16 16 16 16 GTC 16 16 16 16 16 16 | GCC 18 18 18 18 18 18 | GAC 21 21 21 21 21 21 | GGC 16 16 16 16 16 16 GTA 6 6 6 6 6 6 | GCA 6 6 6 6 6 6 | Glu GAA 9 9 9 9 9 9 | GGA 2 2 2 2 2 2 GTG 20 20 20 20 20 20 | GCG 21 21 21 21 21 21 | GAG 16 16 16 16 16 16 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908197_1_1268_MLBR_RS05975 position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 #2: NC_002677_1_NP_301876_1_748_ilvA position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 #3: NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725 position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 #4: NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115 position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 #5: NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550 position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 #6: NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700 position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 18 | Tyr Y TAT 30 | Cys C TGT 6 TTC 30 | TCC 24 | TAC 72 | TGC 24 Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 78 | TCG 36 | TAG 0 | Trp W TGG 6 ------------------------------------------------------------------------------ Leu L CTT 36 | Pro P CCT 48 | His H CAT 12 | Arg R CGT 24 CTC 30 | CCC 30 | CAC 24 | CGC 54 CTA 18 | CCA 12 | Gln Q CAA 24 | CGA 12 CTG 120 | CCG 48 | CAG 54 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 36 | Asn N AAT 0 | Ser S AGT 6 ATC 78 | ACC 90 | AAC 72 | AGC 6 ATA 6 | ACA 12 | Lys K AAA 18 | Arg R AGA 12 Met M ATG 48 | ACG 30 | AAG 36 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 54 | Asp D GAT 30 | Gly G GGT 96 GTC 96 | GCC 108 | GAC 126 | GGC 96 GTA 36 | GCA 36 | Glu E GAA 54 | GGA 12 GTG 120 | GCG 126 | GAG 96 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13583 C:0.22717 A:0.18970 G:0.44731 position 2: T:0.29508 C:0.28103 A:0.25293 G:0.17096 position 3: T:0.17564 C:0.37471 A:0.10539 G:0.34426 Average T:0.20219 C:0.29430 A:0.18267 G:0.32084 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1669.175702 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299918 1.299957 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908197_1_1268_MLBR_RS05975: 0.000004, NC_002677_1_NP_301876_1_748_ilvA: 0.000004, NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725: 0.000004, NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115: 0.000004, NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550: 0.000004, NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29992 omega (dN/dS) = 1.29996 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 975.1 305.9 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1669.175483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908197_1_1268_MLBR_RS05975: 0.000004, NC_002677_1_NP_301876_1_748_ilvA: 0.000004, NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725: 0.000004, NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115: 0.000004, NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550: 0.000004, NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:05 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1669.175641 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.627411 0.203280 0.000001 1.302919 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908197_1_1268_MLBR_RS05975: 0.000004, NC_002677_1_NP_301876_1_748_ilvA: 0.000004, NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725: 0.000004, NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115: 0.000004, NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550: 0.000004, NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.62741 0.20328 0.16931 w: 0.00000 1.00000 1.30292 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 7..2 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 7..3 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 7..4 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 7..5 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 7..6 0.000 985.0 296.0 0.4239 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908197_1_1268_MLBR_RS05975) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908197_1_1268_MLBR_RS05975) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:07 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1669.175483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.500088 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908197_1_1268_MLBR_RS05975: 0.000004, NC_002677_1_NP_301876_1_748_ilvA: 0.000004, NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725: 0.000004, NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115: 0.000004, NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550: 0.000004, NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.50009 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:10 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1669.175483 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.645446 1.476155 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908197_1_1268_MLBR_RS05975: 0.000004, NC_002677_1_NP_301876_1_748_ilvA: 0.000004, NZ_LVXE01000044_1_WP_010908197_1_1897_A3216_RS10725: 0.000004, NZ_LYPH01000049_1_WP_010908197_1_1910_A8144_RS09115: 0.000004, NZ_CP029543_1_WP_010908197_1_1290_DIJ64_RS06550: 0.000004, NZ_AP014567_1_WP_010908197_1_1320_JK2ML_RS06700: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.64545 (p1 = 0.00001) w = 1.47616 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.47616 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 985.0 296.0 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908197_1_1268_MLBR_RS05975) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.092 0.094 0.095 0.097 0.099 0.101 0.103 0.104 0.106 0.108 p : 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.108 0.106 0.104 0.102 0.101 0.099 0.097 0.096 0.094 0.093 Time used: 0:18
Model 1: NearlyNeutral -1669.175483 Model 2: PositiveSelection -1669.175641 Model 0: one-ratio -1669.175702 Model 7: beta -1669.175483 Model 8: beta&w>1 -1669.175483 Model 0 vs 1 4.380000000310247E-4 Model 2 vs 1 3.160000001116714E-4 Model 8 vs 7 0.0