--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:15:37 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/ilvE/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1497.86 -1501.07 2 -1497.82 -1502.63 -------------------------------------- TOTAL -1497.84 -1502.13 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898266 0.085324 0.388082 1.512861 0.870514 1443.29 1472.15 1.000 r(A<->C){all} 0.163887 0.021162 0.000035 0.453201 0.122184 198.79 268.82 1.002 r(A<->G){all} 0.166663 0.020562 0.000025 0.461262 0.128521 168.19 191.02 1.005 r(A<->T){all} 0.159962 0.016826 0.000187 0.418126 0.128402 216.12 242.27 1.000 r(C<->G){all} 0.158823 0.019257 0.000036 0.438472 0.117142 205.51 246.52 1.000 r(C<->T){all} 0.166040 0.020278 0.000085 0.452628 0.127910 241.33 257.04 1.000 r(G<->T){all} 0.184626 0.023261 0.000137 0.490584 0.145033 239.57 246.21 1.000 pi(A){all} 0.170799 0.000129 0.149488 0.193908 0.170253 1326.92 1388.01 1.000 pi(C){all} 0.286261 0.000183 0.261528 0.313642 0.285731 1143.30 1193.43 1.000 pi(G){all} 0.329039 0.000190 0.301934 0.355853 0.329412 1123.30 1177.79 1.000 pi(T){all} 0.213900 0.000152 0.191214 0.238514 0.213555 1199.29 1257.49 1.000 alpha{1,2} 0.440013 0.257940 0.000259 1.448660 0.254536 1400.61 1409.75 1.000 alpha{3} 0.474947 0.262869 0.000685 1.540835 0.303183 1289.23 1395.12 1.000 pinvar{all} 0.998631 0.000003 0.995637 1.000000 0.999156 851.95 1016.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1447.211034 Model 2: PositiveSelection -1447.210968 Model 0: one-ratio -1447.211047 Model 7: beta -1447.210968 Model 8: beta&w>1 -1447.211426 Model 0 vs 1 2.6000000161729986E-5 Model 2 vs 1 1.3199999966673204E-4 Model 8 vs 7 9.159999999610591E-4
>C1 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C2 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C3 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C4 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C5 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C6 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=368 C1 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C2 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C3 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C4 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C5 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C6 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW ************************************************** C1 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C2 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C3 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C4 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C5 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C6 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA ************************************************** C1 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C2 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C3 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C4 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C5 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C6 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ************************************************** C1 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C2 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C3 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C4 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C5 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C6 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT ************************************************** C1 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C2 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C3 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C4 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C5 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C6 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL ************************************************** C1 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C2 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C3 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C4 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C5 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C6 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK ************************************************** C1 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C2 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C3 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C4 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C5 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C6 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT ************************************************** C1 GIQRGTFADTHGWMARLG C2 GIQRGTFADTHGWMARLG C3 GIQRGTFADTHGWMARLG C4 GIQRGTFADTHGWMARLG C5 GIQRGTFADTHGWMARLG C6 GIQRGTFADTHGWMARLG ****************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 368 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 368 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11040] Library Relaxation: Multi_proc [96] Relaxation Summary: [11040]--->[11040] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.525 Mb, Max= 30.942 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C2 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C3 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C4 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C5 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW C6 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW ************************************************** C1 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C2 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C3 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C4 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C5 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA C6 HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA ************************************************** C1 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C2 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C3 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C4 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C5 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF C6 RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ************************************************** C1 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C2 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C3 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C4 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C5 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT C6 ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT ************************************************** C1 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C2 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C3 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C4 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C5 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL C6 GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL ************************************************** C1 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C2 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C3 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C4 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C5 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK C6 GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK ************************************************** C1 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C2 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C3 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C4 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C5 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT C6 AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT ************************************************** C1 GIQRGTFADTHGWMARLG C2 GIQRGTFADTHGWMARLG C3 GIQRGTFADTHGWMARLG C4 GIQRGTFADTHGWMARLG C5 GIQRGTFADTHGWMARLG C6 GIQRGTFADTHGWMARLG ****************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT C2 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT C3 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT C4 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT C5 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT C6 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT ************************************************** C1 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT C2 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT C3 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT C4 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT C5 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT C6 GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ************************************************** C1 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG C2 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG C3 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG C4 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG C5 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG C6 ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG ************************************************** C1 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC C2 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC C3 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC C4 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC C5 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC C6 CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC ************************************************** C1 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC C2 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC C3 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC C4 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC C5 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC C6 GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC ************************************************** C1 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC C2 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC C3 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC C4 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC C5 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC C6 GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC ************************************************** C1 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA C2 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA C3 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA C4 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA C5 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA C6 AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA ************************************************** C1 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG C2 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG C3 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG C4 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG C5 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG C6 GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG ************************************************** C1 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC C2 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC C3 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC C4 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC C5 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC C6 TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC ************************************************** C1 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT C2 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT C3 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT C4 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT C5 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT C6 GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT ************************************************** C1 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG C2 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG C3 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG C4 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG C5 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG C6 GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG ************************************************** C1 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC C2 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC C3 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC C4 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC C5 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC C6 TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC ************************************************** C1 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC C2 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC C3 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC C4 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC C5 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC C6 GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC ************************************************** C1 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG C2 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG C3 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG C4 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG C5 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG C6 CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG ************************************************** C1 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC C2 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC C3 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC C4 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC C5 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC C6 AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC ************************************************** C1 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT C2 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT C3 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT C4 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT C5 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT C6 GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT ************************************************** C1 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG C2 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG C3 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG C4 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG C5 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG C6 GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG ************************************************** C1 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA C2 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA C3 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA C4 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA C5 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA C6 GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA ************************************************** C1 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT C2 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT C3 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT C4 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT C5 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT C6 GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT ************************************************** C1 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG C2 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG C3 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG C4 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG C5 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG C6 CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG ************************************************** C1 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT C2 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT C3 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT C4 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT C5 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT C6 CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT ************************************************** C1 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT C2 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT C3 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT C4 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT C5 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT C6 GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT ************************************************** C1 GGGA C2 GGGA C3 GGGA C4 GGGA C5 GGGA C6 GGGA **** >C1 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C2 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C3 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C4 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C5 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C6 ATGACCAGCGGCTTCCTCGAGTTCACGGTGTCACTCTCGGCCCATCCGGT GACTGATGCGGAACGTGAATCGATCCTGGCTGAGCCGGGCTTCGGTAAGT ACCACACTGACCACATGGTGTCGATCGATTACATTGATGGCCGAGGTTGG CACGATGCGCGGGTCATTCCCTACGGCCCGATTCAGCTGGATCCGTCCGC GATAGTGCTGCACTACGCGCAGGAAGTTTTTGAGGGACTCAAGGCTTACC GCTGGGCGGACGGGTCGATCGTGTCTTTTCGCCCTGATGCTAACGCGGCC AGGTTGCGTTCGTCGGCGCGGAGAATCGCGATTCCCGAGCTGCCCGACGA GTTATTCATTGACTCTCTGTGTCAGCTCATCGCTGTCGACAATGCTTGGG TGCCCCGGGTCGGCGGTGAAGAGGCGCTTTATCTGCGGCCCTTCATCTTC GCGACCGAGCCGGGGCTGGGGGTACGGCCAGCCAAGCAGTATCGGTACCT GTTGATCGCCTCGCCGGTCGGGGCGTATTTCAAAGGCGGCATCAACCCTG TCACGGTCTGGGTGTCGATGGAGTACGTGCGAGCTAGCCCGGGCGGCACC GGTGCGGCCAAATTTGGCGGCAACTACGCTGCGTCGCTGCTGGCTCAGAC CGAAGCCGCAGCCAACGGGTGCGACCAGGTGGTGTGGCTAGACGCCGTCG AGCGCCGCTTCGTCGAAGAAATGGGCGGGATGAACATCTTCTTTGTGCTC GGCAGCGGCGGGTCGGCACGCCTGGTCACCCCGGAGCTGTCTGGCTCACT GCTGCCCGGGGTCACACGCGCTTCGTTGCTGCAGTTGGCTATTGATGCCG GATTCAGTGTCGAAGAACGTAAGATCGATATCGACGAGTGGCAGAAGAAA GCTGCTGCTGGCGAGATCACCGAGGTGTTTGCCTGCGGCACTGCCGCCTT CATTACCCCGGTCTCGCGGGTGAAATACGGTGATACCGAGTTTACCATCG CCGGTGGCGCACCAGGTGAGGTGACTATGGCGTTGCGCGACACGCTAACT GGAATCCAGCGCGGTACTTTTGCCGACACCCACGGCTGGATGGCCCGGCT GGGA >C1 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C2 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C3 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C4 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C5 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG >C6 MTSGFLEFTVSLSAHPVTDAERESILAEPGFGKYHTDHMVSIDYIDGRGW HDARVIPYGPIQLDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRPDANAA RLRSSARRIAIPELPDELFIDSLCQLIAVDNAWVPRVGGEEALYLRPFIF ATEPGLGVRPAKQYRYLLIASPVGAYFKGGINPVTVWVSMEYVRASPGGT GAAKFGGNYAASLLAQTEAAANGCDQVVWLDAVERRFVEEMGGMNIFFVL GSGGSARLVTPELSGSLLPGVTRASLLQLAIDAGFSVEERKIDIDEWQKK AAAGEITEVFACGTAAFITPVSRVKYGDTEFTIAGGAPGEVTMALRDTLT GIQRGTFADTHGWMARLG MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1104 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579792457 Setting output file names to "/data/2res/ilvE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 190125017 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0548098006 Seed = 908465973 Swapseed = 1579792457 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2470.804922 -- -24.965149 Chain 2 -- -2470.804922 -- -24.965149 Chain 3 -- -2470.804779 -- -24.965149 Chain 4 -- -2470.804922 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2470.804922 -- -24.965149 Chain 2 -- -2470.804922 -- -24.965149 Chain 3 -- -2470.804922 -- -24.965149 Chain 4 -- -2470.804922 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2470.805] (-2470.805) (-2470.805) (-2470.805) * [-2470.805] (-2470.805) (-2470.805) (-2470.805) 500 -- (-1511.051) [-1522.135] (-1519.437) (-1518.953) * [-1506.502] (-1526.820) (-1529.437) (-1539.552) -- 0:00:00 1000 -- [-1504.559] (-1522.217) (-1507.957) (-1506.873) * (-1503.881) (-1523.790) (-1506.082) [-1507.319] -- 0:00:00 1500 -- (-1508.286) [-1506.320] (-1507.801) (-1513.346) * (-1505.355) (-1516.023) [-1503.702] (-1503.248) -- 0:00:00 2000 -- (-1507.904) [-1503.922] (-1511.403) (-1510.880) * [-1508.900] (-1502.484) (-1512.027) (-1504.051) -- 0:00:00 2500 -- (-1502.942) (-1519.432) (-1503.828) [-1506.609] * (-1510.754) (-1504.170) [-1509.672] (-1499.992) -- 0:00:00 3000 -- (-1512.310) (-1510.995) [-1505.487] (-1510.380) * (-1507.888) (-1503.407) [-1505.925] (-1502.666) -- 0:05:32 3500 -- [-1505.386] (-1512.702) (-1503.980) (-1511.814) * (-1510.002) [-1509.261] (-1511.225) (-1505.080) -- 0:04:44 4000 -- (-1506.409) (-1505.767) (-1511.536) [-1501.256] * (-1509.236) [-1503.224] (-1508.994) (-1507.469) -- 0:04:09 4500 -- (-1512.611) [-1507.831] (-1509.472) (-1511.927) * (-1507.110) (-1506.255) (-1510.074) [-1502.354] -- 0:03:41 5000 -- (-1510.407) [-1505.111] (-1507.210) (-1508.731) * (-1511.287) (-1508.160) (-1500.851) [-1509.066] -- 0:03:19 Average standard deviation of split frequencies: 0.097274 5500 -- (-1504.621) [-1502.730] (-1507.757) (-1505.714) * (-1506.260) (-1511.537) (-1510.079) [-1512.108] -- 0:03:00 6000 -- (-1506.376) (-1505.691) (-1512.867) [-1504.759] * (-1520.599) (-1501.490) [-1506.360] (-1505.578) -- 0:02:45 6500 -- [-1508.396] (-1510.156) (-1505.598) (-1508.461) * (-1514.271) [-1511.346] (-1508.534) (-1510.706) -- 0:02:32 7000 -- (-1504.500) (-1512.691) (-1506.315) [-1512.196] * (-1506.640) [-1504.136] (-1508.561) (-1509.633) -- 0:02:21 7500 -- (-1510.790) [-1501.399] (-1505.332) (-1507.866) * (-1514.232) (-1506.266) [-1503.292] (-1503.414) -- 0:02:12 8000 -- (-1509.623) (-1511.908) (-1507.773) [-1512.868] * (-1509.344) [-1511.324] (-1507.065) (-1501.295) -- 0:02:04 8500 -- (-1522.074) [-1508.516] (-1510.612) (-1505.078) * (-1506.724) (-1509.413) (-1511.107) [-1503.024] -- 0:01:56 9000 -- (-1512.356) (-1508.854) (-1527.603) [-1503.629] * [-1504.243] (-1511.916) (-1502.829) (-1505.385) -- 0:01:50 9500 -- (-1510.113) (-1504.359) [-1504.173] (-1508.897) * (-1510.717) (-1510.654) (-1503.253) [-1509.326] -- 0:01:44 10000 -- (-1509.552) (-1508.542) (-1503.799) [-1504.693] * (-1514.290) (-1505.349) [-1506.272] (-1508.690) -- 0:01:39 Average standard deviation of split frequencies: 0.040177 10500 -- (-1504.478) [-1504.621] (-1506.846) (-1507.300) * [-1503.805] (-1505.037) (-1505.822) (-1507.171) -- 0:01:34 11000 -- (-1507.048) [-1503.904] (-1509.647) (-1508.895) * (-1503.423) (-1506.874) [-1507.258] (-1503.634) -- 0:01:29 11500 -- (-1505.640) (-1508.275) [-1504.094] (-1504.663) * (-1503.861) [-1501.888] (-1506.166) (-1504.839) -- 0:01:25 12000 -- (-1503.732) (-1507.841) [-1510.181] (-1513.781) * (-1514.112) [-1506.462] (-1510.003) (-1504.968) -- 0:01:22 12500 -- (-1506.314) (-1510.672) (-1509.231) [-1509.778] * (-1519.377) (-1507.734) (-1510.207) [-1505.889] -- 0:01:19 13000 -- (-1509.173) (-1507.959) (-1504.310) [-1512.080] * (-1508.124) [-1502.166] (-1511.688) (-1509.510) -- 0:01:15 13500 -- (-1503.894) (-1509.395) [-1508.684] (-1514.210) * (-1510.288) [-1505.439] (-1509.508) (-1517.187) -- 0:01:13 14000 -- [-1511.155] (-1507.615) (-1508.247) (-1514.668) * (-1512.090) (-1504.961) (-1509.646) [-1505.429] -- 0:01:10 14500 -- (-1508.984) [-1508.626] (-1509.301) (-1510.790) * (-1501.802) (-1512.170) (-1507.429) [-1503.950] -- 0:01:07 15000 -- [-1508.075] (-1510.888) (-1509.632) (-1502.904) * (-1515.954) (-1508.924) (-1508.619) [-1507.170] -- 0:01:05 Average standard deviation of split frequencies: 0.051993 15500 -- [-1507.480] (-1509.576) (-1511.163) (-1510.266) * [-1505.924] (-1509.362) (-1517.540) (-1510.517) -- 0:01:03 16000 -- (-1504.593) [-1512.120] (-1508.014) (-1519.108) * [-1506.761] (-1502.276) (-1512.242) (-1504.853) -- 0:01:01 16500 -- (-1508.911) [-1512.005] (-1511.592) (-1504.440) * (-1513.663) (-1503.351) (-1501.354) [-1503.933] -- 0:00:59 17000 -- [-1509.913] (-1510.926) (-1509.020) (-1508.244) * [-1503.888] (-1502.742) (-1506.188) (-1512.431) -- 0:00:57 17500 -- [-1504.779] (-1505.023) (-1505.343) (-1507.808) * (-1509.085) [-1501.170] (-1506.713) (-1506.234) -- 0:01:52 18000 -- (-1504.949) (-1507.720) [-1508.456] (-1502.962) * (-1507.680) (-1509.962) (-1506.992) [-1502.900] -- 0:01:49 18500 -- (-1506.503) (-1503.587) [-1509.333] (-1507.712) * [-1510.290] (-1512.941) (-1514.101) (-1507.988) -- 0:01:46 19000 -- (-1512.873) (-1502.999) [-1514.986] (-1509.928) * (-1508.437) (-1503.259) (-1510.647) [-1508.797] -- 0:01:43 19500 -- (-1507.470) (-1507.817) [-1502.126] (-1510.896) * (-1511.661) [-1506.187] (-1516.856) (-1503.114) -- 0:01:40 20000 -- (-1499.972) (-1514.111) (-1512.078) [-1513.767] * [-1511.520] (-1504.601) (-1513.698) (-1510.889) -- 0:01:38 Average standard deviation of split frequencies: 0.040253 20500 -- [-1503.798] (-1507.780) (-1504.616) (-1504.004) * [-1513.064] (-1506.731) (-1509.521) (-1503.697) -- 0:01:35 21000 -- [-1504.556] (-1506.065) (-1505.152) (-1509.915) * [-1505.993] (-1507.516) (-1511.272) (-1510.005) -- 0:01:33 21500 -- (-1509.670) (-1511.342) [-1511.108] (-1513.495) * (-1509.434) [-1505.528] (-1508.356) (-1505.571) -- 0:01:31 22000 -- [-1506.976] (-1507.531) (-1508.023) (-1501.951) * (-1512.108) (-1511.296) [-1497.703] (-1514.409) -- 0:01:28 22500 -- (-1504.191) (-1510.057) [-1508.275] (-1504.174) * [-1507.789] (-1504.098) (-1497.663) (-1512.358) -- 0:01:26 23000 -- (-1503.612) [-1508.654] (-1510.271) (-1500.959) * (-1509.371) (-1504.698) (-1497.663) [-1505.484] -- 0:01:24 23500 -- (-1515.014) (-1504.959) (-1502.871) [-1501.570] * (-1504.995) (-1509.897) [-1498.770] (-1507.380) -- 0:01:23 24000 -- (-1501.836) [-1502.324] (-1517.391) (-1502.358) * (-1508.231) (-1518.205) (-1500.148) [-1504.515] -- 0:01:21 24500 -- (-1503.707) (-1517.247) (-1511.966) [-1501.147] * (-1507.938) [-1507.684] (-1497.303) (-1509.222) -- 0:01:19 25000 -- (-1498.213) [-1508.281] (-1505.024) (-1502.696) * (-1509.535) (-1505.408) (-1499.170) [-1500.607] -- 0:01:18 Average standard deviation of split frequencies: 0.041987 25500 -- (-1497.749) (-1504.967) [-1498.977] (-1499.413) * (-1508.499) (-1510.072) [-1501.292] (-1506.017) -- 0:01:16 26000 -- (-1497.994) (-1503.775) [-1498.109] (-1499.205) * (-1515.417) (-1506.457) (-1499.012) [-1507.129] -- 0:01:14 26500 -- (-1497.660) [-1508.118] (-1498.087) (-1500.110) * [-1507.028] (-1505.096) (-1500.478) (-1511.981) -- 0:01:13 27000 -- (-1496.717) (-1504.665) (-1502.645) [-1499.813] * (-1503.123) (-1510.835) (-1497.055) [-1503.024] -- 0:01:12 27500 -- [-1498.206] (-1507.202) (-1501.854) (-1498.060) * [-1501.290] (-1511.826) (-1497.693) (-1511.263) -- 0:01:10 28000 -- (-1497.470) (-1509.008) (-1502.009) [-1499.078] * (-1504.788) [-1501.664] (-1496.917) (-1508.641) -- 0:01:09 28500 -- (-1497.328) (-1508.645) (-1501.264) [-1499.868] * (-1504.051) (-1510.429) [-1500.565] (-1508.934) -- 0:01:08 29000 -- (-1497.882) (-1505.854) [-1498.125] (-1497.437) * [-1509.201] (-1512.190) (-1498.151) (-1502.748) -- 0:01:06 29500 -- (-1496.725) (-1503.043) [-1499.657] (-1497.879) * (-1507.340) [-1504.799] (-1499.917) (-1497.048) -- 0:01:05 30000 -- (-1496.791) [-1508.709] (-1498.198) (-1499.373) * [-1504.641] (-1503.784) (-1496.384) (-1497.418) -- 0:01:04 Average standard deviation of split frequencies: 0.037576 30500 -- [-1497.105] (-1504.079) (-1497.390) (-1499.342) * (-1512.080) (-1515.468) [-1496.820] (-1498.383) -- 0:01:03 31000 -- (-1499.136) (-1506.304) (-1497.682) [-1499.590] * (-1511.968) (-1507.802) (-1496.590) [-1498.648] -- 0:01:33 31500 -- (-1497.949) [-1507.839] (-1498.435) (-1500.811) * (-1517.818) [-1507.893] (-1498.769) (-1496.910) -- 0:01:32 32000 -- (-1497.527) (-1503.475) [-1499.078] (-1499.499) * [-1497.229] (-1511.610) (-1497.696) (-1497.956) -- 0:01:30 32500 -- (-1497.440) (-1514.700) (-1500.024) [-1500.103] * [-1497.728] (-1503.187) (-1496.753) (-1497.956) -- 0:01:29 33000 -- [-1499.794] (-1508.126) (-1499.236) (-1499.821) * (-1497.714) [-1505.602] (-1496.745) (-1501.083) -- 0:01:27 33500 -- (-1498.930) [-1507.482] (-1500.030) (-1499.078) * (-1500.802) [-1506.599] (-1496.737) (-1500.218) -- 0:01:26 34000 -- (-1498.442) (-1508.664) [-1501.458] (-1497.997) * (-1497.237) (-1509.541) [-1497.731] (-1500.751) -- 0:01:25 34500 -- [-1498.228] (-1509.832) (-1499.440) (-1496.923) * (-1499.583) (-1511.402) [-1498.599] (-1498.613) -- 0:01:23 35000 -- [-1499.040] (-1513.989) (-1501.200) (-1497.159) * (-1497.931) (-1511.714) [-1496.830] (-1498.191) -- 0:01:22 Average standard deviation of split frequencies: 0.035838 35500 -- (-1500.954) [-1507.793] (-1498.736) (-1498.480) * [-1496.341] (-1502.301) (-1497.960) (-1500.455) -- 0:01:21 36000 -- (-1499.587) (-1507.571) [-1499.680] (-1500.823) * (-1498.869) (-1505.080) (-1496.864) [-1499.790] -- 0:01:20 36500 -- (-1499.210) (-1507.167) (-1500.091) [-1499.480] * [-1498.225] (-1504.019) (-1497.292) (-1498.414) -- 0:01:19 37000 -- (-1497.608) [-1504.954] (-1500.941) (-1499.631) * [-1498.834] (-1509.524) (-1497.083) (-1497.665) -- 0:01:18 37500 -- (-1498.967) (-1514.846) (-1500.704) [-1500.060] * (-1498.716) (-1513.945) (-1497.239) [-1498.471] -- 0:01:17 38000 -- (-1498.934) (-1502.465) (-1499.604) [-1502.206] * (-1498.627) [-1508.615] (-1498.824) (-1500.197) -- 0:01:15 38500 -- (-1498.719) [-1505.777] (-1497.531) (-1499.887) * (-1496.445) (-1511.737) [-1498.562] (-1500.491) -- 0:01:14 39000 -- (-1500.053) (-1509.606) (-1497.593) [-1497.898] * [-1496.448] (-1503.435) (-1498.267) (-1499.831) -- 0:01:13 39500 -- (-1500.986) [-1501.884] (-1500.371) (-1499.481) * (-1496.447) (-1511.177) [-1496.777] (-1507.323) -- 0:01:12 40000 -- (-1501.745) (-1503.599) [-1499.012] (-1499.975) * [-1496.440] (-1508.469) (-1497.252) (-1507.731) -- 0:01:12 Average standard deviation of split frequencies: 0.034196 40500 -- (-1500.695) (-1506.510) [-1497.584] (-1500.612) * [-1497.992] (-1502.703) (-1497.370) (-1503.404) -- 0:01:11 41000 -- (-1496.857) [-1506.690] (-1498.940) (-1500.332) * (-1497.590) (-1503.045) (-1498.545) [-1499.453] -- 0:01:10 41500 -- (-1497.921) [-1509.645] (-1499.523) (-1499.825) * (-1498.512) (-1504.442) [-1500.801] (-1499.101) -- 0:01:09 42000 -- (-1498.714) (-1521.328) (-1498.998) [-1499.268] * (-1499.015) [-1508.196] (-1499.697) (-1502.007) -- 0:01:08 42500 -- [-1499.908] (-1504.675) (-1498.574) (-1498.446) * (-1499.034) (-1505.176) [-1496.533] (-1497.833) -- 0:01:07 43000 -- (-1500.941) (-1504.174) (-1498.197) [-1499.363] * (-1497.860) (-1507.346) (-1496.162) [-1497.406] -- 0:01:06 43500 -- (-1497.830) (-1509.184) [-1500.307] (-1499.192) * (-1497.794) [-1510.102] (-1499.053) (-1497.552) -- 0:01:05 44000 -- (-1499.468) [-1505.209] (-1497.118) (-1499.095) * (-1498.694) (-1506.458) (-1498.064) [-1497.208] -- 0:01:05 44500 -- (-1497.853) [-1506.152] (-1499.036) (-1500.529) * [-1498.244] (-1507.309) (-1497.556) (-1497.387) -- 0:01:04 45000 -- (-1501.338) [-1504.490] (-1497.453) (-1498.770) * (-1496.964) (-1507.698) (-1498.085) [-1496.453] -- 0:01:24 Average standard deviation of split frequencies: 0.025376 45500 -- (-1501.087) [-1501.022] (-1496.932) (-1499.048) * [-1496.922] (-1509.489) (-1498.592) (-1496.605) -- 0:01:23 46000 -- (-1497.734) [-1508.683] (-1496.524) (-1496.739) * (-1497.625) [-1504.331] (-1499.492) (-1501.530) -- 0:01:22 46500 -- (-1499.504) (-1513.552) (-1498.491) [-1496.747] * (-1501.911) (-1513.870) [-1498.507] (-1496.518) -- 0:01:22 47000 -- (-1498.214) (-1505.014) (-1499.273) [-1496.423] * (-1496.636) [-1503.991] (-1500.181) (-1496.512) -- 0:01:21 47500 -- (-1499.230) (-1505.710) (-1502.017) [-1496.498] * (-1501.638) (-1509.600) (-1498.273) [-1497.023] -- 0:01:20 48000 -- [-1499.694] (-1509.624) (-1501.886) (-1497.696) * [-1499.826] (-1509.558) (-1498.807) (-1496.816) -- 0:01:19 48500 -- (-1498.636) (-1501.317) [-1496.557] (-1497.588) * (-1504.078) [-1506.524] (-1500.017) (-1496.820) -- 0:01:18 49000 -- (-1497.322) (-1506.409) (-1499.497) [-1496.941] * [-1498.017] (-1504.633) (-1498.799) (-1499.122) -- 0:01:17 49500 -- (-1496.853) (-1508.062) [-1500.715] (-1499.475) * (-1503.173) (-1514.934) [-1498.010] (-1496.452) -- 0:01:16 50000 -- (-1499.383) (-1507.387) (-1498.624) [-1497.837] * [-1497.328] (-1514.461) (-1497.918) (-1501.540) -- 0:01:16 Average standard deviation of split frequencies: 0.027469 50500 -- (-1501.836) (-1504.686) [-1503.001] (-1497.939) * (-1497.503) (-1504.907) (-1498.468) [-1498.028] -- 0:01:15 51000 -- (-1501.079) [-1512.105] (-1498.648) (-1501.001) * [-1500.037] (-1505.913) (-1497.383) (-1497.266) -- 0:01:14 51500 -- (-1501.010) (-1508.114) (-1497.568) [-1498.575] * (-1500.369) [-1510.515] (-1498.044) (-1498.145) -- 0:01:13 52000 -- (-1501.491) (-1505.353) (-1498.302) [-1499.184] * (-1500.310) (-1506.329) (-1498.622) [-1499.963] -- 0:01:12 52500 -- (-1498.800) (-1505.693) (-1498.048) [-1498.044] * (-1504.408) [-1510.321] (-1498.821) (-1497.842) -- 0:01:12 53000 -- (-1499.035) [-1504.837] (-1496.935) (-1497.780) * (-1498.193) (-1505.007) (-1507.213) [-1498.809] -- 0:01:11 53500 -- (-1501.547) [-1501.555] (-1503.962) (-1497.698) * (-1500.790) [-1503.784] (-1499.101) (-1500.996) -- 0:01:10 54000 -- (-1498.144) [-1505.480] (-1504.338) (-1498.252) * (-1502.572) [-1508.250] (-1501.541) (-1497.232) -- 0:01:10 54500 -- (-1496.647) (-1510.131) (-1503.768) [-1497.980] * [-1503.691] (-1509.721) (-1503.543) (-1497.332) -- 0:01:09 55000 -- [-1497.124] (-1503.797) (-1508.383) (-1500.629) * (-1498.869) (-1504.030) [-1505.718] (-1498.202) -- 0:01:08 Average standard deviation of split frequencies: 0.032068 55500 -- (-1498.747) [-1512.390] (-1501.038) (-1500.554) * (-1499.050) (-1509.059) (-1500.887) [-1498.617] -- 0:01:08 56000 -- (-1498.767) [-1511.121] (-1502.790) (-1511.386) * [-1499.507] (-1508.731) (-1499.725) (-1497.496) -- 0:01:07 56500 -- (-1500.202) (-1510.839) [-1502.800] (-1498.788) * [-1498.116] (-1504.343) (-1500.754) (-1500.100) -- 0:01:06 57000 -- (-1501.780) (-1505.270) (-1502.358) [-1503.086] * (-1500.250) (-1516.990) [-1497.135] (-1497.004) -- 0:01:06 57500 -- (-1500.210) (-1503.493) [-1497.316] (-1502.341) * (-1496.686) (-1506.520) [-1496.678] (-1496.745) -- 0:01:05 58000 -- [-1497.548] (-1511.356) (-1498.664) (-1501.706) * (-1497.732) (-1519.000) (-1497.121) [-1497.478] -- 0:01:04 58500 -- (-1499.720) [-1508.480] (-1499.227) (-1498.223) * (-1496.872) (-1511.050) [-1498.064] (-1499.766) -- 0:01:20 59000 -- (-1499.667) [-1502.480] (-1505.150) (-1498.472) * (-1498.218) (-1507.642) [-1500.814] (-1498.055) -- 0:01:19 59500 -- (-1499.114) [-1511.539] (-1501.713) (-1500.247) * [-1498.616] (-1516.134) (-1498.303) (-1497.345) -- 0:01:19 60000 -- (-1498.760) (-1518.873) [-1499.599] (-1500.047) * (-1496.607) [-1504.704] (-1497.521) (-1497.783) -- 0:01:18 Average standard deviation of split frequencies: 0.032562 60500 -- (-1497.848) (-1519.258) [-1497.575] (-1498.937) * (-1499.947) (-1518.233) [-1497.482] (-1504.562) -- 0:01:17 61000 -- (-1497.829) [-1505.616] (-1497.594) (-1498.928) * [-1498.382] (-1516.844) (-1501.088) (-1498.336) -- 0:01:16 61500 -- (-1497.706) (-1499.991) (-1498.853) [-1499.001] * (-1500.600) (-1510.556) [-1497.864] (-1497.836) -- 0:01:16 62000 -- (-1498.422) (-1503.529) [-1496.667] (-1502.128) * [-1500.232] (-1505.638) (-1498.550) (-1496.859) -- 0:01:15 62500 -- (-1498.533) [-1503.614] (-1497.716) (-1500.724) * [-1499.064] (-1507.802) (-1497.566) (-1497.188) -- 0:01:15 63000 -- (-1500.861) [-1502.148] (-1496.611) (-1500.022) * (-1501.058) (-1510.285) (-1503.375) [-1496.901] -- 0:01:14 63500 -- (-1499.711) [-1498.359] (-1496.460) (-1500.031) * [-1499.774] (-1510.233) (-1503.537) (-1497.657) -- 0:01:13 64000 -- (-1500.901) (-1498.776) (-1496.719) [-1498.740] * [-1498.555] (-1515.009) (-1497.339) (-1497.536) -- 0:01:13 64500 -- [-1499.890] (-1498.294) (-1498.082) (-1500.741) * [-1498.558] (-1517.175) (-1499.560) (-1498.347) -- 0:01:12 65000 -- [-1497.384] (-1496.892) (-1499.913) (-1497.471) * (-1498.929) (-1511.585) [-1499.881] (-1502.106) -- 0:01:11 Average standard deviation of split frequencies: 0.026622 65500 -- [-1496.842] (-1496.701) (-1501.187) (-1496.614) * [-1498.029] (-1507.945) (-1499.833) (-1501.797) -- 0:01:11 66000 -- [-1497.350] (-1497.739) (-1498.547) (-1497.556) * (-1498.097) [-1510.787] (-1500.413) (-1500.086) -- 0:01:10 66500 -- [-1498.678] (-1497.155) (-1498.020) (-1500.222) * (-1499.553) (-1509.688) [-1499.459] (-1500.544) -- 0:01:10 67000 -- (-1498.865) [-1496.986] (-1498.406) (-1499.067) * (-1498.196) [-1508.042] (-1499.915) (-1502.013) -- 0:01:09 67500 -- (-1498.264) (-1497.480) (-1499.553) [-1496.940] * (-1501.076) (-1508.399) [-1498.950] (-1505.344) -- 0:01:09 68000 -- (-1498.068) (-1498.414) (-1499.121) [-1497.935] * (-1502.288) (-1507.451) [-1499.435] (-1498.412) -- 0:01:08 68500 -- [-1498.783] (-1497.701) (-1498.919) (-1496.375) * (-1497.275) [-1507.292] (-1498.565) (-1498.622) -- 0:01:07 69000 -- (-1500.146) (-1497.564) [-1501.610] (-1497.115) * (-1497.549) (-1511.837) (-1500.455) [-1498.025] -- 0:01:07 69500 -- (-1501.200) [-1498.082] (-1498.269) (-1498.206) * [-1498.153] (-1503.474) (-1498.862) (-1509.006) -- 0:01:06 70000 -- [-1499.812] (-1505.410) (-1497.677) (-1497.734) * (-1505.212) [-1501.952] (-1497.277) (-1504.264) -- 0:01:06 Average standard deviation of split frequencies: 0.027319 70500 -- (-1503.317) (-1501.671) (-1497.577) [-1497.131] * (-1501.356) (-1508.638) [-1500.302] (-1506.555) -- 0:01:19 71000 -- (-1504.427) [-1502.327] (-1498.643) (-1499.090) * [-1499.213] (-1510.732) (-1497.697) (-1497.748) -- 0:01:18 71500 -- (-1504.762) (-1501.413) [-1497.397] (-1496.520) * (-1499.140) (-1506.942) [-1499.377] (-1500.866) -- 0:01:17 72000 -- [-1506.846] (-1500.938) (-1496.684) (-1496.520) * (-1501.262) (-1512.868) [-1498.067] (-1502.812) -- 0:01:17 72500 -- (-1501.630) (-1506.695) [-1496.413] (-1497.055) * (-1498.075) (-1504.148) (-1499.812) [-1500.458] -- 0:01:16 73000 -- (-1501.683) (-1497.668) [-1496.597] (-1497.066) * (-1502.803) (-1503.264) (-1499.121) [-1500.445] -- 0:01:16 73500 -- [-1501.697] (-1501.315) (-1496.596) (-1497.066) * (-1500.897) (-1508.642) (-1499.173) [-1498.868] -- 0:01:15 74000 -- (-1500.992) (-1498.976) [-1497.226] (-1497.493) * (-1503.110) (-1507.625) (-1499.050) [-1498.856] -- 0:01:15 74500 -- (-1497.285) (-1498.042) [-1497.208] (-1496.472) * (-1502.363) [-1503.721] (-1499.115) (-1499.726) -- 0:01:14 75000 -- (-1497.185) (-1498.670) (-1503.523) [-1496.411] * (-1497.652) [-1506.487] (-1498.869) (-1498.477) -- 0:01:14 Average standard deviation of split frequencies: 0.026288 75500 -- (-1498.406) (-1498.417) (-1503.664) [-1496.560] * (-1500.521) (-1506.283) (-1498.472) [-1497.475] -- 0:01:13 76000 -- (-1498.466) (-1498.168) (-1502.630) [-1496.280] * (-1497.666) (-1506.616) (-1498.623) [-1497.886] -- 0:01:12 76500 -- (-1498.397) (-1498.229) (-1501.284) [-1496.402] * (-1499.376) (-1512.908) (-1499.143) [-1496.861] -- 0:01:12 77000 -- (-1498.044) (-1498.395) [-1501.242] (-1496.395) * (-1497.820) [-1507.307] (-1501.637) (-1498.222) -- 0:01:11 77500 -- [-1497.267] (-1496.817) (-1498.809) (-1496.873) * (-1496.666) (-1507.274) (-1498.903) [-1498.240] -- 0:01:11 78000 -- (-1498.361) (-1498.586) [-1499.944] (-1496.557) * (-1499.199) (-1505.636) [-1499.312] (-1498.809) -- 0:01:10 78500 -- (-1498.444) [-1496.931] (-1498.408) (-1496.838) * (-1505.290) [-1514.671] (-1500.007) (-1498.688) -- 0:01:10 79000 -- (-1499.717) [-1496.525] (-1500.252) (-1498.168) * (-1497.758) (-1509.180) [-1502.022] (-1497.204) -- 0:01:09 79500 -- (-1499.318) [-1498.271] (-1499.846) (-1496.652) * [-1497.205] (-1509.462) (-1500.217) (-1500.270) -- 0:01:09 80000 -- [-1497.963] (-1497.422) (-1499.627) (-1498.486) * (-1498.526) (-1508.513) (-1501.384) [-1498.727] -- 0:01:09 Average standard deviation of split frequencies: 0.022726 80500 -- (-1500.366) (-1496.587) (-1500.642) [-1498.688] * (-1501.544) [-1508.700] (-1500.290) (-1497.255) -- 0:01:08 81000 -- (-1501.761) [-1499.175] (-1500.069) (-1499.161) * (-1501.305) (-1505.648) [-1498.978] (-1498.596) -- 0:01:08 81500 -- [-1501.145] (-1500.702) (-1497.003) (-1498.679) * (-1499.515) (-1505.525) (-1501.614) [-1499.788] -- 0:01:07 82000 -- (-1499.332) [-1502.073] (-1496.841) (-1497.126) * (-1503.643) (-1508.434) (-1501.855) [-1496.680] -- 0:01:07 82500 -- (-1498.382) (-1500.330) (-1497.617) [-1497.969] * (-1499.007) [-1502.641] (-1499.968) (-1496.703) -- 0:01:06 83000 -- (-1497.964) (-1500.331) (-1499.801) [-1497.468] * (-1504.363) (-1506.281) (-1501.273) [-1496.730] -- 0:01:06 83500 -- (-1498.574) (-1501.548) [-1500.149] (-1498.434) * (-1502.174) (-1506.983) [-1497.341] (-1498.971) -- 0:01:05 84000 -- (-1499.523) (-1499.080) (-1497.563) [-1497.504] * (-1501.179) (-1512.335) [-1498.273] (-1497.399) -- 0:01:05 84500 -- [-1499.217] (-1497.488) (-1497.759) (-1498.120) * [-1499.121] (-1514.631) (-1497.936) (-1497.342) -- 0:01:15 85000 -- (-1498.343) (-1496.817) [-1499.391] (-1499.004) * (-1499.234) (-1508.100) (-1500.189) [-1497.695] -- 0:01:15 Average standard deviation of split frequencies: 0.024667 85500 -- (-1503.024) [-1498.109] (-1500.280) (-1497.261) * (-1498.742) [-1505.127] (-1497.434) (-1499.650) -- 0:01:14 86000 -- (-1504.183) (-1497.875) [-1497.516] (-1502.181) * (-1499.208) (-1516.401) (-1498.150) [-1498.922] -- 0:01:14 86500 -- (-1497.990) (-1498.651) [-1498.227] (-1496.735) * (-1498.618) [-1505.113] (-1498.064) (-1504.504) -- 0:01:13 87000 -- (-1498.699) [-1498.274] (-1497.581) (-1496.847) * [-1498.317] (-1516.608) (-1497.516) (-1503.187) -- 0:01:13 87500 -- (-1502.050) (-1498.638) [-1497.540] (-1499.723) * [-1499.929] (-1504.328) (-1498.419) (-1498.273) -- 0:01:13 88000 -- (-1502.004) (-1496.740) [-1497.245] (-1500.964) * (-1501.332) (-1507.298) [-1496.774] (-1500.763) -- 0:01:12 88500 -- [-1502.792] (-1497.159) (-1502.429) (-1500.561) * (-1502.361) (-1502.339) (-1498.135) [-1499.598] -- 0:01:12 89000 -- [-1499.531] (-1497.495) (-1500.556) (-1499.580) * (-1503.926) (-1499.713) (-1497.622) [-1499.326] -- 0:01:11 89500 -- (-1499.054) (-1499.539) [-1497.862] (-1497.488) * (-1501.591) (-1497.712) [-1498.993] (-1499.670) -- 0:01:11 90000 -- (-1499.997) (-1499.790) [-1496.935] (-1497.265) * (-1498.693) (-1499.627) (-1498.697) [-1498.345] -- 0:01:10 Average standard deviation of split frequencies: 0.027036 90500 -- (-1502.511) (-1498.581) (-1498.384) [-1497.244] * (-1500.362) [-1504.013] (-1498.649) (-1497.284) -- 0:01:10 91000 -- (-1497.928) (-1499.706) [-1497.544] (-1501.289) * (-1498.677) [-1498.045] (-1498.388) (-1496.549) -- 0:01:09 91500 -- [-1499.740] (-1499.632) (-1497.245) (-1497.305) * [-1498.732] (-1499.437) (-1497.733) (-1498.237) -- 0:01:09 92000 -- (-1503.048) [-1498.362] (-1497.086) (-1497.145) * (-1499.703) (-1499.437) [-1497.667] (-1498.121) -- 0:01:09 92500 -- (-1499.188) (-1499.259) (-1497.101) [-1497.157] * (-1500.786) (-1501.602) (-1497.409) [-1497.035] -- 0:01:08 93000 -- [-1499.183] (-1504.581) (-1497.821) (-1498.179) * (-1501.548) [-1498.150] (-1498.482) (-1497.366) -- 0:01:08 93500 -- (-1499.766) [-1498.570] (-1498.054) (-1500.156) * (-1499.010) (-1498.115) (-1501.517) [-1497.137] -- 0:01:07 94000 -- (-1501.172) (-1498.712) (-1497.306) [-1498.879] * [-1499.266] (-1499.887) (-1499.284) (-1499.632) -- 0:01:07 94500 -- (-1502.114) [-1498.378] (-1498.020) (-1497.091) * (-1500.839) (-1498.789) (-1499.946) [-1499.746] -- 0:01:07 95000 -- (-1504.096) (-1498.398) (-1498.914) [-1499.266] * (-1500.538) (-1497.430) (-1499.798) [-1497.732] -- 0:01:06 Average standard deviation of split frequencies: 0.025289 95500 -- (-1501.146) [-1498.416] (-1498.468) (-1497.653) * (-1499.500) (-1500.894) (-1497.283) [-1497.649] -- 0:01:06 96000 -- [-1499.694] (-1501.192) (-1499.287) (-1498.619) * (-1500.509) [-1497.451] (-1497.403) (-1499.861) -- 0:01:05 96500 -- (-1502.009) (-1503.450) [-1498.756] (-1498.642) * (-1498.791) (-1500.048) (-1498.191) [-1498.805] -- 0:01:05 97000 -- [-1498.407] (-1499.535) (-1497.753) (-1500.245) * (-1499.712) (-1499.902) [-1500.104] (-1499.769) -- 0:01:05 97500 -- (-1499.250) (-1497.347) (-1499.317) [-1497.812] * (-1499.360) (-1499.215) (-1499.135) [-1499.880] -- 0:01:04 98000 -- [-1497.894] (-1497.608) (-1499.563) (-1498.797) * [-1498.477] (-1500.760) (-1497.275) (-1499.028) -- 0:01:04 98500 -- (-1503.943) (-1498.322) [-1499.082] (-1498.754) * (-1499.106) (-1500.507) (-1498.212) [-1498.022] -- 0:01:04 99000 -- (-1498.752) [-1497.122] (-1498.802) (-1499.567) * (-1499.702) [-1499.059] (-1499.013) (-1498.391) -- 0:01:12 99500 -- [-1498.587] (-1497.398) (-1497.767) (-1497.846) * (-1497.494) [-1498.642] (-1500.691) (-1497.205) -- 0:01:12 100000 -- (-1497.538) (-1497.046) [-1498.192] (-1499.590) * [-1497.785] (-1496.865) (-1498.157) (-1497.862) -- 0:01:12 Average standard deviation of split frequencies: 0.027358 100500 -- (-1502.426) [-1499.441] (-1503.038) (-1499.953) * (-1502.416) (-1498.817) (-1497.490) [-1499.549] -- 0:01:11 101000 -- (-1499.512) (-1497.600) (-1498.325) [-1497.684] * (-1502.615) (-1498.566) [-1498.905] (-1498.711) -- 0:01:11 101500 -- (-1499.178) (-1497.931) [-1499.449] (-1497.393) * [-1497.413] (-1498.004) (-1499.760) (-1501.394) -- 0:01:10 102000 -- (-1497.883) (-1499.575) (-1496.812) [-1498.137] * (-1498.422) (-1497.740) (-1498.880) [-1498.407] -- 0:01:10 102500 -- (-1497.928) [-1499.747] (-1499.379) (-1499.170) * (-1499.446) (-1497.510) [-1498.093] (-1504.001) -- 0:01:10 103000 -- (-1497.819) (-1500.683) [-1500.577] (-1497.195) * (-1497.781) [-1499.188] (-1500.984) (-1498.286) -- 0:01:09 103500 -- (-1499.698) (-1501.556) [-1501.253] (-1498.098) * (-1497.945) (-1498.785) (-1499.529) [-1497.205] -- 0:01:09 104000 -- (-1497.977) [-1498.456] (-1499.469) (-1496.694) * (-1498.610) (-1497.768) (-1500.573) [-1498.709] -- 0:01:08 104500 -- (-1497.880) (-1497.047) (-1496.888) [-1498.645] * (-1497.312) [-1497.257] (-1499.699) (-1497.784) -- 0:01:08 105000 -- [-1499.250] (-1497.404) (-1497.540) (-1500.701) * [-1497.675] (-1497.086) (-1500.745) (-1499.340) -- 0:01:08 Average standard deviation of split frequencies: 0.027088 105500 -- (-1498.991) (-1498.660) (-1497.735) [-1497.458] * [-1497.657] (-1496.693) (-1500.391) (-1501.284) -- 0:01:07 106000 -- (-1498.883) [-1499.829] (-1497.734) (-1496.874) * (-1498.978) [-1496.615] (-1502.363) (-1496.777) -- 0:01:07 106500 -- (-1498.995) (-1498.399) (-1496.630) [-1497.715] * [-1501.102] (-1498.720) (-1502.769) (-1498.472) -- 0:01:07 107000 -- (-1502.218) (-1499.976) [-1500.128] (-1497.917) * [-1497.464] (-1498.178) (-1500.434) (-1496.904) -- 0:01:06 107500 -- (-1499.354) (-1499.880) (-1498.723) [-1497.281] * (-1498.877) (-1496.626) (-1503.845) [-1496.837] -- 0:01:06 108000 -- (-1499.918) (-1499.659) (-1499.280) [-1496.578] * (-1497.113) (-1496.616) (-1499.550) [-1497.227] -- 0:01:06 108500 -- (-1498.035) (-1498.412) (-1500.115) [-1500.605] * (-1497.051) (-1496.555) (-1502.069) [-1498.052] -- 0:01:05 109000 -- [-1497.256] (-1498.082) (-1498.594) (-1499.265) * (-1499.588) (-1496.585) (-1497.960) [-1499.709] -- 0:01:05 109500 -- [-1497.190] (-1502.268) (-1499.404) (-1500.734) * (-1500.608) (-1496.321) (-1498.709) [-1499.574] -- 0:01:05 110000 -- (-1498.308) (-1499.018) (-1498.058) [-1504.556] * [-1498.743] (-1497.802) (-1497.989) (-1497.912) -- 0:01:04 Average standard deviation of split frequencies: 0.024375 110500 -- (-1497.032) (-1499.018) (-1497.464) [-1500.341] * (-1499.130) [-1500.958] (-1497.874) (-1498.662) -- 0:01:04 111000 -- [-1497.405] (-1500.950) (-1500.563) (-1500.886) * [-1498.894] (-1501.262) (-1496.939) (-1497.917) -- 0:01:04 111500 -- (-1498.382) [-1497.082] (-1500.058) (-1499.114) * (-1498.696) [-1499.174] (-1498.092) (-1497.742) -- 0:01:03 112000 -- (-1498.348) (-1497.196) (-1502.231) [-1498.570] * (-1497.242) (-1496.939) [-1500.868] (-1502.290) -- 0:01:03 112500 -- (-1498.514) (-1497.431) (-1500.965) [-1496.871] * (-1497.810) (-1498.221) [-1496.822] (-1506.089) -- 0:01:03 113000 -- (-1497.441) (-1497.915) (-1500.308) [-1497.190] * (-1497.251) (-1497.275) [-1499.298] (-1496.602) -- 0:01:02 113500 -- [-1497.608] (-1500.137) (-1500.832) (-1496.962) * (-1500.862) (-1497.170) [-1499.263] (-1498.739) -- 0:01:02 114000 -- (-1503.050) (-1497.411) (-1499.663) [-1498.374] * (-1499.538) (-1497.068) [-1498.770] (-1500.040) -- 0:01:09 114500 -- (-1499.319) (-1498.165) [-1499.263] (-1500.075) * [-1498.127] (-1500.512) (-1497.462) (-1499.351) -- 0:01:09 115000 -- (-1500.682) (-1503.635) [-1503.645] (-1497.636) * [-1501.685] (-1498.979) (-1497.462) (-1497.136) -- 0:01:09 Average standard deviation of split frequencies: 0.023254 115500 -- (-1496.833) (-1500.720) (-1501.407) [-1496.779] * [-1501.658] (-1497.833) (-1496.720) (-1497.306) -- 0:01:08 116000 -- (-1497.418) (-1500.497) [-1501.760] (-1499.597) * (-1500.992) (-1499.954) (-1499.329) [-1499.530] -- 0:01:08 116500 -- (-1498.677) (-1498.723) [-1498.587] (-1498.093) * (-1501.272) (-1498.291) [-1496.678] (-1499.530) -- 0:01:08 117000 -- (-1499.188) (-1502.425) (-1498.954) [-1498.300] * (-1501.315) (-1501.582) (-1498.570) [-1498.321] -- 0:01:07 117500 -- (-1503.091) (-1497.710) (-1498.638) [-1500.320] * [-1497.835] (-1499.080) (-1500.114) (-1498.079) -- 0:01:07 118000 -- (-1496.863) [-1498.181] (-1497.811) (-1499.697) * [-1497.034] (-1498.683) (-1499.223) (-1498.528) -- 0:01:07 118500 -- (-1498.304) (-1504.358) [-1499.560] (-1498.443) * (-1499.453) (-1497.020) (-1497.619) [-1497.666] -- 0:01:06 119000 -- (-1498.666) (-1498.345) (-1499.396) [-1498.688] * (-1499.066) (-1498.814) [-1497.361] (-1498.570) -- 0:01:06 119500 -- [-1496.246] (-1501.893) (-1498.810) (-1499.322) * (-1499.730) [-1499.896] (-1500.526) (-1500.317) -- 0:01:06 120000 -- (-1501.257) (-1500.421) (-1497.645) [-1499.164] * (-1497.539) [-1499.951] (-1498.820) (-1501.586) -- 0:01:06 Average standard deviation of split frequencies: 0.024308 120500 -- (-1500.593) (-1497.302) (-1498.046) [-1502.496] * (-1497.444) (-1498.579) [-1498.434] (-1499.442) -- 0:01:05 121000 -- [-1501.302] (-1498.295) (-1497.676) (-1501.560) * (-1500.161) (-1496.444) (-1496.889) [-1498.883] -- 0:01:05 121500 -- (-1498.961) (-1503.421) (-1499.981) [-1496.838] * (-1501.669) (-1496.955) (-1499.182) [-1498.370] -- 0:01:05 122000 -- [-1496.945] (-1497.680) (-1498.975) (-1498.463) * (-1499.018) (-1496.594) (-1504.373) [-1498.411] -- 0:01:04 122500 -- (-1496.603) [-1496.685] (-1499.483) (-1502.543) * (-1498.511) (-1497.629) [-1500.992] (-1498.662) -- 0:01:04 123000 -- (-1499.566) (-1496.505) (-1497.849) [-1496.856] * (-1498.904) (-1497.618) (-1497.189) [-1498.034] -- 0:01:04 123500 -- [-1501.019] (-1501.107) (-1498.486) (-1497.368) * (-1499.280) (-1499.078) (-1499.789) [-1500.183] -- 0:01:03 124000 -- [-1498.228] (-1498.072) (-1499.662) (-1498.441) * (-1499.941) (-1497.780) [-1499.324] (-1500.658) -- 0:01:03 124500 -- (-1499.187) (-1497.394) (-1498.732) [-1498.197] * (-1499.963) (-1496.948) [-1498.190] (-1497.606) -- 0:01:03 125000 -- (-1501.531) (-1497.404) (-1500.800) [-1497.411] * (-1498.622) (-1497.309) [-1498.818] (-1499.184) -- 0:01:03 Average standard deviation of split frequencies: 0.022448 125500 -- (-1500.265) [-1498.044] (-1497.536) (-1497.332) * (-1498.468) [-1497.172] (-1499.349) (-1498.372) -- 0:01:02 126000 -- (-1499.804) (-1502.086) [-1497.137] (-1496.861) * (-1496.801) (-1496.829) (-1497.389) [-1498.139] -- 0:01:02 126500 -- (-1497.792) (-1500.549) (-1496.483) [-1496.711] * [-1498.851] (-1499.899) (-1497.767) (-1497.933) -- 0:01:02 127000 -- (-1500.095) (-1499.611) (-1499.514) [-1497.517] * (-1497.188) (-1496.749) (-1498.477) [-1499.845] -- 0:01:01 127500 -- (-1505.750) (-1498.812) (-1496.448) [-1496.461] * (-1496.961) [-1497.795] (-1499.239) (-1498.345) -- 0:01:08 128000 -- [-1498.726] (-1497.922) (-1496.845) (-1498.099) * (-1498.185) [-1497.279] (-1498.342) (-1498.664) -- 0:01:08 128500 -- (-1499.476) (-1497.745) (-1497.079) [-1498.217] * (-1499.832) (-1496.752) [-1497.578] (-1497.360) -- 0:01:07 129000 -- [-1502.480] (-1498.606) (-1499.786) (-1497.656) * (-1497.206) (-1497.113) (-1499.803) [-1497.360] -- 0:01:07 129500 -- (-1496.898) (-1498.541) (-1502.871) [-1498.162] * (-1497.104) (-1497.775) (-1497.300) [-1499.208] -- 0:01:07 130000 -- [-1497.408] (-1499.707) (-1500.087) (-1497.023) * (-1496.683) [-1497.901] (-1498.580) (-1497.044) -- 0:01:06 Average standard deviation of split frequencies: 0.021446 130500 -- (-1497.298) [-1499.102] (-1499.698) (-1498.450) * [-1497.483] (-1498.652) (-1501.469) (-1499.309) -- 0:01:06 131000 -- (-1497.424) (-1499.000) (-1499.008) [-1497.213] * [-1496.385] (-1500.670) (-1501.812) (-1500.204) -- 0:01:06 131500 -- (-1497.042) (-1499.317) (-1499.712) [-1497.707] * [-1496.803] (-1498.198) (-1498.336) (-1501.702) -- 0:01:06 132000 -- (-1497.781) (-1501.402) (-1500.075) [-1497.215] * (-1498.283) (-1497.908) [-1498.107] (-1503.017) -- 0:01:05 132500 -- (-1497.425) (-1502.375) [-1498.562] (-1497.271) * (-1497.661) [-1499.915] (-1498.241) (-1502.624) -- 0:01:05 133000 -- (-1503.346) [-1501.162] (-1498.073) (-1499.033) * (-1497.337) (-1497.727) (-1496.960) [-1497.075] -- 0:01:05 133500 -- (-1504.318) (-1500.909) (-1502.415) [-1497.156] * (-1497.220) (-1496.867) (-1497.662) [-1497.390] -- 0:01:04 134000 -- (-1500.426) (-1501.879) [-1497.255] (-1497.031) * (-1499.362) (-1496.846) (-1497.049) [-1497.224] -- 0:01:04 134500 -- [-1497.785] (-1497.577) (-1499.563) (-1497.700) * (-1504.461) (-1496.830) [-1497.749] (-1496.638) -- 0:01:04 135000 -- (-1496.918) (-1498.571) (-1498.022) [-1498.877] * (-1501.850) (-1496.643) (-1499.066) [-1496.706] -- 0:01:04 Average standard deviation of split frequencies: 0.023878 135500 -- (-1499.031) (-1498.862) [-1500.560] (-1500.464) * (-1501.845) (-1497.721) (-1497.449) [-1497.563] -- 0:01:03 136000 -- [-1498.613] (-1499.720) (-1498.835) (-1502.948) * (-1501.831) (-1499.316) (-1499.750) [-1498.342] -- 0:01:03 136500 -- (-1496.809) [-1497.759] (-1498.542) (-1499.444) * [-1500.251] (-1497.467) (-1501.994) (-1499.809) -- 0:01:03 137000 -- (-1499.509) (-1498.944) (-1499.564) [-1500.988] * [-1501.425] (-1498.503) (-1501.554) (-1498.422) -- 0:01:02 137500 -- (-1498.854) [-1498.029] (-1497.869) (-1502.031) * (-1498.451) (-1497.259) (-1498.893) [-1502.960] -- 0:01:02 138000 -- (-1498.297) (-1501.063) (-1498.407) [-1505.342] * [-1499.030] (-1497.800) (-1497.339) (-1498.666) -- 0:01:02 138500 -- [-1498.713] (-1501.679) (-1498.849) (-1499.312) * (-1501.291) (-1496.788) [-1498.616] (-1501.284) -- 0:01:02 139000 -- (-1498.188) (-1500.390) [-1497.489] (-1501.171) * (-1503.961) (-1497.769) (-1499.137) [-1499.041] -- 0:01:01 139500 -- (-1497.752) [-1500.770] (-1498.604) (-1502.133) * (-1504.393) (-1497.627) [-1498.570] (-1499.869) -- 0:01:01 140000 -- (-1498.041) (-1502.390) (-1496.485) [-1501.002] * (-1499.180) [-1499.223] (-1497.655) (-1500.636) -- 0:01:01 Average standard deviation of split frequencies: 0.024517 140500 -- (-1497.714) (-1501.527) [-1497.195] (-1497.859) * (-1503.391) (-1499.191) [-1498.230] (-1501.489) -- 0:01:01 141000 -- (-1497.482) (-1502.383) [-1498.087] (-1497.518) * [-1499.289] (-1498.961) (-1497.426) (-1502.409) -- 0:01:00 141500 -- (-1499.882) [-1501.267] (-1497.160) (-1497.650) * (-1499.202) (-1499.067) [-1497.299] (-1503.316) -- 0:01:00 142000 -- (-1499.860) (-1498.772) (-1496.518) [-1497.847] * (-1500.480) [-1499.696] (-1496.708) (-1501.751) -- 0:01:00 142500 -- (-1500.987) (-1498.719) [-1496.242] (-1497.995) * (-1498.757) (-1498.724) (-1496.338) [-1497.206] -- 0:01:00 143000 -- (-1500.186) [-1498.392] (-1499.929) (-1498.414) * (-1498.383) (-1498.441) (-1498.169) [-1496.561] -- 0:01:05 143500 -- [-1500.347] (-1499.229) (-1499.450) (-1499.406) * [-1497.618] (-1499.809) (-1497.026) (-1500.706) -- 0:01:05 144000 -- (-1499.047) [-1499.893] (-1499.316) (-1501.288) * (-1497.183) (-1501.230) [-1497.525] (-1500.142) -- 0:01:05 144500 -- (-1500.392) (-1498.049) (-1496.622) [-1501.082] * (-1498.803) (-1499.192) (-1497.992) [-1500.046] -- 0:01:05 145000 -- (-1497.391) (-1500.479) (-1496.622) [-1499.258] * (-1497.135) (-1498.884) [-1497.213] (-1503.557) -- 0:01:04 Average standard deviation of split frequencies: 0.023893 145500 -- (-1496.659) (-1499.045) (-1496.154) [-1497.897] * (-1497.000) [-1498.885] (-1498.026) (-1499.518) -- 0:01:04 146000 -- (-1497.405) (-1497.481) [-1503.461] (-1502.534) * (-1499.035) (-1497.321) [-1496.788] (-1499.119) -- 0:01:04 146500 -- (-1499.098) (-1498.535) [-1501.636] (-1500.297) * (-1498.877) (-1497.347) [-1498.634] (-1499.350) -- 0:01:04 147000 -- (-1500.610) (-1498.702) (-1499.409) [-1498.862] * [-1501.726] (-1499.513) (-1501.812) (-1503.146) -- 0:01:03 147500 -- (-1501.231) (-1500.480) (-1502.515) [-1499.222] * (-1499.778) (-1498.197) [-1498.154] (-1502.936) -- 0:01:03 148000 -- (-1499.643) (-1500.056) (-1498.719) [-1497.561] * [-1501.567] (-1497.031) (-1497.552) (-1498.332) -- 0:01:03 148500 -- [-1500.230] (-1502.158) (-1497.541) (-1497.644) * (-1502.558) [-1498.612] (-1497.617) (-1497.556) -- 0:01:03 149000 -- [-1500.943] (-1499.601) (-1496.590) (-1497.641) * (-1500.804) [-1500.106] (-1497.789) (-1500.292) -- 0:01:02 149500 -- [-1497.142] (-1497.797) (-1497.129) (-1498.154) * (-1498.413) (-1501.407) [-1498.103] (-1500.544) -- 0:01:02 150000 -- [-1496.707] (-1501.058) (-1496.666) (-1498.577) * (-1499.282) (-1501.667) [-1498.493] (-1496.441) -- 0:01:02 Average standard deviation of split frequencies: 0.022396 150500 -- (-1497.730) (-1497.969) (-1496.743) [-1501.419] * (-1503.277) (-1496.951) (-1497.485) [-1497.921] -- 0:01:02 151000 -- (-1497.470) (-1498.795) [-1498.035] (-1498.754) * [-1498.354] (-1498.306) (-1499.281) (-1497.921) -- 0:01:01 151500 -- (-1501.804) (-1497.405) [-1498.093] (-1498.654) * [-1498.305] (-1497.650) (-1499.097) (-1500.036) -- 0:01:01 152000 -- (-1503.092) [-1498.696] (-1498.745) (-1496.259) * (-1499.589) [-1499.393] (-1499.525) (-1499.770) -- 0:01:01 152500 -- (-1501.528) [-1497.987] (-1497.671) (-1503.876) * (-1503.819) [-1498.860] (-1499.004) (-1496.864) -- 0:01:01 153000 -- (-1498.017) (-1500.415) [-1497.913] (-1501.373) * (-1501.632) (-1498.549) [-1497.539] (-1496.938) -- 0:01:00 153500 -- (-1504.739) [-1497.224] (-1498.846) (-1506.071) * (-1497.883) [-1499.148] (-1499.797) (-1499.995) -- 0:01:00 154000 -- (-1503.806) [-1500.466] (-1499.132) (-1499.260) * [-1497.904] (-1498.121) (-1502.861) (-1497.517) -- 0:01:00 154500 -- (-1502.016) (-1498.290) (-1497.849) [-1499.207] * (-1499.982) [-1497.864] (-1500.107) (-1497.533) -- 0:01:00 155000 -- [-1502.496] (-1499.248) (-1498.589) (-1498.491) * [-1497.706] (-1496.764) (-1499.209) (-1499.221) -- 0:00:59 Average standard deviation of split frequencies: 0.022902 155500 -- (-1501.792) (-1499.253) (-1499.889) [-1498.855] * [-1498.173] (-1497.941) (-1496.157) (-1498.216) -- 0:00:59 156000 -- (-1499.018) (-1501.341) (-1496.592) [-1499.053] * (-1498.406) (-1499.252) (-1501.705) [-1499.024] -- 0:00:59 156500 -- [-1498.855] (-1498.511) (-1496.596) (-1498.449) * [-1499.159] (-1498.901) (-1498.843) (-1499.725) -- 0:00:59 157000 -- (-1500.303) (-1497.242) [-1496.624] (-1498.087) * [-1498.960] (-1498.145) (-1497.400) (-1497.477) -- 0:00:59 157500 -- [-1498.085] (-1498.198) (-1498.276) (-1500.856) * (-1498.935) [-1499.004] (-1497.310) (-1500.416) -- 0:00:58 158000 -- [-1498.802] (-1497.893) (-1501.342) (-1501.618) * (-1500.722) (-1502.945) (-1498.319) [-1500.721] -- 0:01:03 158500 -- (-1498.467) [-1498.965] (-1499.964) (-1504.079) * (-1501.040) (-1506.513) [-1496.518] (-1498.110) -- 0:01:03 159000 -- [-1500.124] (-1497.371) (-1500.334) (-1497.914) * [-1497.264] (-1501.463) (-1497.483) (-1498.622) -- 0:01:03 159500 -- [-1501.538] (-1497.178) (-1499.449) (-1498.567) * [-1499.768] (-1497.886) (-1498.426) (-1499.622) -- 0:01:03 160000 -- (-1501.296) (-1498.464) (-1498.875) [-1497.254] * [-1498.056] (-1499.256) (-1496.833) (-1498.896) -- 0:01:02 Average standard deviation of split frequencies: 0.022609 160500 -- [-1502.233] (-1499.012) (-1499.062) (-1497.130) * (-1498.186) (-1500.469) (-1499.261) [-1498.619] -- 0:01:02 161000 -- (-1505.362) (-1498.533) (-1501.028) [-1497.047] * (-1496.683) (-1499.787) [-1497.201] (-1499.664) -- 0:01:02 161500 -- (-1500.692) (-1497.505) (-1499.911) [-1499.190] * (-1496.965) (-1502.449) (-1498.768) [-1497.599] -- 0:01:02 162000 -- (-1498.488) (-1498.569) (-1497.611) [-1498.187] * (-1497.633) (-1502.014) (-1502.339) [-1497.118] -- 0:01:02 162500 -- (-1500.558) (-1497.498) [-1497.464] (-1497.304) * [-1497.625] (-1498.646) (-1504.744) (-1497.446) -- 0:01:01 163000 -- (-1498.646) (-1500.499) (-1500.728) [-1496.954] * (-1497.763) [-1500.143] (-1503.036) (-1500.888) -- 0:01:01 163500 -- [-1496.862] (-1500.492) (-1498.685) (-1496.736) * [-1499.444] (-1499.857) (-1498.708) (-1498.121) -- 0:01:01 164000 -- (-1497.874) [-1498.746] (-1498.054) (-1497.903) * [-1500.140] (-1497.249) (-1498.605) (-1497.570) -- 0:01:01 164500 -- [-1498.158] (-1500.815) (-1498.791) (-1498.947) * (-1501.292) [-1497.249] (-1502.923) (-1498.783) -- 0:01:00 165000 -- (-1500.385) (-1498.656) [-1498.882] (-1496.493) * [-1502.774] (-1503.170) (-1499.985) (-1500.242) -- 0:01:00 Average standard deviation of split frequencies: 0.023349 165500 -- (-1498.128) (-1499.369) [-1497.447] (-1498.304) * (-1500.045) [-1497.420] (-1497.873) (-1500.156) -- 0:01:00 166000 -- (-1497.314) [-1497.950] (-1505.352) (-1497.347) * [-1499.624] (-1496.540) (-1497.430) (-1499.404) -- 0:01:00 166500 -- (-1498.024) (-1500.076) [-1505.283] (-1498.648) * (-1500.489) (-1501.384) (-1497.330) [-1499.842] -- 0:01:00 167000 -- (-1499.556) (-1498.974) (-1500.759) [-1496.781] * (-1498.763) [-1496.960] (-1498.299) (-1498.454) -- 0:00:59 167500 -- (-1499.518) (-1497.576) (-1497.118) [-1499.143] * (-1498.340) (-1497.565) [-1500.286] (-1500.405) -- 0:00:59 168000 -- (-1498.460) (-1501.463) (-1498.772) [-1497.926] * (-1500.272) (-1497.024) [-1496.578] (-1501.421) -- 0:00:59 168500 -- (-1497.105) (-1500.171) (-1497.496) [-1498.672] * (-1496.988) (-1497.024) (-1497.496) [-1500.415] -- 0:00:59 169000 -- (-1499.016) (-1497.659) [-1498.818] (-1497.850) * [-1498.816] (-1498.285) (-1498.043) (-1500.261) -- 0:00:59 169500 -- (-1501.721) (-1496.387) (-1500.435) [-1497.117] * (-1496.576) (-1496.456) [-1497.395] (-1499.998) -- 0:00:58 170000 -- (-1501.058) [-1497.368] (-1499.759) (-1496.435) * (-1501.081) (-1496.947) [-1497.732] (-1504.055) -- 0:00:58 Average standard deviation of split frequencies: 0.021944 170500 -- (-1497.154) (-1497.517) (-1499.756) [-1496.414] * [-1498.042] (-1497.713) (-1497.269) (-1497.612) -- 0:00:58 171000 -- (-1497.220) [-1496.266] (-1499.531) (-1497.443) * (-1497.541) (-1497.095) [-1499.343] (-1498.163) -- 0:00:58 171500 -- (-1498.974) [-1496.173] (-1497.852) (-1497.445) * (-1500.051) (-1497.844) [-1500.455] (-1503.509) -- 0:00:57 172000 -- (-1502.431) (-1497.523) [-1497.390] (-1497.509) * (-1498.129) (-1496.728) [-1500.832] (-1506.661) -- 0:00:57 172500 -- (-1499.219) [-1498.011] (-1497.711) (-1502.656) * (-1498.542) (-1496.767) [-1497.527] (-1498.192) -- 0:00:57 173000 -- [-1496.702] (-1498.215) (-1498.968) (-1499.155) * (-1499.488) (-1496.764) (-1497.124) [-1501.418] -- 0:00:57 173500 -- (-1496.750) [-1497.577] (-1500.434) (-1499.749) * (-1500.530) (-1496.766) [-1497.747] (-1502.363) -- 0:01:01 174000 -- (-1496.826) (-1496.929) (-1499.825) [-1499.322] * (-1500.072) (-1497.804) [-1498.141] (-1501.074) -- 0:01:01 174500 -- [-1498.491] (-1497.407) (-1503.985) (-1498.749) * (-1500.187) (-1500.052) (-1500.068) [-1498.081] -- 0:01:01 175000 -- (-1500.200) [-1496.761] (-1501.206) (-1497.865) * [-1499.232] (-1497.446) (-1498.273) (-1501.046) -- 0:01:01 Average standard deviation of split frequencies: 0.022618 175500 -- (-1499.990) (-1496.240) (-1497.999) [-1498.048] * (-1497.949) (-1497.587) [-1500.177] (-1498.623) -- 0:01:01 176000 -- (-1498.807) (-1499.959) (-1504.128) [-1497.147] * (-1496.676) (-1497.617) (-1497.995) [-1497.387] -- 0:01:00 176500 -- [-1497.672] (-1500.167) (-1498.995) (-1498.256) * [-1497.102] (-1499.181) (-1501.712) (-1498.885) -- 0:01:00 177000 -- [-1499.722] (-1499.347) (-1497.099) (-1496.853) * (-1499.712) [-1497.540] (-1506.657) (-1497.422) -- 0:01:00 177500 -- (-1500.908) (-1500.789) [-1497.708] (-1496.775) * (-1503.210) (-1497.860) [-1497.004] (-1497.384) -- 0:01:00 178000 -- (-1502.158) (-1502.519) (-1500.725) [-1499.281] * (-1501.590) (-1498.467) [-1498.345] (-1499.237) -- 0:01:00 178500 -- (-1499.704) (-1502.903) [-1500.711] (-1500.450) * (-1500.151) (-1499.661) (-1501.209) [-1503.004] -- 0:00:59 179000 -- (-1503.428) (-1501.432) [-1497.924] (-1498.306) * (-1502.996) [-1497.122] (-1502.910) (-1500.026) -- 0:00:59 179500 -- (-1498.058) (-1501.305) (-1497.715) [-1498.403] * (-1496.894) [-1496.246] (-1496.790) (-1497.908) -- 0:00:59 180000 -- (-1497.881) (-1499.146) [-1499.486] (-1499.448) * [-1497.669] (-1497.515) (-1496.917) (-1498.983) -- 0:00:59 Average standard deviation of split frequencies: 0.021164 180500 -- (-1498.471) (-1499.899) (-1499.678) [-1497.058] * (-1498.141) (-1498.557) (-1496.841) [-1499.520] -- 0:00:59 181000 -- (-1498.333) [-1500.249] (-1498.544) (-1498.560) * [-1497.817] (-1497.061) (-1498.953) (-1499.668) -- 0:00:58 181500 -- (-1497.433) (-1501.949) (-1500.354) [-1498.542] * (-1497.166) (-1496.924) [-1498.345] (-1501.375) -- 0:00:58 182000 -- (-1501.750) (-1506.817) (-1496.838) [-1498.639] * [-1497.084] (-1500.042) (-1499.907) (-1501.236) -- 0:00:58 182500 -- (-1498.156) [-1499.164] (-1500.470) (-1498.725) * (-1498.461) (-1498.948) [-1498.266] (-1497.463) -- 0:00:58 183000 -- [-1498.596] (-1498.557) (-1498.843) (-1498.330) * [-1501.303] (-1500.287) (-1497.184) (-1496.828) -- 0:00:58 183500 -- (-1505.317) [-1500.185] (-1500.125) (-1499.728) * (-1497.961) [-1497.673] (-1497.688) (-1497.017) -- 0:00:57 184000 -- [-1504.820] (-1497.999) (-1500.177) (-1498.834) * (-1499.374) [-1496.815] (-1497.324) (-1497.050) -- 0:00:57 184500 -- (-1502.739) (-1497.628) [-1498.497] (-1498.428) * (-1498.192) [-1499.107] (-1500.252) (-1498.115) -- 0:00:57 185000 -- (-1501.003) (-1498.850) (-1500.230) [-1498.146] * [-1498.974] (-1496.584) (-1499.947) (-1499.240) -- 0:00:57 Average standard deviation of split frequencies: 0.023514 185500 -- [-1500.389] (-1497.431) (-1497.211) (-1497.304) * [-1498.893] (-1497.319) (-1497.128) (-1496.940) -- 0:00:57 186000 -- (-1498.460) (-1497.401) [-1498.346] (-1498.591) * (-1498.598) (-1498.573) [-1499.350] (-1497.302) -- 0:00:56 186500 -- (-1499.226) [-1498.865] (-1497.690) (-1498.941) * (-1500.208) [-1496.752] (-1503.030) (-1498.285) -- 0:00:56 187000 -- [-1498.159] (-1497.500) (-1499.834) (-1501.144) * (-1498.888) (-1496.505) (-1499.618) [-1500.164] -- 0:00:56 187500 -- (-1498.160) [-1498.108] (-1502.063) (-1497.871) * (-1499.455) [-1498.073] (-1498.822) (-1498.846) -- 0:00:56 188000 -- (-1505.318) (-1497.851) (-1502.757) [-1499.345] * (-1499.465) [-1498.378] (-1499.045) (-1498.942) -- 0:00:56 188500 -- (-1497.814) (-1497.537) [-1503.217] (-1498.294) * (-1498.971) (-1496.359) [-1499.691] (-1501.142) -- 0:01:00 189000 -- [-1497.772] (-1499.674) (-1505.081) (-1498.383) * (-1501.542) [-1497.206] (-1500.383) (-1500.022) -- 0:01:00 189500 -- (-1498.326) (-1498.486) (-1499.659) [-1500.238] * (-1500.518) [-1497.208] (-1501.692) (-1497.607) -- 0:00:59 190000 -- (-1497.233) [-1498.478] (-1498.585) (-1498.105) * (-1500.853) (-1497.554) [-1498.259] (-1499.459) -- 0:00:59 Average standard deviation of split frequencies: 0.021991 190500 -- (-1497.291) (-1497.381) (-1498.002) [-1501.038] * (-1501.270) (-1497.477) (-1500.385) [-1497.908] -- 0:00:59 191000 -- [-1497.694] (-1498.540) (-1500.342) (-1500.686) * (-1501.252) (-1497.754) (-1501.562) [-1499.568] -- 0:00:59 191500 -- (-1499.912) (-1498.145) (-1498.716) [-1505.302] * [-1497.881] (-1498.100) (-1500.889) (-1499.018) -- 0:00:59 192000 -- [-1497.112] (-1497.473) (-1497.216) (-1498.818) * (-1497.982) (-1497.802) [-1500.356] (-1498.559) -- 0:00:58 192500 -- (-1497.481) [-1497.752] (-1498.044) (-1497.983) * (-1498.429) [-1501.832] (-1504.234) (-1499.458) -- 0:00:58 193000 -- (-1497.564) (-1498.773) (-1498.163) [-1499.128] * (-1497.743) [-1497.593] (-1500.157) (-1498.210) -- 0:00:58 193500 -- (-1497.176) (-1497.044) (-1504.778) [-1499.969] * (-1497.475) (-1498.000) [-1499.844] (-1504.155) -- 0:00:58 194000 -- (-1496.956) (-1500.190) (-1499.345) [-1500.130] * (-1497.269) [-1497.851] (-1498.956) (-1499.378) -- 0:00:58 194500 -- (-1496.956) (-1496.757) [-1497.328] (-1499.394) * (-1498.834) (-1500.290) [-1497.398] (-1499.384) -- 0:00:57 195000 -- (-1496.921) (-1498.247) [-1500.815] (-1497.193) * (-1497.729) [-1501.126] (-1497.595) (-1500.236) -- 0:00:57 Average standard deviation of split frequencies: 0.023918 195500 -- (-1497.545) (-1497.344) [-1500.368] (-1497.692) * (-1496.741) [-1501.299] (-1497.921) (-1502.002) -- 0:00:57 196000 -- (-1498.616) (-1498.598) [-1498.435] (-1499.552) * (-1497.275) (-1498.384) [-1499.091] (-1496.894) -- 0:00:57 196500 -- (-1497.133) (-1502.433) (-1501.523) [-1500.165] * [-1498.363] (-1497.883) (-1499.710) (-1497.196) -- 0:00:57 197000 -- (-1497.200) [-1500.725] (-1499.364) (-1498.275) * (-1497.213) (-1497.601) (-1499.520) [-1498.719] -- 0:00:57 197500 -- (-1498.702) [-1500.240] (-1496.658) (-1497.565) * (-1498.399) (-1497.759) [-1498.000] (-1498.385) -- 0:00:56 198000 -- (-1502.064) (-1500.034) [-1497.144] (-1497.587) * [-1498.797] (-1499.176) (-1498.446) (-1498.462) -- 0:00:56 198500 -- (-1500.876) [-1499.884] (-1501.274) (-1498.347) * [-1497.696] (-1497.850) (-1501.890) (-1499.442) -- 0:00:56 199000 -- (-1501.121) (-1497.522) [-1497.281] (-1497.839) * (-1500.758) (-1497.730) [-1502.252] (-1500.336) -- 0:00:56 199500 -- (-1500.792) [-1498.716] (-1497.501) (-1497.839) * [-1500.031] (-1497.966) (-1501.673) (-1498.922) -- 0:00:56 200000 -- (-1501.512) [-1498.077] (-1498.299) (-1497.602) * [-1501.857] (-1497.415) (-1499.552) (-1498.167) -- 0:00:55 Average standard deviation of split frequencies: 0.024536 200500 -- (-1503.265) [-1498.331] (-1500.523) (-1497.134) * (-1498.568) (-1497.293) [-1499.549] (-1497.647) -- 0:00:55 201000 -- (-1497.696) (-1497.545) (-1499.851) [-1497.243] * (-1497.453) (-1498.653) (-1500.533) [-1497.082] -- 0:00:55 201500 -- [-1497.022] (-1497.250) (-1501.437) (-1505.128) * [-1497.734] (-1497.799) (-1497.798) (-1499.254) -- 0:00:55 202000 -- [-1497.168] (-1498.874) (-1499.725) (-1501.168) * (-1498.410) (-1497.916) (-1496.812) [-1497.770] -- 0:00:59 202500 -- [-1497.000] (-1498.130) (-1498.827) (-1502.894) * [-1500.208] (-1497.397) (-1497.478) (-1496.536) -- 0:00:59 203000 -- (-1497.933) (-1497.629) (-1499.385) [-1501.077] * (-1499.591) [-1498.065] (-1497.478) (-1499.152) -- 0:00:58 203500 -- (-1498.115) (-1499.662) (-1497.104) [-1500.469] * (-1497.723) (-1497.042) [-1497.118] (-1497.951) -- 0:00:58 204000 -- [-1499.678] (-1502.031) (-1497.055) (-1497.508) * [-1497.824] (-1497.398) (-1500.470) (-1501.134) -- 0:00:58 204500 -- (-1498.173) [-1498.047] (-1497.055) (-1497.643) * (-1500.197) (-1496.988) (-1505.939) [-1500.833] -- 0:00:58 205000 -- [-1498.494] (-1498.566) (-1497.054) (-1497.604) * (-1497.265) (-1498.050) (-1504.855) [-1499.975] -- 0:00:58 Average standard deviation of split frequencies: 0.022248 205500 -- (-1496.985) (-1497.050) [-1497.427] (-1499.979) * (-1498.279) (-1498.271) (-1504.188) [-1499.278] -- 0:00:57 206000 -- (-1497.731) [-1497.177] (-1500.355) (-1498.859) * [-1500.813] (-1499.942) (-1500.424) (-1499.353) -- 0:00:57 206500 -- (-1497.240) [-1496.928] (-1501.108) (-1497.504) * (-1498.730) [-1498.763] (-1497.861) (-1498.040) -- 0:00:57 207000 -- (-1497.671) (-1497.539) (-1498.144) [-1496.679] * (-1498.509) (-1498.718) [-1497.940] (-1497.281) -- 0:00:57 207500 -- (-1497.804) (-1499.810) (-1498.740) [-1499.292] * (-1498.213) (-1498.218) (-1498.280) [-1497.802] -- 0:00:57 208000 -- (-1500.332) (-1498.487) [-1498.286] (-1502.561) * (-1501.087) [-1501.353] (-1497.223) (-1498.776) -- 0:00:57 208500 -- [-1496.669] (-1500.474) (-1498.291) (-1498.005) * (-1499.536) (-1503.964) (-1499.004) [-1498.682] -- 0:00:56 209000 -- (-1496.806) (-1502.698) [-1500.667] (-1498.612) * (-1496.449) (-1503.056) [-1498.404] (-1498.843) -- 0:00:56 209500 -- (-1498.851) [-1501.276] (-1499.865) (-1505.637) * [-1496.523] (-1499.997) (-1500.502) (-1499.432) -- 0:00:56 210000 -- [-1497.898] (-1506.394) (-1499.428) (-1499.574) * [-1499.534] (-1498.807) (-1499.274) (-1498.500) -- 0:00:56 Average standard deviation of split frequencies: 0.020246 210500 -- [-1501.655] (-1500.303) (-1498.127) (-1501.124) * (-1500.279) (-1498.828) (-1496.682) [-1498.798] -- 0:00:56 211000 -- [-1498.546] (-1498.791) (-1496.683) (-1498.703) * (-1497.787) [-1497.197] (-1496.801) (-1498.463) -- 0:00:56 211500 -- [-1499.378] (-1499.432) (-1499.635) (-1498.758) * (-1497.651) [-1499.596] (-1497.976) (-1498.549) -- 0:00:55 212000 -- (-1497.258) [-1498.981] (-1498.998) (-1497.581) * [-1496.968] (-1501.602) (-1500.706) (-1499.329) -- 0:00:55 212500 -- (-1500.686) (-1501.207) [-1497.110] (-1498.179) * (-1498.344) [-1500.016] (-1503.463) (-1499.794) -- 0:00:55 213000 -- (-1501.179) (-1498.910) (-1496.679) [-1499.108] * (-1498.468) (-1499.618) [-1500.838] (-1498.397) -- 0:00:55 213500 -- (-1498.299) [-1498.028] (-1496.679) (-1501.472) * (-1497.998) (-1502.540) (-1499.172) [-1498.609] -- 0:00:55 214000 -- (-1499.417) (-1496.884) (-1499.496) [-1502.199] * [-1499.809] (-1499.860) (-1506.616) (-1505.465) -- 0:00:55 214500 -- (-1500.255) [-1500.833] (-1497.738) (-1498.014) * [-1501.187] (-1499.057) (-1497.945) (-1504.644) -- 0:00:54 215000 -- [-1500.494] (-1498.873) (-1497.737) (-1497.910) * (-1503.639) (-1498.210) [-1497.978] (-1497.686) -- 0:00:54 Average standard deviation of split frequencies: 0.021715 215500 -- (-1497.274) (-1504.317) (-1496.388) [-1498.730] * (-1498.036) [-1498.225] (-1502.148) (-1500.372) -- 0:00:54 216000 -- (-1497.025) (-1499.332) [-1498.250] (-1497.640) * (-1498.495) [-1501.765] (-1499.961) (-1501.965) -- 0:00:54 216500 -- (-1497.255) [-1496.545] (-1500.306) (-1498.002) * [-1501.522] (-1499.662) (-1500.660) (-1500.019) -- 0:00:54 217000 -- (-1497.527) (-1500.062) [-1499.497] (-1498.204) * (-1501.524) (-1502.662) [-1505.856] (-1502.347) -- 0:00:54 217500 -- (-1498.972) (-1496.737) (-1498.387) [-1503.250] * (-1500.099) (-1501.172) (-1500.702) [-1499.399] -- 0:00:57 218000 -- (-1499.080) (-1497.855) (-1498.745) [-1503.029] * (-1497.084) (-1497.643) [-1498.939] (-1498.075) -- 0:00:57 218500 -- (-1498.786) (-1497.629) [-1501.291] (-1500.392) * [-1499.142] (-1497.822) (-1499.449) (-1498.859) -- 0:00:57 219000 -- (-1497.342) [-1497.342] (-1496.795) (-1499.222) * (-1499.418) [-1496.591] (-1500.900) (-1501.851) -- 0:00:57 219500 -- (-1498.736) (-1498.152) (-1497.368) [-1497.518] * (-1499.146) (-1496.590) [-1498.695] (-1501.762) -- 0:00:56 220000 -- (-1498.051) (-1498.880) [-1500.315] (-1500.683) * (-1497.619) [-1497.245] (-1497.942) (-1501.956) -- 0:00:56 Average standard deviation of split frequencies: 0.021470 220500 -- [-1497.609] (-1497.394) (-1501.583) (-1500.501) * (-1497.484) (-1497.155) (-1497.118) [-1499.762] -- 0:00:56 221000 -- (-1497.595) (-1497.050) (-1499.326) [-1501.480] * (-1497.445) (-1497.708) (-1496.847) [-1499.881] -- 0:00:56 221500 -- (-1499.127) [-1497.966] (-1498.868) (-1497.185) * (-1497.514) (-1498.033) [-1498.199] (-1501.221) -- 0:00:56 222000 -- (-1497.826) (-1497.403) [-1498.931] (-1502.154) * [-1498.231] (-1500.455) (-1496.550) (-1501.812) -- 0:00:56 222500 -- (-1497.524) [-1496.668] (-1497.815) (-1499.241) * (-1500.886) (-1498.734) [-1498.869] (-1499.683) -- 0:00:55 223000 -- [-1496.927] (-1496.395) (-1499.132) (-1498.997) * (-1498.426) (-1498.569) (-1500.282) [-1503.324] -- 0:00:55 223500 -- (-1499.282) (-1497.927) (-1499.124) [-1499.193] * (-1498.058) (-1499.313) [-1496.981] (-1502.770) -- 0:00:55 224000 -- (-1497.412) [-1496.833] (-1498.235) (-1499.191) * (-1497.991) [-1497.812] (-1498.862) (-1500.739) -- 0:00:55 224500 -- (-1497.881) (-1496.833) [-1498.198] (-1497.639) * (-1499.777) [-1497.690] (-1498.301) (-1499.708) -- 0:00:55 225000 -- (-1497.752) (-1497.985) [-1497.254] (-1497.738) * (-1499.749) (-1496.925) (-1498.106) [-1498.290] -- 0:00:55 Average standard deviation of split frequencies: 0.022110 225500 -- (-1501.414) (-1497.738) (-1499.321) [-1498.263] * (-1497.017) [-1496.349] (-1499.831) (-1499.216) -- 0:00:54 226000 -- (-1497.410) (-1497.532) (-1499.590) [-1498.477] * (-1497.362) (-1496.128) [-1499.887] (-1497.470) -- 0:00:54 226500 -- [-1498.384] (-1501.504) (-1497.761) (-1499.543) * [-1496.855] (-1496.786) (-1500.000) (-1499.136) -- 0:00:54 227000 -- (-1498.315) (-1501.029) (-1497.203) [-1497.000] * (-1498.430) (-1497.679) [-1496.397] (-1497.191) -- 0:00:54 227500 -- (-1501.145) (-1501.082) [-1499.287] (-1498.267) * [-1500.299] (-1499.544) (-1496.625) (-1498.121) -- 0:00:54 228000 -- (-1497.732) [-1498.346] (-1498.334) (-1497.109) * (-1501.099) (-1499.537) [-1496.637] (-1498.446) -- 0:00:54 228500 -- (-1499.474) [-1500.118] (-1498.607) (-1496.538) * (-1497.662) (-1497.828) [-1498.492] (-1499.662) -- 0:00:54 229000 -- [-1497.583] (-1504.757) (-1501.251) (-1497.705) * (-1499.966) (-1500.300) (-1500.654) [-1498.726] -- 0:00:53 229500 -- [-1496.451] (-1501.908) (-1499.463) (-1497.423) * (-1498.073) (-1498.212) (-1503.515) [-1497.998] -- 0:00:53 230000 -- (-1497.667) [-1498.050] (-1499.411) (-1497.249) * (-1502.007) (-1497.629) [-1497.075] (-1498.409) -- 0:00:53 Average standard deviation of split frequencies: 0.021663 230500 -- [-1498.467] (-1497.227) (-1499.143) (-1497.379) * (-1500.448) (-1499.236) [-1498.657] (-1504.790) -- 0:00:53 231000 -- (-1497.894) [-1499.740] (-1501.619) (-1499.067) * (-1499.698) (-1498.557) [-1502.050] (-1503.699) -- 0:00:53 231500 -- (-1498.063) (-1497.265) [-1499.435] (-1497.012) * [-1499.308] (-1498.554) (-1499.833) (-1498.874) -- 0:00:53 232000 -- [-1499.097] (-1496.771) (-1499.535) (-1497.742) * (-1500.639) (-1499.462) [-1498.800] (-1498.766) -- 0:00:52 232500 -- (-1498.351) [-1497.513] (-1500.758) (-1497.589) * (-1497.721) (-1499.112) [-1499.089] (-1499.950) -- 0:00:52 233000 -- (-1497.272) [-1499.408] (-1502.582) (-1499.166) * [-1499.754] (-1497.098) (-1496.707) (-1501.161) -- 0:00:55 233500 -- [-1497.694] (-1498.491) (-1499.726) (-1500.918) * [-1498.931] (-1496.962) (-1496.940) (-1499.506) -- 0:00:55 234000 -- (-1500.324) (-1499.699) (-1497.926) [-1498.235] * (-1499.090) (-1498.309) [-1498.774] (-1501.145) -- 0:00:55 234500 -- (-1500.904) (-1497.087) [-1497.053] (-1497.540) * (-1499.705) [-1497.164] (-1498.701) (-1499.573) -- 0:00:55 235000 -- [-1497.337] (-1497.197) (-1498.195) (-1499.939) * (-1497.097) (-1499.319) (-1501.278) [-1499.666] -- 0:00:55 Average standard deviation of split frequencies: 0.022472 235500 -- [-1498.250] (-1498.576) (-1497.556) (-1500.396) * [-1498.943] (-1498.719) (-1499.584) (-1501.066) -- 0:00:55 236000 -- (-1499.198) (-1497.107) (-1496.553) [-1498.724] * [-1498.939] (-1500.747) (-1502.487) (-1501.906) -- 0:00:55 236500 -- (-1499.603) [-1499.056] (-1497.933) (-1498.535) * (-1497.452) (-1500.103) (-1499.740) [-1502.075] -- 0:00:54 237000 -- (-1497.821) [-1499.464] (-1500.033) (-1501.632) * (-1498.432) [-1499.681] (-1499.028) (-1501.405) -- 0:00:54 237500 -- (-1499.706) (-1502.353) [-1499.400] (-1499.867) * (-1498.352) (-1498.539) (-1500.373) [-1497.829] -- 0:00:54 238000 -- (-1497.598) (-1503.524) [-1497.816] (-1500.676) * (-1497.934) (-1496.430) [-1500.346] (-1500.443) -- 0:00:54 238500 -- (-1497.500) (-1501.634) (-1498.745) [-1496.755] * (-1497.659) [-1503.353] (-1498.364) (-1497.603) -- 0:00:54 239000 -- (-1496.636) (-1499.387) (-1496.908) [-1497.726] * (-1497.493) (-1499.440) [-1498.539] (-1498.530) -- 0:00:54 239500 -- [-1497.447] (-1497.065) (-1496.940) (-1501.297) * (-1500.310) (-1500.027) (-1496.760) [-1499.884] -- 0:00:53 240000 -- (-1500.291) (-1500.507) (-1500.586) [-1497.315] * (-1498.407) [-1500.419] (-1497.629) (-1498.668) -- 0:00:53 Average standard deviation of split frequencies: 0.020987 240500 -- (-1498.707) (-1498.556) [-1500.894] (-1498.116) * (-1499.064) (-1497.182) (-1498.534) [-1498.329] -- 0:00:53 241000 -- (-1498.475) (-1500.559) [-1497.638] (-1502.107) * [-1497.063] (-1499.835) (-1497.938) (-1497.437) -- 0:00:53 241500 -- [-1499.100] (-1503.241) (-1499.742) (-1502.138) * [-1496.433] (-1501.647) (-1497.885) (-1499.391) -- 0:00:53 242000 -- (-1499.875) (-1501.269) [-1499.736] (-1496.873) * (-1498.331) (-1500.597) (-1498.086) [-1500.850] -- 0:00:53 242500 -- [-1500.057] (-1501.076) (-1498.377) (-1499.309) * (-1497.281) (-1498.819) (-1500.446) [-1498.300] -- 0:00:53 243000 -- (-1500.953) [-1498.706] (-1498.504) (-1498.529) * (-1496.774) (-1498.200) (-1500.327) [-1500.665] -- 0:00:52 243500 -- (-1497.908) (-1498.924) [-1499.034] (-1498.219) * (-1500.491) [-1499.085] (-1498.702) (-1501.378) -- 0:00:52 244000 -- (-1497.811) (-1498.575) (-1497.800) [-1497.115] * (-1497.139) (-1498.600) [-1496.885] (-1498.779) -- 0:00:52 244500 -- (-1497.794) (-1501.684) (-1498.450) [-1497.453] * (-1497.935) (-1501.022) [-1496.759] (-1498.912) -- 0:00:52 245000 -- (-1498.277) [-1500.976] (-1498.943) (-1498.010) * [-1497.575] (-1502.456) (-1496.752) (-1502.857) -- 0:00:52 Average standard deviation of split frequencies: 0.020714 245500 -- [-1497.991] (-1499.206) (-1498.702) (-1499.226) * (-1496.289) (-1498.391) [-1497.716] (-1501.177) -- 0:00:52 246000 -- (-1496.873) (-1498.903) (-1497.631) [-1498.488] * (-1496.597) [-1498.964] (-1498.236) (-1496.989) -- 0:00:52 246500 -- (-1496.985) (-1499.756) [-1501.233] (-1501.413) * (-1496.860) [-1498.200] (-1497.319) (-1497.744) -- 0:00:51 247000 -- (-1499.400) [-1498.254] (-1502.329) (-1498.855) * [-1497.882] (-1500.625) (-1497.603) (-1497.748) -- 0:00:51 247500 -- (-1500.174) (-1497.036) (-1499.126) [-1499.692] * [-1498.196] (-1498.501) (-1498.020) (-1498.254) -- 0:00:51 248000 -- (-1498.501) (-1497.657) (-1498.215) [-1500.715] * (-1496.651) (-1498.097) (-1496.750) [-1500.112] -- 0:00:54 248500 -- (-1498.644) [-1500.586] (-1499.381) (-1499.701) * (-1496.985) (-1500.079) [-1496.877] (-1497.494) -- 0:00:54 249000 -- [-1502.240] (-1499.728) (-1498.597) (-1500.411) * [-1497.310] (-1497.311) (-1497.713) (-1498.513) -- 0:00:54 249500 -- (-1501.089) [-1499.859] (-1497.308) (-1500.451) * [-1497.686] (-1496.472) (-1498.838) (-1497.349) -- 0:00:54 250000 -- (-1497.220) (-1498.995) (-1498.946) [-1499.091] * [-1501.441] (-1501.781) (-1500.141) (-1497.230) -- 0:00:54 Average standard deviation of split frequencies: 0.019791 250500 -- (-1496.973) (-1497.493) [-1499.492] (-1500.191) * (-1498.020) (-1501.848) [-1502.496] (-1496.980) -- 0:00:53 251000 -- (-1498.673) (-1497.301) [-1499.645] (-1497.627) * (-1496.799) (-1501.441) (-1498.019) [-1497.073] -- 0:00:53 251500 -- (-1500.202) (-1497.179) [-1497.348] (-1497.788) * (-1498.952) (-1497.894) [-1496.990] (-1497.074) -- 0:00:53 252000 -- (-1496.593) (-1496.602) (-1496.524) [-1497.658] * (-1497.180) (-1496.931) (-1496.975) [-1497.244] -- 0:00:53 252500 -- (-1498.789) (-1496.917) (-1496.524) [-1497.660] * (-1498.918) (-1497.154) (-1496.975) [-1499.136] -- 0:00:53 253000 -- (-1498.575) [-1499.594] (-1496.709) (-1498.607) * [-1497.937] (-1496.614) (-1497.800) (-1498.197) -- 0:00:53 253500 -- (-1499.940) (-1497.182) (-1502.294) [-1497.989] * (-1497.923) (-1496.610) [-1499.902] (-1499.519) -- 0:00:53 254000 -- (-1499.173) (-1497.044) [-1496.544] (-1499.011) * [-1497.646] (-1496.663) (-1498.498) (-1496.720) -- 0:00:52 254500 -- (-1500.488) (-1498.647) [-1496.697] (-1498.357) * [-1497.972] (-1496.663) (-1499.446) (-1497.877) -- 0:00:52 255000 -- [-1502.260] (-1498.647) (-1499.373) (-1504.752) * (-1498.797) (-1496.365) (-1499.340) [-1497.826] -- 0:00:52 Average standard deviation of split frequencies: 0.018853 255500 -- (-1499.158) (-1496.478) (-1497.684) [-1504.441] * (-1501.367) (-1502.678) (-1500.487) [-1498.152] -- 0:00:52 256000 -- (-1499.424) [-1496.274] (-1497.790) (-1499.587) * [-1499.434] (-1498.133) (-1500.162) (-1502.844) -- 0:00:52 256500 -- (-1502.390) [-1497.640] (-1497.357) (-1499.557) * (-1497.285) [-1496.385] (-1499.999) (-1499.599) -- 0:00:52 257000 -- (-1501.247) (-1498.220) [-1496.636] (-1500.517) * (-1498.211) (-1496.946) (-1499.923) [-1496.766] -- 0:00:52 257500 -- [-1501.168] (-1497.488) (-1497.354) (-1498.944) * (-1498.309) (-1499.245) (-1499.896) [-1496.651] -- 0:00:51 258000 -- [-1499.286] (-1496.792) (-1497.762) (-1499.355) * (-1497.591) (-1499.176) (-1499.658) [-1496.225] -- 0:00:51 258500 -- [-1499.155] (-1496.482) (-1498.649) (-1500.052) * [-1500.569] (-1497.889) (-1499.714) (-1498.481) -- 0:00:51 259000 -- (-1499.190) (-1497.306) (-1499.652) [-1497.324] * [-1498.873] (-1496.574) (-1498.068) (-1500.541) -- 0:00:51 259500 -- [-1498.093] (-1497.747) (-1500.242) (-1497.272) * (-1497.270) [-1496.725] (-1499.938) (-1500.454) -- 0:00:51 260000 -- (-1498.223) (-1501.728) [-1500.660] (-1497.192) * (-1498.545) (-1496.760) [-1502.900] (-1497.355) -- 0:00:51 Average standard deviation of split frequencies: 0.018465 260500 -- [-1499.009] (-1497.179) (-1499.071) (-1497.586) * [-1506.600] (-1498.444) (-1500.375) (-1497.370) -- 0:00:51 261000 -- (-1499.420) (-1498.511) [-1498.803] (-1496.805) * [-1497.249] (-1499.566) (-1503.201) (-1498.310) -- 0:00:50 261500 -- (-1503.275) [-1498.872] (-1501.827) (-1502.722) * (-1498.188) (-1499.879) (-1502.337) [-1496.515] -- 0:00:50 262000 -- [-1503.985] (-1497.245) (-1501.577) (-1501.031) * (-1497.765) (-1497.999) [-1500.120] (-1497.241) -- 0:00:50 262500 -- [-1496.977] (-1497.636) (-1497.586) (-1500.584) * (-1497.566) [-1497.554] (-1496.534) (-1497.539) -- 0:00:50 263000 -- (-1497.456) [-1497.232] (-1497.871) (-1500.448) * (-1496.465) (-1497.480) [-1498.373] (-1498.313) -- 0:00:50 263500 -- (-1497.577) (-1497.834) [-1497.305] (-1497.902) * (-1497.370) (-1500.802) (-1498.563) [-1498.768] -- 0:00:53 264000 -- (-1497.432) [-1497.046] (-1498.780) (-1498.104) * [-1497.874] (-1501.979) (-1500.281) (-1498.684) -- 0:00:52 264500 -- [-1499.850] (-1497.672) (-1499.376) (-1497.937) * (-1498.399) (-1501.620) [-1500.255] (-1497.976) -- 0:00:52 265000 -- (-1498.576) (-1497.564) (-1498.295) [-1498.929] * [-1499.596] (-1498.728) (-1501.780) (-1497.973) -- 0:00:52 Average standard deviation of split frequencies: 0.017131 265500 -- (-1499.157) (-1497.621) [-1497.432] (-1497.813) * [-1498.054] (-1499.749) (-1499.465) (-1498.541) -- 0:00:52 266000 -- [-1497.235] (-1499.571) (-1503.384) (-1498.596) * [-1498.170] (-1499.274) (-1499.523) (-1499.139) -- 0:00:52 266500 -- (-1497.853) [-1498.605] (-1502.180) (-1497.957) * (-1500.878) [-1501.082] (-1501.335) (-1498.296) -- 0:00:52 267000 -- [-1496.887] (-1502.106) (-1498.755) (-1496.805) * (-1500.123) (-1499.259) [-1498.706] (-1499.916) -- 0:00:52 267500 -- (-1503.072) (-1499.208) [-1497.070] (-1497.082) * (-1503.864) (-1498.627) (-1497.992) [-1502.992] -- 0:00:52 268000 -- [-1496.818] (-1498.626) (-1502.933) (-1496.992) * [-1502.341] (-1503.643) (-1502.274) (-1500.405) -- 0:00:51 268500 -- (-1498.193) [-1497.941] (-1502.812) (-1496.885) * (-1504.046) [-1501.135] (-1500.403) (-1503.191) -- 0:00:51 269000 -- (-1498.506) (-1496.790) [-1500.537] (-1500.569) * (-1501.103) (-1497.345) (-1500.523) [-1498.226] -- 0:00:51 269500 -- [-1497.662] (-1497.408) (-1500.009) (-1499.713) * (-1499.275) (-1497.127) (-1498.086) [-1498.690] -- 0:00:51 270000 -- [-1499.987] (-1497.926) (-1497.314) (-1499.229) * (-1499.421) (-1498.072) [-1497.054] (-1499.907) -- 0:00:51 Average standard deviation of split frequencies: 0.016933 270500 -- (-1503.087) [-1498.997] (-1498.925) (-1498.240) * (-1501.348) [-1509.725] (-1499.120) (-1498.659) -- 0:00:51 271000 -- [-1500.996] (-1501.189) (-1500.716) (-1499.098) * (-1500.035) (-1498.848) [-1497.229] (-1499.128) -- 0:00:51 271500 -- [-1501.475] (-1500.273) (-1497.638) (-1497.511) * (-1500.225) [-1497.142] (-1499.163) (-1497.742) -- 0:00:50 272000 -- (-1499.980) [-1498.845] (-1496.948) (-1498.217) * [-1498.464] (-1499.145) (-1500.758) (-1496.796) -- 0:00:50 272500 -- (-1498.181) (-1501.719) [-1496.707] (-1501.544) * (-1500.988) (-1498.900) (-1499.599) [-1496.735] -- 0:00:50 273000 -- (-1497.544) [-1497.104] (-1498.725) (-1501.286) * (-1500.597) (-1498.463) (-1499.763) [-1497.132] -- 0:00:50 273500 -- [-1499.672] (-1500.316) (-1499.169) (-1498.178) * [-1500.291] (-1497.023) (-1501.820) (-1498.486) -- 0:00:50 274000 -- (-1497.874) (-1497.766) [-1498.136] (-1498.352) * (-1498.421) (-1498.051) (-1502.525) [-1498.373] -- 0:00:50 274500 -- (-1498.372) (-1498.032) [-1497.846] (-1498.501) * (-1499.288) (-1500.977) (-1503.745) [-1499.063] -- 0:00:50 275000 -- [-1497.116] (-1496.608) (-1496.990) (-1499.364) * [-1497.693] (-1501.073) (-1502.036) (-1498.491) -- 0:00:50 Average standard deviation of split frequencies: 0.017649 275500 -- [-1499.248] (-1499.411) (-1497.935) (-1499.898) * (-1498.351) [-1499.248] (-1498.935) (-1498.511) -- 0:00:49 276000 -- (-1497.277) (-1500.026) [-1499.759] (-1498.305) * (-1497.651) (-1501.002) (-1499.424) [-1498.511] -- 0:00:49 276500 -- (-1499.041) (-1499.126) [-1499.660] (-1501.256) * (-1496.708) (-1499.601) [-1499.178] (-1500.743) -- 0:00:49 277000 -- (-1499.286) (-1502.490) (-1498.185) [-1502.599] * (-1499.996) (-1497.683) (-1499.795) [-1503.832] -- 0:00:49 277500 -- [-1500.028] (-1499.877) (-1502.093) (-1499.240) * (-1497.781) [-1500.280] (-1498.021) (-1500.833) -- 0:00:49 278000 -- (-1499.702) [-1500.159] (-1498.686) (-1498.870) * (-1498.068) (-1501.051) [-1500.791] (-1499.376) -- 0:00:49 278500 -- (-1497.288) (-1501.486) [-1500.102] (-1501.051) * (-1496.903) (-1501.600) (-1501.592) [-1501.364] -- 0:00:49 279000 -- (-1496.968) (-1500.975) (-1502.962) [-1497.471] * (-1498.887) (-1497.940) (-1500.883) [-1498.162] -- 0:00:51 279500 -- [-1496.640] (-1501.320) (-1501.142) (-1496.202) * [-1500.280] (-1497.066) (-1503.322) (-1498.092) -- 0:00:51 280000 -- (-1500.774) (-1501.124) [-1499.227] (-1498.293) * (-1499.046) (-1499.409) (-1502.573) [-1498.318] -- 0:00:51 Average standard deviation of split frequencies: 0.017729 280500 -- (-1501.396) (-1498.499) [-1498.888] (-1497.987) * (-1497.594) [-1498.946] (-1500.053) (-1497.559) -- 0:00:51 281000 -- (-1497.304) [-1497.955] (-1498.514) (-1497.837) * (-1499.154) (-1496.792) (-1504.224) [-1499.461] -- 0:00:51 281500 -- (-1501.346) [-1496.818] (-1498.001) (-1501.393) * [-1497.587] (-1497.967) (-1497.697) (-1501.090) -- 0:00:51 282000 -- (-1501.194) (-1498.719) [-1496.822] (-1497.235) * (-1498.018) (-1499.143) [-1498.634] (-1500.681) -- 0:00:50 282500 -- (-1500.684) [-1498.388] (-1497.535) (-1498.226) * (-1499.529) (-1502.043) (-1498.144) [-1499.178] -- 0:00:50 283000 -- [-1500.263] (-1502.499) (-1497.501) (-1499.344) * (-1502.448) [-1500.687] (-1497.611) (-1496.895) -- 0:00:50 283500 -- [-1497.399] (-1498.497) (-1497.648) (-1500.434) * (-1497.789) (-1499.311) [-1497.727] (-1497.863) -- 0:00:50 284000 -- (-1500.277) (-1499.168) [-1497.521] (-1500.896) * (-1498.657) (-1497.744) [-1497.334] (-1498.382) -- 0:00:50 284500 -- [-1499.748] (-1497.615) (-1504.738) (-1500.603) * (-1498.350) [-1496.551] (-1496.918) (-1498.676) -- 0:00:50 285000 -- (-1498.941) (-1498.146) [-1498.783] (-1499.203) * (-1498.726) (-1500.250) [-1497.442] (-1496.611) -- 0:00:50 Average standard deviation of split frequencies: 0.017307 285500 -- (-1497.391) (-1497.813) (-1498.984) [-1497.327] * (-1500.174) (-1498.290) (-1497.260) [-1498.704] -- 0:00:50 286000 -- (-1505.322) [-1497.488] (-1500.346) (-1499.600) * [-1500.879] (-1498.221) (-1502.653) (-1502.510) -- 0:00:49 286500 -- (-1499.961) (-1500.644) [-1498.191] (-1500.223) * (-1501.781) (-1497.090) [-1497.342] (-1500.936) -- 0:00:49 287000 -- (-1502.398) (-1501.810) [-1498.336] (-1499.313) * (-1499.311) (-1497.199) [-1498.407] (-1505.855) -- 0:00:49 287500 -- (-1498.251) (-1500.009) (-1498.441) [-1497.583] * (-1499.162) (-1496.636) [-1497.706] (-1509.255) -- 0:00:49 288000 -- (-1499.746) (-1497.825) (-1498.473) [-1500.795] * (-1500.043) [-1496.691] (-1496.890) (-1506.448) -- 0:00:49 288500 -- (-1499.763) (-1496.408) [-1502.002] (-1498.025) * (-1499.356) [-1496.833] (-1496.554) (-1501.204) -- 0:00:49 289000 -- (-1499.057) (-1499.061) [-1497.608] (-1497.891) * (-1501.028) [-1498.285] (-1496.647) (-1501.240) -- 0:00:49 289500 -- (-1499.539) (-1501.360) (-1498.643) [-1499.060] * (-1500.975) (-1499.393) (-1497.038) [-1496.819] -- 0:00:49 290000 -- (-1503.001) [-1497.325] (-1497.366) (-1498.460) * (-1497.332) (-1498.274) (-1497.216) [-1497.265] -- 0:00:48 Average standard deviation of split frequencies: 0.017660 290500 -- [-1499.611] (-1497.500) (-1497.399) (-1498.478) * (-1498.482) (-1497.761) (-1499.234) [-1496.758] -- 0:00:48 291000 -- (-1500.597) (-1498.723) (-1497.582) [-1499.997] * (-1496.763) (-1498.013) (-1497.675) [-1496.446] -- 0:00:48 291500 -- (-1502.495) (-1501.851) (-1497.966) [-1498.967] * (-1496.981) (-1497.294) [-1497.042] (-1496.839) -- 0:00:48 292000 -- [-1501.125] (-1501.292) (-1499.142) (-1501.115) * [-1497.621] (-1498.433) (-1497.419) (-1498.678) -- 0:00:48 292500 -- (-1503.641) [-1501.254] (-1501.409) (-1499.005) * (-1497.444) [-1500.034] (-1497.953) (-1499.378) -- 0:00:48 293000 -- (-1508.123) [-1499.410] (-1501.554) (-1498.192) * (-1497.515) (-1496.532) [-1498.986] (-1499.787) -- 0:00:48 293500 -- (-1500.834) (-1498.958) [-1496.769] (-1500.424) * [-1497.126] (-1497.508) (-1497.702) (-1500.380) -- 0:00:48 294000 -- [-1498.442] (-1498.751) (-1498.210) (-1496.404) * [-1497.768] (-1497.650) (-1496.442) (-1500.549) -- 0:00:48 294500 -- (-1499.195) (-1498.662) (-1497.847) [-1497.891] * (-1497.021) [-1498.746] (-1497.240) (-1500.742) -- 0:00:50 295000 -- (-1501.623) (-1498.978) [-1498.528] (-1498.462) * [-1496.822] (-1499.649) (-1503.168) (-1499.720) -- 0:00:50 Average standard deviation of split frequencies: 0.018934 295500 -- (-1498.446) [-1497.926] (-1497.698) (-1497.984) * (-1497.464) (-1499.608) (-1503.070) [-1501.209] -- 0:00:50 296000 -- [-1499.182] (-1499.536) (-1500.292) (-1497.144) * [-1497.044] (-1497.515) (-1497.426) (-1500.678) -- 0:00:49 296500 -- [-1497.755] (-1497.456) (-1501.456) (-1497.171) * [-1497.044] (-1497.668) (-1498.676) (-1503.140) -- 0:00:49 297000 -- [-1498.184] (-1498.489) (-1498.894) (-1497.946) * (-1497.737) (-1498.540) [-1498.027] (-1502.560) -- 0:00:49 297500 -- (-1498.721) [-1497.238] (-1497.095) (-1498.710) * [-1497.745] (-1497.210) (-1496.957) (-1499.335) -- 0:00:49 298000 -- (-1498.112) (-1499.351) (-1499.754) [-1498.230] * (-1497.535) [-1498.280] (-1499.254) (-1504.718) -- 0:00:49 298500 -- (-1497.701) (-1496.953) (-1499.996) [-1499.290] * (-1498.886) [-1496.961] (-1497.455) (-1501.115) -- 0:00:49 299000 -- (-1498.365) [-1496.949] (-1498.987) (-1498.468) * (-1498.902) (-1497.454) [-1497.548] (-1499.867) -- 0:00:49 299500 -- (-1502.274) (-1498.342) [-1498.095] (-1501.091) * (-1498.754) (-1501.059) [-1497.676] (-1499.634) -- 0:00:49 300000 -- (-1501.165) (-1497.302) (-1502.176) [-1497.896] * (-1499.543) (-1500.045) (-1504.278) [-1501.353] -- 0:00:48 Average standard deviation of split frequencies: 0.019773 300500 -- (-1498.447) (-1498.028) [-1496.724] (-1497.623) * (-1499.994) (-1500.133) (-1502.330) [-1499.540] -- 0:00:48 301000 -- (-1498.606) (-1497.282) [-1496.576] (-1496.627) * (-1498.131) [-1497.887] (-1501.568) (-1503.769) -- 0:00:48 301500 -- (-1501.418) [-1497.222] (-1496.253) (-1496.345) * [-1498.840] (-1499.243) (-1501.416) (-1502.320) -- 0:00:48 302000 -- [-1499.817] (-1497.207) (-1498.578) (-1497.272) * (-1498.160) (-1498.466) [-1502.879] (-1500.590) -- 0:00:48 302500 -- (-1498.244) (-1498.427) (-1497.481) [-1500.739] * (-1502.148) [-1500.071] (-1500.382) (-1499.727) -- 0:00:48 303000 -- (-1497.483) [-1498.117] (-1499.725) (-1498.414) * (-1500.921) [-1498.398] (-1498.210) (-1497.871) -- 0:00:48 303500 -- [-1497.774] (-1498.513) (-1499.711) (-1497.711) * (-1500.294) (-1501.501) [-1497.435] (-1497.448) -- 0:00:48 304000 -- (-1498.094) (-1498.512) [-1499.616] (-1498.946) * (-1498.297) (-1497.238) [-1499.531] (-1498.038) -- 0:00:48 304500 -- (-1500.857) [-1497.506] (-1499.227) (-1501.716) * (-1498.345) [-1498.140] (-1498.926) (-1499.934) -- 0:00:47 305000 -- (-1499.050) (-1497.993) [-1500.776] (-1500.698) * [-1497.326] (-1498.328) (-1498.774) (-1499.027) -- 0:00:47 Average standard deviation of split frequencies: 0.019378 305500 -- (-1499.093) (-1497.990) (-1500.581) [-1498.581] * (-1501.380) (-1498.920) [-1498.939] (-1499.809) -- 0:00:47 306000 -- (-1498.619) [-1497.618] (-1500.384) (-1503.826) * (-1500.476) [-1498.606] (-1496.890) (-1502.835) -- 0:00:47 306500 -- (-1502.748) (-1498.132) [-1497.957] (-1503.303) * (-1500.021) (-1498.439) (-1500.866) [-1499.039] -- 0:00:47 307000 -- (-1499.138) (-1497.903) [-1498.554] (-1503.555) * (-1499.633) (-1498.235) [-1501.644] (-1499.536) -- 0:00:47 307500 -- (-1498.875) [-1499.287] (-1498.698) (-1497.924) * (-1504.165) [-1497.709] (-1496.921) (-1498.768) -- 0:00:47 308000 -- (-1500.305) [-1497.622] (-1498.232) (-1497.924) * (-1502.663) (-1498.185) (-1496.748) [-1497.216] -- 0:00:47 308500 -- (-1497.657) (-1496.651) [-1497.388] (-1501.262) * (-1501.578) (-1500.001) (-1499.192) [-1497.087] -- 0:00:47 309000 -- [-1497.604] (-1501.554) (-1497.361) (-1497.518) * (-1500.317) (-1498.188) (-1498.900) [-1497.696] -- 0:00:46 309500 -- [-1498.655] (-1498.217) (-1498.978) (-1497.226) * [-1496.498] (-1498.575) (-1496.721) (-1503.316) -- 0:00:46 310000 -- [-1498.443] (-1499.497) (-1499.179) (-1499.271) * (-1496.641) [-1498.992] (-1496.543) (-1502.083) -- 0:00:48 Average standard deviation of split frequencies: 0.020924 310500 -- (-1498.840) [-1497.346] (-1501.631) (-1498.546) * (-1497.833) (-1497.670) (-1497.526) [-1502.031] -- 0:00:48 311000 -- [-1501.607] (-1498.587) (-1503.571) (-1497.729) * (-1499.380) [-1497.690] (-1498.220) (-1499.193) -- 0:00:48 311500 -- [-1496.505] (-1503.292) (-1500.018) (-1499.119) * (-1500.146) (-1498.867) (-1501.685) [-1502.837] -- 0:00:48 312000 -- (-1498.880) (-1500.425) (-1500.677) [-1500.964] * [-1497.484] (-1497.433) (-1498.081) (-1504.716) -- 0:00:48 312500 -- (-1499.757) (-1498.694) [-1498.769] (-1499.737) * (-1497.397) (-1498.299) [-1498.308] (-1500.597) -- 0:00:48 313000 -- (-1499.469) [-1498.332] (-1497.890) (-1499.971) * [-1498.209] (-1498.041) (-1498.979) (-1497.507) -- 0:00:48 313500 -- (-1498.154) (-1497.190) [-1498.185] (-1499.027) * [-1498.930] (-1501.230) (-1498.781) (-1501.968) -- 0:00:48 314000 -- [-1497.617] (-1496.833) (-1497.593) (-1499.741) * (-1498.672) (-1498.757) (-1502.496) [-1500.926] -- 0:00:48 314500 -- (-1498.603) (-1498.368) (-1497.111) [-1499.242] * (-1497.949) [-1498.009] (-1499.020) (-1501.847) -- 0:00:47 315000 -- (-1498.570) (-1498.113) [-1498.014] (-1501.615) * (-1497.906) (-1499.373) [-1498.744] (-1499.457) -- 0:00:47 Average standard deviation of split frequencies: 0.020806 315500 -- (-1498.570) [-1499.069] (-1503.279) (-1500.192) * [-1497.599] (-1498.153) (-1499.487) (-1498.369) -- 0:00:47 316000 -- (-1497.248) [-1498.286] (-1497.493) (-1497.523) * [-1499.508] (-1498.379) (-1499.588) (-1498.297) -- 0:00:47 316500 -- (-1499.583) (-1498.512) [-1497.636] (-1498.272) * (-1497.116) (-1497.593) [-1498.266] (-1505.295) -- 0:00:47 317000 -- (-1499.102) [-1497.882] (-1497.968) (-1497.038) * (-1498.166) (-1497.591) [-1503.772] (-1500.160) -- 0:00:47 317500 -- [-1497.019] (-1497.095) (-1498.530) (-1499.154) * (-1496.909) (-1500.273) [-1498.515] (-1497.781) -- 0:00:47 318000 -- (-1499.652) [-1500.615] (-1504.473) (-1498.940) * (-1498.831) (-1498.193) [-1498.366] (-1498.211) -- 0:00:47 318500 -- (-1499.265) [-1500.607] (-1503.746) (-1497.315) * (-1496.668) [-1497.462] (-1498.614) (-1498.681) -- 0:00:47 319000 -- (-1499.643) [-1497.746] (-1501.939) (-1496.841) * [-1497.467] (-1502.242) (-1499.935) (-1499.251) -- 0:00:46 319500 -- (-1500.833) (-1502.270) (-1501.189) [-1498.727] * (-1497.624) [-1499.145] (-1498.579) (-1501.843) -- 0:00:46 320000 -- (-1499.670) (-1498.681) (-1502.019) [-1498.255] * (-1497.864) (-1496.334) (-1498.631) [-1500.956] -- 0:00:46 Average standard deviation of split frequencies: 0.020349 320500 -- (-1501.894) (-1502.800) (-1497.535) [-1496.806] * (-1498.894) (-1499.068) [-1500.701] (-1500.434) -- 0:00:46 321000 -- (-1503.367) [-1504.470] (-1498.486) (-1496.875) * (-1502.778) (-1498.975) [-1499.977] (-1500.556) -- 0:00:46 321500 -- (-1502.207) (-1501.452) [-1500.959] (-1496.825) * (-1501.340) (-1498.352) (-1499.931) [-1497.616] -- 0:00:46 322000 -- (-1501.885) (-1499.085) (-1499.272) [-1497.132] * (-1498.257) (-1499.962) [-1499.833] (-1498.520) -- 0:00:46 322500 -- (-1505.075) (-1500.036) [-1497.522] (-1499.811) * (-1498.163) [-1501.447] (-1498.498) (-1498.415) -- 0:00:46 323000 -- (-1502.665) [-1500.126] (-1497.621) (-1498.342) * (-1500.596) (-1497.587) (-1496.895) [-1498.293] -- 0:00:46 323500 -- (-1504.756) (-1498.235) (-1497.148) [-1499.139] * (-1497.456) [-1497.634] (-1498.766) (-1498.111) -- 0:00:46 324000 -- (-1499.526) (-1497.616) (-1498.810) [-1498.644] * (-1500.299) [-1497.993] (-1500.575) (-1497.513) -- 0:00:45 324500 -- (-1498.567) [-1501.345] (-1500.348) (-1498.971) * (-1498.126) (-1497.526) (-1499.883) [-1497.584] -- 0:00:45 325000 -- (-1500.356) (-1499.532) [-1496.807] (-1498.074) * (-1498.047) (-1499.583) [-1496.641] (-1505.815) -- 0:00:45 Average standard deviation of split frequencies: 0.021082 325500 -- (-1502.173) (-1497.243) [-1497.840] (-1496.909) * (-1499.759) [-1497.621] (-1497.522) (-1497.304) -- 0:00:47 326000 -- (-1497.256) (-1499.510) (-1500.394) [-1497.376] * (-1497.003) [-1501.325] (-1497.508) (-1496.704) -- 0:00:47 326500 -- [-1499.864] (-1499.994) (-1498.236) (-1497.375) * [-1497.063] (-1498.560) (-1497.277) (-1496.618) -- 0:00:47 327000 -- (-1497.513) (-1497.361) [-1497.369] (-1497.780) * (-1501.955) (-1500.306) (-1497.292) [-1500.444] -- 0:00:47 327500 -- (-1496.957) [-1498.868] (-1497.327) (-1499.448) * (-1500.444) (-1499.711) [-1498.528] (-1500.526) -- 0:00:47 328000 -- [-1496.965] (-1497.974) (-1498.151) (-1499.755) * [-1499.316] (-1499.869) (-1497.690) (-1498.016) -- 0:00:47 328500 -- (-1497.180) [-1503.771] (-1497.108) (-1501.210) * (-1497.903) (-1499.230) [-1497.781] (-1499.958) -- 0:00:47 329000 -- (-1497.208) (-1502.015) [-1497.513] (-1497.523) * [-1497.955] (-1499.288) (-1502.231) (-1501.186) -- 0:00:46 329500 -- (-1501.131) (-1499.982) [-1497.299] (-1497.813) * [-1499.747] (-1498.722) (-1497.093) (-1501.044) -- 0:00:46 330000 -- (-1496.732) (-1500.054) [-1497.136] (-1498.567) * (-1501.870) [-1498.665] (-1497.111) (-1498.155) -- 0:00:46 Average standard deviation of split frequencies: 0.020559 330500 -- (-1497.012) (-1501.836) (-1500.426) [-1498.740] * [-1501.260] (-1499.475) (-1497.050) (-1500.818) -- 0:00:46 331000 -- (-1496.728) [-1497.930] (-1502.248) (-1497.969) * [-1496.686] (-1498.092) (-1498.039) (-1504.009) -- 0:00:46 331500 -- [-1499.343] (-1500.493) (-1498.367) (-1499.923) * (-1499.425) (-1498.167) (-1497.953) [-1498.265] -- 0:00:46 332000 -- (-1497.697) [-1499.296] (-1502.422) (-1498.092) * (-1502.566) [-1500.424] (-1498.920) (-1497.857) -- 0:00:46 332500 -- [-1500.283] (-1497.441) (-1499.796) (-1500.338) * (-1503.424) (-1499.629) (-1502.931) [-1496.770] -- 0:00:46 333000 -- (-1496.941) (-1499.063) [-1499.747] (-1496.780) * (-1503.076) (-1502.356) [-1497.942] (-1498.276) -- 0:00:46 333500 -- (-1497.882) [-1497.964] (-1499.264) (-1499.353) * (-1501.888) (-1499.013) (-1498.470) [-1498.198] -- 0:00:45 334000 -- (-1498.225) (-1496.701) (-1499.246) [-1499.529] * (-1497.461) (-1498.391) (-1498.638) [-1497.048] -- 0:00:45 334500 -- [-1499.259] (-1497.150) (-1498.371) (-1498.132) * (-1499.800) (-1498.890) [-1498.268] (-1498.351) -- 0:00:45 335000 -- (-1502.519) (-1497.351) (-1498.958) [-1498.223] * (-1498.435) [-1499.365] (-1498.538) (-1500.187) -- 0:00:45 Average standard deviation of split frequencies: 0.020011 335500 -- (-1498.893) [-1500.365] (-1499.627) (-1501.743) * (-1499.580) (-1499.271) (-1497.862) [-1496.889] -- 0:00:45 336000 -- [-1498.321] (-1499.782) (-1498.703) (-1502.948) * [-1504.144] (-1499.501) (-1498.574) (-1497.126) -- 0:00:45 336500 -- [-1497.432] (-1496.776) (-1498.144) (-1500.444) * (-1502.384) [-1497.894] (-1497.575) (-1497.133) -- 0:00:45 337000 -- (-1498.627) [-1498.103] (-1499.870) (-1501.987) * (-1503.212) [-1499.871] (-1498.123) (-1498.828) -- 0:00:45 337500 -- (-1497.621) (-1497.589) [-1500.252] (-1499.743) * [-1497.748] (-1497.607) (-1498.104) (-1498.273) -- 0:00:45 338000 -- (-1499.598) [-1499.036] (-1501.236) (-1497.089) * (-1496.595) (-1496.936) [-1500.500] (-1497.644) -- 0:00:45 338500 -- [-1499.379] (-1496.958) (-1500.421) (-1497.781) * (-1497.350) (-1499.136) (-1500.602) [-1499.606] -- 0:00:44 339000 -- (-1500.705) (-1497.472) (-1498.535) [-1496.426] * (-1496.590) [-1500.199] (-1497.845) (-1501.323) -- 0:00:44 339500 -- (-1499.585) (-1497.615) (-1498.402) [-1497.500] * (-1498.838) (-1497.274) [-1499.039] (-1498.752) -- 0:00:44 340000 -- [-1498.830] (-1502.589) (-1497.430) (-1499.747) * (-1501.065) (-1499.577) [-1498.707] (-1498.713) -- 0:00:44 Average standard deviation of split frequencies: 0.019518 340500 -- [-1504.506] (-1501.771) (-1497.236) (-1499.366) * (-1502.003) (-1500.392) [-1499.107] (-1503.545) -- 0:00:44 341000 -- (-1504.342) (-1502.985) (-1498.441) [-1504.235] * (-1501.578) (-1500.929) (-1500.676) [-1498.236] -- 0:00:44 341500 -- [-1503.112] (-1499.656) (-1499.666) (-1503.184) * [-1500.327] (-1498.454) (-1500.828) (-1497.843) -- 0:00:46 342000 -- [-1498.220] (-1499.484) (-1497.105) (-1501.962) * (-1499.618) (-1498.208) [-1497.549] (-1497.608) -- 0:00:46 342500 -- (-1498.079) [-1499.850] (-1497.666) (-1498.408) * (-1503.328) (-1497.885) (-1499.321) [-1496.943] -- 0:00:46 343000 -- (-1498.076) (-1498.289) (-1497.686) [-1498.290] * (-1502.134) (-1497.473) (-1498.195) [-1498.301] -- 0:00:45 343500 -- (-1497.972) [-1497.193] (-1496.432) (-1500.838) * (-1504.120) (-1497.535) (-1497.349) [-1501.277] -- 0:00:45 344000 -- (-1498.863) [-1497.193] (-1500.550) (-1498.415) * (-1505.747) (-1499.273) [-1498.249] (-1501.648) -- 0:00:45 344500 -- (-1496.865) (-1497.210) [-1501.985] (-1499.796) * (-1499.600) [-1499.736] (-1502.195) (-1500.721) -- 0:00:45 345000 -- [-1498.207] (-1499.575) (-1499.255) (-1499.736) * [-1499.962] (-1501.191) (-1502.676) (-1497.591) -- 0:00:45 Average standard deviation of split frequencies: 0.019218 345500 -- [-1499.863] (-1499.954) (-1496.942) (-1498.662) * (-1500.159) (-1500.873) [-1499.340] (-1497.020) -- 0:00:45 346000 -- (-1501.681) [-1499.638] (-1498.434) (-1497.317) * (-1501.810) [-1498.337] (-1499.116) (-1498.164) -- 0:00:45 346500 -- (-1498.218) [-1497.755] (-1499.852) (-1498.804) * [-1501.426] (-1497.361) (-1499.216) (-1502.580) -- 0:00:45 347000 -- [-1496.142] (-1500.125) (-1500.589) (-1498.804) * [-1496.687] (-1496.619) (-1497.281) (-1501.008) -- 0:00:45 347500 -- [-1496.514] (-1497.658) (-1501.743) (-1496.998) * (-1497.152) (-1496.585) [-1496.635] (-1497.319) -- 0:00:45 348000 -- [-1497.996] (-1497.127) (-1497.033) (-1496.623) * (-1497.201) [-1497.193] (-1496.457) (-1498.385) -- 0:00:44 348500 -- (-1501.235) [-1497.727] (-1498.709) (-1500.657) * (-1497.170) (-1499.633) [-1499.572] (-1498.003) -- 0:00:44 349000 -- (-1499.674) [-1497.864] (-1497.089) (-1499.558) * (-1500.097) (-1499.364) (-1503.724) [-1497.249] -- 0:00:44 349500 -- [-1496.362] (-1496.591) (-1497.782) (-1498.458) * (-1497.242) (-1499.958) [-1499.094] (-1496.661) -- 0:00:44 350000 -- (-1500.191) (-1496.863) (-1501.770) [-1499.849] * (-1499.994) (-1497.496) [-1498.171] (-1497.333) -- 0:00:44 Average standard deviation of split frequencies: 0.018325 350500 -- [-1497.570] (-1497.973) (-1500.513) (-1499.208) * (-1500.636) (-1496.580) [-1497.276] (-1497.510) -- 0:00:44 351000 -- (-1498.557) (-1497.815) [-1499.991] (-1502.018) * (-1501.532) (-1500.064) (-1497.358) [-1497.805] -- 0:00:44 351500 -- [-1498.189] (-1497.809) (-1499.685) (-1501.890) * (-1496.972) (-1500.188) [-1497.143] (-1498.356) -- 0:00:44 352000 -- [-1498.160] (-1497.343) (-1499.178) (-1498.234) * (-1498.620) (-1500.044) (-1497.026) [-1498.549] -- 0:00:44 352500 -- (-1503.617) (-1498.107) (-1497.714) [-1498.607] * [-1496.363] (-1500.949) (-1498.148) (-1497.588) -- 0:00:44 353000 -- [-1499.678] (-1500.224) (-1498.305) (-1498.142) * (-1497.107) (-1498.658) [-1496.621] (-1499.423) -- 0:00:43 353500 -- (-1498.339) [-1498.265] (-1497.019) (-1501.688) * [-1497.532] (-1497.413) (-1496.781) (-1499.212) -- 0:00:43 354000 -- (-1498.340) [-1500.222] (-1498.313) (-1500.107) * (-1497.642) (-1497.295) (-1497.848) [-1499.007] -- 0:00:43 354500 -- (-1497.773) (-1496.455) (-1497.510) [-1498.549] * [-1497.164] (-1497.762) (-1499.696) (-1499.007) -- 0:00:43 355000 -- (-1496.900) [-1496.354] (-1498.755) (-1498.513) * (-1498.726) [-1498.282] (-1499.195) (-1497.728) -- 0:00:43 Average standard deviation of split frequencies: 0.018887 355500 -- [-1496.847] (-1498.422) (-1501.582) (-1500.656) * (-1497.475) [-1501.535] (-1498.971) (-1498.006) -- 0:00:43 356000 -- (-1496.843) [-1496.966] (-1501.271) (-1500.296) * (-1497.503) (-1498.300) (-1498.744) [-1497.206] -- 0:00:43 356500 -- (-1497.802) [-1496.662] (-1502.059) (-1498.452) * (-1498.056) (-1497.759) (-1499.783) [-1497.799] -- 0:00:43 357000 -- (-1498.019) [-1496.867] (-1497.852) (-1497.192) * (-1498.960) [-1497.230] (-1496.465) (-1497.961) -- 0:00:43 357500 -- (-1502.388) (-1497.132) (-1498.795) [-1498.470] * (-1499.005) (-1497.788) [-1496.517] (-1497.845) -- 0:00:44 358000 -- (-1499.090) (-1497.132) [-1499.292] (-1501.204) * (-1498.018) [-1497.715] (-1496.504) (-1499.314) -- 0:00:44 358500 -- (-1499.706) (-1497.530) [-1498.706] (-1498.379) * (-1505.258) (-1500.337) [-1498.324] (-1498.936) -- 0:00:44 359000 -- (-1499.764) [-1496.883] (-1500.858) (-1501.793) * [-1499.807] (-1500.313) (-1496.646) (-1497.717) -- 0:00:44 359500 -- [-1498.449] (-1498.250) (-1497.008) (-1499.709) * (-1499.532) [-1498.814] (-1500.004) (-1500.591) -- 0:00:44 360000 -- (-1502.462) (-1498.130) [-1499.468] (-1496.567) * (-1501.126) [-1497.867] (-1499.157) (-1499.744) -- 0:00:44 Average standard deviation of split frequencies: 0.018367 360500 -- (-1502.523) (-1499.219) [-1499.547] (-1497.731) * (-1500.948) [-1499.392] (-1499.441) (-1499.074) -- 0:00:44 361000 -- (-1497.877) (-1500.453) (-1507.927) [-1498.939] * (-1499.765) [-1499.633] (-1500.635) (-1498.972) -- 0:00:44 361500 -- [-1498.270] (-1497.556) (-1501.431) (-1500.567) * (-1499.577) (-1499.210) (-1499.307) [-1499.333] -- 0:00:44 362000 -- (-1499.259) (-1498.142) (-1501.465) [-1499.493] * (-1499.374) (-1498.823) (-1497.594) [-1499.779] -- 0:00:44 362500 -- (-1499.511) [-1497.617] (-1500.609) (-1500.371) * (-1498.636) (-1501.180) (-1497.323) [-1498.274] -- 0:00:43 363000 -- (-1499.023) (-1498.681) [-1498.526] (-1499.995) * [-1497.688] (-1498.776) (-1497.081) (-1501.214) -- 0:00:43 363500 -- (-1497.866) [-1497.771] (-1498.771) (-1497.773) * (-1497.688) (-1498.805) [-1501.056] (-1499.337) -- 0:00:43 364000 -- (-1496.591) (-1498.267) [-1496.354] (-1497.525) * (-1500.596) (-1498.384) (-1497.767) [-1498.153] -- 0:00:43 364500 -- (-1497.971) [-1499.244] (-1496.415) (-1501.932) * (-1500.661) [-1498.337] (-1497.304) (-1497.325) -- 0:00:43 365000 -- (-1506.355) (-1498.616) (-1497.070) [-1504.595] * (-1497.006) [-1499.555] (-1498.104) (-1498.532) -- 0:00:43 Average standard deviation of split frequencies: 0.018891 365500 -- (-1505.739) (-1498.531) (-1497.460) [-1498.010] * (-1497.199) [-1498.362] (-1498.799) (-1498.183) -- 0:00:43 366000 -- (-1499.519) (-1497.282) (-1497.411) [-1501.151] * (-1497.472) (-1503.347) (-1499.220) [-1498.991] -- 0:00:43 366500 -- (-1497.707) (-1499.390) (-1499.671) [-1500.210] * (-1497.271) (-1508.855) [-1496.412] (-1498.701) -- 0:00:43 367000 -- [-1500.180] (-1497.713) (-1499.909) (-1501.625) * (-1497.050) (-1497.302) [-1497.224] (-1499.077) -- 0:00:43 367500 -- (-1497.691) (-1499.245) (-1499.375) [-1498.533] * (-1498.147) (-1497.156) [-1498.615] (-1499.529) -- 0:00:43 368000 -- (-1496.579) [-1499.173] (-1497.018) (-1497.942) * (-1499.163) (-1497.762) (-1496.990) [-1498.437] -- 0:00:42 368500 -- (-1496.664) (-1499.567) (-1498.527) [-1496.790] * (-1498.753) (-1498.037) (-1501.796) [-1496.550] -- 0:00:42 369000 -- (-1500.692) (-1497.975) (-1500.754) [-1497.139] * [-1498.275] (-1498.253) (-1498.379) (-1497.313) -- 0:00:42 369500 -- (-1497.939) [-1498.292] (-1500.553) (-1503.217) * (-1496.434) (-1498.940) [-1501.044] (-1496.917) -- 0:00:42 370000 -- (-1496.685) (-1502.032) [-1498.398] (-1496.586) * (-1496.436) [-1497.666] (-1500.101) (-1500.525) -- 0:00:42 Average standard deviation of split frequencies: 0.017002 370500 -- [-1497.141] (-1502.818) (-1500.792) (-1501.685) * [-1496.436] (-1496.960) (-1500.292) (-1497.975) -- 0:00:42 371000 -- [-1496.489] (-1500.791) (-1498.495) (-1500.417) * (-1497.129) [-1497.502] (-1500.505) (-1497.679) -- 0:00:42 371500 -- (-1496.460) [-1497.738] (-1497.874) (-1498.187) * (-1498.058) (-1498.392) (-1499.433) [-1499.399] -- 0:00:42 372000 -- [-1500.972] (-1498.174) (-1497.296) (-1497.153) * (-1500.223) (-1498.715) [-1501.737] (-1498.798) -- 0:00:42 372500 -- (-1498.036) (-1500.002) [-1498.028] (-1496.745) * (-1499.320) (-1499.030) (-1498.308) [-1498.662] -- 0:00:42 373000 -- (-1499.650) [-1499.183] (-1498.758) (-1497.007) * (-1502.017) (-1498.572) (-1497.825) [-1498.061] -- 0:00:42 373500 -- [-1497.471] (-1498.968) (-1499.106) (-1499.888) * (-1498.239) (-1499.170) (-1498.246) [-1498.366] -- 0:00:43 374000 -- (-1497.443) (-1498.734) [-1497.591] (-1499.793) * (-1498.670) [-1496.829] (-1502.289) (-1499.067) -- 0:00:43 374500 -- (-1500.018) [-1498.350] (-1500.057) (-1500.859) * [-1497.149] (-1499.309) (-1500.356) (-1500.036) -- 0:00:43 375000 -- (-1500.043) (-1497.149) [-1497.891] (-1498.540) * (-1497.635) (-1499.664) [-1500.710] (-1497.431) -- 0:00:43 Average standard deviation of split frequencies: 0.016368 375500 -- [-1499.452] (-1497.222) (-1498.817) (-1497.636) * [-1498.009] (-1499.391) (-1497.760) (-1497.412) -- 0:00:43 376000 -- (-1499.602) (-1499.736) [-1500.953] (-1497.095) * (-1499.345) [-1500.676] (-1496.843) (-1498.306) -- 0:00:43 376500 -- (-1499.985) (-1498.026) (-1500.102) [-1497.312] * (-1498.246) (-1499.399) (-1496.564) [-1497.742] -- 0:00:43 377000 -- [-1499.855] (-1498.259) (-1498.312) (-1499.408) * (-1498.140) (-1499.179) (-1497.421) [-1498.506] -- 0:00:42 377500 -- (-1500.283) (-1498.308) [-1498.832] (-1497.253) * (-1502.797) (-1499.467) [-1497.599] (-1498.770) -- 0:00:42 378000 -- [-1504.836] (-1498.036) (-1498.386) (-1497.950) * [-1498.372] (-1498.494) (-1497.298) (-1498.207) -- 0:00:42 378500 -- (-1503.852) (-1502.501) (-1499.423) [-1497.145] * [-1499.595] (-1497.448) (-1497.552) (-1500.637) -- 0:00:42 379000 -- [-1500.034] (-1503.826) (-1499.363) (-1501.624) * (-1500.848) [-1497.186] (-1497.027) (-1500.659) -- 0:00:42 379500 -- (-1498.191) (-1497.356) [-1498.380] (-1501.750) * (-1497.832) (-1497.211) (-1496.550) [-1497.844] -- 0:00:42 380000 -- (-1499.214) (-1499.753) (-1501.107) [-1497.870] * (-1497.966) (-1501.401) [-1497.458] (-1497.826) -- 0:00:42 Average standard deviation of split frequencies: 0.016443 380500 -- (-1499.311) (-1499.569) [-1497.278] (-1497.626) * (-1497.250) (-1499.882) (-1503.188) [-1496.307] -- 0:00:42 381000 -- (-1498.019) [-1498.269] (-1496.735) (-1499.461) * [-1496.624] (-1498.366) (-1503.453) (-1496.287) -- 0:00:42 381500 -- (-1498.739) [-1498.036] (-1496.609) (-1497.391) * [-1498.718] (-1499.767) (-1497.556) (-1496.561) -- 0:00:42 382000 -- (-1498.846) (-1500.166) (-1497.813) [-1497.929] * (-1497.699) (-1500.027) (-1496.688) [-1497.396] -- 0:00:42 382500 -- (-1498.684) (-1499.353) (-1499.619) [-1500.227] * [-1497.612] (-1498.943) (-1502.393) (-1498.644) -- 0:00:41 383000 -- [-1499.536] (-1498.916) (-1497.999) (-1500.000) * (-1498.941) (-1497.967) (-1502.206) [-1497.434] -- 0:00:41 383500 -- (-1498.477) [-1497.481] (-1500.162) (-1500.623) * (-1497.144) (-1498.396) [-1496.360] (-1499.645) -- 0:00:41 384000 -- [-1499.521] (-1497.340) (-1498.170) (-1500.931) * (-1497.735) [-1499.344] (-1496.380) (-1498.806) -- 0:00:41 384500 -- [-1499.876] (-1498.149) (-1499.093) (-1502.566) * [-1500.155] (-1496.703) (-1496.418) (-1498.055) -- 0:00:41 385000 -- (-1500.968) (-1501.148) (-1499.093) [-1497.017] * (-1500.107) (-1496.819) [-1496.727] (-1496.789) -- 0:00:41 Average standard deviation of split frequencies: 0.016894 385500 -- (-1499.860) [-1500.192] (-1500.641) (-1499.514) * (-1498.376) (-1501.431) [-1500.610] (-1496.593) -- 0:00:41 386000 -- [-1500.259] (-1499.203) (-1499.407) (-1496.778) * (-1497.886) (-1499.706) (-1500.672) [-1498.064] -- 0:00:41 386500 -- (-1501.234) [-1497.737] (-1498.068) (-1502.681) * (-1498.060) (-1500.912) [-1497.065] (-1498.851) -- 0:00:41 387000 -- (-1500.164) (-1500.977) [-1497.911] (-1497.192) * (-1496.270) (-1497.637) [-1496.316] (-1500.715) -- 0:00:41 387500 -- [-1499.888] (-1499.945) (-1498.359) (-1497.243) * [-1497.811] (-1497.956) (-1497.564) (-1503.070) -- 0:00:41 388000 -- [-1499.889] (-1499.448) (-1497.731) (-1498.230) * [-1496.613] (-1500.372) (-1501.238) (-1498.293) -- 0:00:41 388500 -- [-1500.692] (-1499.986) (-1501.833) (-1497.219) * (-1498.277) (-1499.982) [-1497.930] (-1498.035) -- 0:00:40 389000 -- [-1500.242] (-1498.439) (-1499.165) (-1497.340) * (-1496.323) [-1498.295] (-1497.126) (-1497.896) -- 0:00:40 389500 -- (-1496.567) (-1500.681) (-1500.039) [-1497.966] * [-1499.178] (-1496.989) (-1497.034) (-1496.975) -- 0:00:42 390000 -- (-1498.642) (-1499.301) [-1499.930] (-1498.675) * [-1499.609] (-1496.678) (-1497.343) (-1497.678) -- 0:00:42 Average standard deviation of split frequencies: 0.017027 390500 -- (-1497.419) (-1497.828) (-1499.193) [-1498.271] * (-1496.841) (-1498.166) (-1498.058) [-1497.788] -- 0:00:42 391000 -- (-1498.502) (-1498.683) [-1498.965] (-1499.955) * (-1497.341) (-1497.420) [-1499.862] (-1498.356) -- 0:00:42 391500 -- (-1497.130) (-1500.660) (-1496.535) [-1498.063] * (-1497.469) (-1497.632) (-1498.746) [-1499.507] -- 0:00:41 392000 -- (-1496.994) (-1502.806) (-1501.332) [-1497.244] * (-1496.747) (-1497.670) [-1497.445] (-1498.315) -- 0:00:41 392500 -- (-1496.427) [-1499.487] (-1497.308) (-1497.977) * (-1496.746) [-1498.257] (-1497.297) (-1498.364) -- 0:00:41 393000 -- (-1498.275) (-1498.428) (-1497.313) [-1497.084] * (-1496.679) [-1498.432] (-1496.978) (-1497.075) -- 0:00:41 393500 -- [-1498.273] (-1498.428) (-1498.587) (-1499.434) * (-1497.084) (-1500.462) [-1496.981] (-1497.522) -- 0:00:41 394000 -- (-1498.097) (-1499.105) (-1500.545) [-1498.045] * (-1501.048) (-1500.259) (-1496.895) [-1502.205] -- 0:00:41 394500 -- (-1498.081) [-1498.232] (-1498.063) (-1497.138) * (-1496.972) (-1497.351) [-1498.557] (-1499.558) -- 0:00:41 395000 -- (-1500.960) (-1497.928) [-1500.860] (-1496.531) * (-1498.127) (-1501.465) [-1499.105] (-1501.436) -- 0:00:41 Average standard deviation of split frequencies: 0.016335 395500 -- (-1499.616) [-1498.176] (-1497.226) (-1498.865) * (-1499.352) (-1497.727) [-1496.682] (-1499.376) -- 0:00:41 396000 -- (-1498.014) [-1497.997] (-1500.694) (-1503.024) * (-1499.386) (-1497.267) (-1497.066) [-1496.757] -- 0:00:41 396500 -- (-1497.387) (-1496.500) [-1499.541] (-1500.460) * (-1499.472) [-1497.349] (-1497.705) (-1498.267) -- 0:00:41 397000 -- (-1497.556) (-1497.936) (-1498.950) [-1498.187] * (-1496.789) (-1497.087) (-1501.207) [-1502.136] -- 0:00:41 397500 -- [-1501.345] (-1497.282) (-1498.744) (-1497.727) * (-1498.595) [-1496.199] (-1502.239) (-1499.388) -- 0:00:40 398000 -- (-1502.463) (-1498.034) (-1499.698) [-1497.027] * [-1498.078] (-1496.176) (-1502.632) (-1498.238) -- 0:00:40 398500 -- [-1500.322] (-1500.380) (-1497.430) (-1498.814) * [-1498.078] (-1496.554) (-1500.502) (-1496.788) -- 0:00:40 399000 -- (-1498.240) (-1497.856) (-1496.672) [-1499.699] * (-1502.306) (-1497.593) (-1501.246) [-1497.334] -- 0:00:40 399500 -- (-1498.632) (-1499.046) [-1496.570] (-1497.851) * (-1497.064) (-1497.451) [-1499.352] (-1498.690) -- 0:00:40 400000 -- (-1498.670) (-1497.496) [-1497.592] (-1496.615) * (-1496.820) [-1496.519] (-1498.650) (-1502.309) -- 0:00:40 Average standard deviation of split frequencies: 0.015226 400500 -- (-1496.434) [-1497.138] (-1498.419) (-1499.388) * (-1499.229) (-1497.096) [-1497.037] (-1501.772) -- 0:00:40 401000 -- (-1497.793) (-1496.993) (-1497.746) [-1497.528] * (-1502.121) (-1499.426) [-1499.482] (-1501.571) -- 0:00:40 401500 -- (-1498.926) [-1497.760] (-1499.342) (-1501.774) * (-1498.076) (-1498.050) [-1499.662] (-1499.713) -- 0:00:40 402000 -- (-1497.420) [-1498.101] (-1503.546) (-1504.380) * (-1497.179) (-1496.906) [-1505.727] (-1500.810) -- 0:00:40 402500 -- (-1497.541) (-1497.099) (-1497.737) [-1498.058] * (-1496.745) (-1498.282) (-1501.682) [-1503.460] -- 0:00:40 403000 -- [-1497.680] (-1498.505) (-1498.108) (-1499.381) * (-1497.740) (-1499.858) [-1503.070] (-1501.456) -- 0:00:39 403500 -- [-1496.565] (-1497.451) (-1505.067) (-1501.150) * [-1498.823] (-1499.096) (-1500.334) (-1501.267) -- 0:00:39 404000 -- [-1497.953] (-1497.173) (-1501.475) (-1501.338) * (-1498.741) [-1501.812] (-1499.365) (-1498.435) -- 0:00:39 404500 -- (-1496.718) (-1500.959) [-1501.980] (-1498.816) * (-1501.136) (-1504.341) [-1498.895] (-1498.573) -- 0:00:39 405000 -- [-1497.337] (-1500.274) (-1499.738) (-1500.850) * (-1499.022) [-1497.231] (-1498.629) (-1498.385) -- 0:00:39 Average standard deviation of split frequencies: 0.015804 405500 -- [-1496.520] (-1496.357) (-1497.048) (-1498.364) * [-1499.675] (-1496.569) (-1498.585) (-1498.054) -- 0:00:41 406000 -- (-1499.350) [-1496.357] (-1497.073) (-1497.602) * (-1499.251) (-1496.924) (-1498.378) [-1500.652] -- 0:00:40 406500 -- (-1500.640) (-1496.561) [-1500.919] (-1497.205) * [-1497.005] (-1497.680) (-1497.602) (-1501.180) -- 0:00:40 407000 -- (-1498.056) (-1496.562) [-1500.518] (-1497.803) * [-1497.707] (-1499.328) (-1497.873) (-1498.061) -- 0:00:40 407500 -- [-1497.745] (-1501.280) (-1496.961) (-1497.956) * (-1499.398) [-1499.587] (-1500.518) (-1498.817) -- 0:00:40 408000 -- (-1498.641) (-1503.899) [-1497.763] (-1498.982) * (-1498.239) [-1498.504] (-1499.884) (-1497.063) -- 0:00:40 408500 -- [-1498.602] (-1498.421) (-1497.437) (-1499.558) * [-1497.949] (-1497.991) (-1499.341) (-1499.683) -- 0:00:40 409000 -- (-1497.845) (-1498.422) (-1497.437) [-1497.761] * [-1498.485] (-1497.448) (-1498.171) (-1500.139) -- 0:00:40 409500 -- (-1498.200) (-1499.753) [-1498.330] (-1500.164) * [-1502.617] (-1498.157) (-1498.611) (-1496.917) -- 0:00:40 410000 -- (-1498.778) [-1497.663] (-1501.246) (-1500.696) * (-1497.936) (-1499.233) [-1497.330] (-1498.577) -- 0:00:40 Average standard deviation of split frequencies: 0.015433 410500 -- [-1496.621] (-1498.181) (-1499.623) (-1500.971) * (-1501.988) (-1497.696) (-1500.607) [-1498.725] -- 0:00:40 411000 -- (-1496.442) (-1498.084) (-1498.201) [-1497.048] * (-1498.484) [-1497.106] (-1506.457) (-1499.957) -- 0:00:40 411500 -- (-1498.502) [-1497.042] (-1498.820) (-1499.627) * (-1498.347) [-1497.353] (-1499.366) (-1499.892) -- 0:00:40 412000 -- (-1498.502) (-1497.787) (-1503.547) [-1499.246] * (-1497.954) (-1496.805) [-1498.266] (-1498.421) -- 0:00:39 412500 -- (-1499.263) (-1503.800) (-1499.101) [-1496.777] * (-1496.599) [-1496.967] (-1497.620) (-1496.483) -- 0:00:39 413000 -- [-1499.070] (-1500.335) (-1499.225) (-1500.306) * (-1497.166) (-1497.316) (-1500.010) [-1498.114] -- 0:00:39 413500 -- (-1499.850) (-1497.843) [-1499.168] (-1499.814) * (-1497.027) [-1499.175] (-1501.183) (-1498.539) -- 0:00:39 414000 -- (-1499.288) [-1499.551] (-1497.871) (-1496.947) * (-1499.255) (-1497.242) [-1499.902] (-1497.804) -- 0:00:39 414500 -- (-1500.052) [-1498.614] (-1499.444) (-1499.463) * (-1496.825) (-1497.555) [-1500.538] (-1497.603) -- 0:00:39 415000 -- (-1498.913) (-1502.435) (-1496.839) [-1496.725] * (-1498.521) (-1497.765) [-1499.364] (-1499.337) -- 0:00:39 Average standard deviation of split frequencies: 0.014131 415500 -- (-1500.042) (-1500.277) [-1497.551] (-1497.469) * (-1501.118) (-1498.028) (-1498.320) [-1497.442] -- 0:00:39 416000 -- (-1497.745) (-1496.897) [-1498.560] (-1497.938) * (-1498.543) (-1502.742) [-1496.971] (-1497.260) -- 0:00:39 416500 -- (-1500.073) (-1497.310) (-1502.263) [-1497.165] * (-1499.235) [-1500.638] (-1500.077) (-1499.768) -- 0:00:39 417000 -- (-1505.706) (-1497.548) [-1499.472] (-1497.799) * (-1499.814) (-1498.774) (-1499.221) [-1496.751] -- 0:00:39 417500 -- (-1497.255) (-1502.368) [-1498.787] (-1501.987) * (-1500.180) (-1497.949) (-1496.831) [-1496.272] -- 0:00:39 418000 -- (-1500.757) (-1497.761) [-1497.871] (-1500.502) * (-1502.013) [-1499.306] (-1496.684) (-1498.615) -- 0:00:38 418500 -- (-1498.329) (-1499.785) [-1498.556] (-1500.893) * (-1498.822) (-1499.350) [-1498.306] (-1498.570) -- 0:00:38 419000 -- (-1497.694) (-1502.536) [-1497.568] (-1500.275) * [-1497.232] (-1499.802) (-1497.798) (-1497.874) -- 0:00:38 419500 -- (-1499.119) [-1496.654] (-1496.923) (-1499.178) * (-1499.022) [-1498.761] (-1497.934) (-1497.910) -- 0:00:38 420000 -- (-1498.084) (-1497.528) [-1497.150] (-1498.397) * (-1498.558) [-1498.551] (-1498.093) (-1500.022) -- 0:00:38 Average standard deviation of split frequencies: 0.015227 420500 -- (-1502.291) (-1498.019) [-1499.699] (-1497.883) * (-1504.510) [-1500.553] (-1499.078) (-1499.691) -- 0:00:38 421000 -- (-1499.591) (-1498.135) (-1501.643) [-1498.289] * (-1498.343) [-1498.958] (-1504.244) (-1498.772) -- 0:00:39 421500 -- (-1501.179) (-1498.644) (-1498.849) [-1497.277] * (-1497.752) (-1500.448) [-1497.456] (-1498.889) -- 0:00:39 422000 -- (-1499.392) (-1497.545) (-1502.054) [-1498.422] * [-1497.094] (-1500.451) (-1499.095) (-1504.564) -- 0:00:39 422500 -- (-1500.722) [-1497.640] (-1498.495) (-1498.094) * (-1499.171) [-1499.077] (-1498.910) (-1498.577) -- 0:00:39 423000 -- (-1499.097) [-1501.046] (-1497.190) (-1497.642) * [-1497.602] (-1498.646) (-1496.680) (-1498.684) -- 0:00:39 423500 -- (-1499.083) [-1498.571] (-1497.152) (-1497.741) * (-1497.458) (-1498.337) [-1497.661] (-1500.768) -- 0:00:39 424000 -- (-1500.360) (-1497.935) (-1500.397) [-1497.647] * (-1498.402) (-1498.363) [-1499.733] (-1506.065) -- 0:00:39 424500 -- (-1501.593) [-1496.561] (-1501.995) (-1500.258) * (-1499.048) [-1498.835] (-1501.074) (-1497.829) -- 0:00:39 425000 -- [-1498.291] (-1498.862) (-1496.916) (-1498.836) * (-1497.340) (-1496.953) [-1498.023] (-1498.888) -- 0:00:39 Average standard deviation of split frequencies: 0.015000 425500 -- [-1497.592] (-1497.300) (-1497.543) (-1501.917) * [-1497.332] (-1497.034) (-1501.102) (-1498.830) -- 0:00:39 426000 -- (-1499.313) (-1499.348) [-1497.889] (-1501.853) * (-1498.421) (-1498.026) (-1499.088) [-1498.933] -- 0:00:39 426500 -- (-1498.795) [-1499.279] (-1497.995) (-1498.251) * (-1499.222) (-1497.642) (-1500.888) [-1497.690] -- 0:00:38 427000 -- [-1497.166] (-1498.335) (-1497.711) (-1497.876) * (-1497.641) (-1500.308) [-1498.008] (-1496.563) -- 0:00:38 427500 -- (-1498.007) [-1499.200] (-1498.653) (-1497.315) * [-1498.368] (-1498.554) (-1499.454) (-1497.871) -- 0:00:38 428000 -- (-1503.037) [-1496.730] (-1497.774) (-1497.315) * (-1498.081) (-1499.634) [-1496.836] (-1497.697) -- 0:00:38 428500 -- [-1502.954] (-1497.133) (-1496.894) (-1498.343) * (-1499.604) [-1500.414] (-1496.831) (-1498.031) -- 0:00:38 429000 -- (-1496.771) [-1499.461] (-1499.392) (-1500.924) * (-1498.262) [-1499.751] (-1499.737) (-1498.279) -- 0:00:38 429500 -- (-1501.580) (-1501.753) (-1497.910) [-1497.172] * [-1497.455] (-1499.106) (-1498.786) (-1499.386) -- 0:00:38 430000 -- (-1502.728) [-1499.612] (-1497.664) (-1497.716) * (-1497.909) (-1497.404) (-1498.699) [-1498.801] -- 0:00:38 Average standard deviation of split frequencies: 0.013999 430500 -- (-1499.303) (-1503.853) (-1501.332) [-1501.453] * (-1498.026) [-1499.261] (-1500.678) (-1498.214) -- 0:00:38 431000 -- (-1499.080) (-1501.589) (-1499.303) [-1498.710] * (-1498.202) (-1500.600) [-1499.099] (-1497.357) -- 0:00:38 431500 -- [-1498.502] (-1498.657) (-1505.119) (-1497.113) * (-1497.422) (-1498.782) (-1498.048) [-1499.092] -- 0:00:38 432000 -- (-1497.549) (-1497.143) [-1498.394] (-1498.273) * (-1498.905) (-1497.862) [-1498.676] (-1501.596) -- 0:00:38 432500 -- (-1498.797) [-1497.569] (-1499.037) (-1498.844) * (-1499.357) [-1497.930] (-1500.101) (-1500.921) -- 0:00:38 433000 -- [-1497.641] (-1497.645) (-1496.788) (-1498.204) * (-1498.303) (-1497.930) [-1499.872] (-1497.751) -- 0:00:37 433500 -- [-1499.144] (-1497.603) (-1496.632) (-1496.906) * [-1497.362] (-1497.983) (-1499.635) (-1499.328) -- 0:00:37 434000 -- [-1499.281] (-1497.255) (-1496.719) (-1498.572) * (-1498.537) [-1498.044] (-1499.475) (-1499.079) -- 0:00:37 434500 -- (-1498.265) (-1496.534) (-1497.153) [-1499.154] * (-1498.905) [-1498.448] (-1497.240) (-1499.036) -- 0:00:37 435000 -- (-1497.673) (-1497.831) [-1497.259] (-1501.941) * [-1497.383] (-1498.154) (-1497.463) (-1499.081) -- 0:00:37 Average standard deviation of split frequencies: 0.014882 435500 -- (-1501.785) (-1497.043) [-1497.426] (-1498.196) * [-1498.267] (-1499.520) (-1497.652) (-1498.327) -- 0:00:37 436000 -- (-1499.866) (-1497.312) [-1496.483] (-1496.482) * [-1498.407] (-1498.622) (-1499.130) (-1498.667) -- 0:00:37 436500 -- (-1497.926) [-1499.031] (-1503.080) (-1499.245) * [-1497.735] (-1499.555) (-1498.935) (-1498.753) -- 0:00:38 437000 -- [-1498.788] (-1501.558) (-1501.982) (-1499.382) * (-1498.342) (-1508.390) [-1499.257] (-1498.440) -- 0:00:38 437500 -- (-1502.919) (-1506.801) [-1497.849] (-1500.787) * (-1498.590) (-1501.612) (-1502.781) [-1498.420] -- 0:00:38 438000 -- (-1499.807) (-1498.688) (-1499.350) [-1497.984] * (-1497.990) (-1501.259) [-1497.425] (-1498.748) -- 0:00:38 438500 -- (-1502.800) (-1500.576) (-1499.034) [-1498.673] * (-1500.556) (-1498.138) [-1500.022] (-1500.482) -- 0:00:38 439000 -- (-1497.967) (-1500.200) [-1498.274] (-1497.948) * (-1498.874) [-1497.231] (-1499.433) (-1499.190) -- 0:00:38 439500 -- [-1496.923] (-1499.889) (-1498.769) (-1496.591) * (-1499.758) (-1499.605) [-1497.031] (-1500.363) -- 0:00:38 440000 -- [-1496.924] (-1498.984) (-1500.742) (-1496.700) * (-1499.505) (-1498.762) [-1497.169] (-1499.957) -- 0:00:38 Average standard deviation of split frequencies: 0.014725 440500 -- [-1497.536] (-1498.663) (-1498.075) (-1498.401) * [-1498.411] (-1500.272) (-1498.405) (-1498.607) -- 0:00:38 441000 -- (-1498.519) (-1499.593) [-1497.118] (-1498.560) * (-1501.273) [-1498.797] (-1497.505) (-1500.847) -- 0:00:38 441500 -- (-1498.454) (-1500.816) (-1505.770) [-1496.830] * [-1501.447] (-1498.164) (-1497.331) (-1497.512) -- 0:00:37 442000 -- (-1497.531) (-1501.347) (-1502.780) [-1497.928] * [-1498.650] (-1501.095) (-1499.320) (-1498.057) -- 0:00:37 442500 -- [-1498.380] (-1499.491) (-1503.586) (-1499.214) * (-1497.414) (-1503.379) [-1498.832] (-1499.929) -- 0:00:37 443000 -- (-1499.133) (-1499.172) (-1499.692) [-1500.889] * (-1499.911) (-1501.950) [-1499.843] (-1497.622) -- 0:00:37 443500 -- (-1499.609) (-1499.223) (-1501.247) [-1500.552] * [-1497.571] (-1500.856) (-1498.904) (-1497.334) -- 0:00:37 444000 -- (-1498.557) (-1499.253) (-1499.417) [-1500.927] * (-1497.571) (-1496.728) [-1496.769] (-1497.130) -- 0:00:37 444500 -- (-1501.138) [-1501.525] (-1504.464) (-1501.759) * (-1497.239) (-1497.246) (-1499.413) [-1499.296] -- 0:00:37 445000 -- [-1498.435] (-1499.823) (-1498.195) (-1500.046) * (-1497.098) [-1502.199] (-1500.892) (-1499.461) -- 0:00:37 Average standard deviation of split frequencies: 0.014238 445500 -- (-1497.313) (-1499.994) (-1500.062) [-1499.367] * (-1497.144) (-1500.295) (-1505.906) [-1498.588] -- 0:00:37 446000 -- (-1497.399) (-1499.106) (-1498.446) [-1498.317] * (-1497.648) (-1498.436) (-1503.150) [-1497.789] -- 0:00:37 446500 -- (-1497.591) [-1499.156] (-1496.860) (-1497.162) * (-1498.886) (-1498.601) (-1496.865) [-1498.477] -- 0:00:37 447000 -- (-1498.041) (-1498.491) (-1497.929) [-1498.683] * [-1497.434] (-1498.344) (-1498.124) (-1498.366) -- 0:00:37 447500 -- [-1499.845] (-1498.036) (-1497.476) (-1506.273) * [-1496.808] (-1496.769) (-1496.872) (-1498.663) -- 0:00:37 448000 -- (-1499.205) [-1497.885] (-1498.865) (-1501.609) * (-1498.036) (-1496.662) (-1497.318) [-1497.594] -- 0:00:36 448500 -- (-1500.455) (-1497.198) (-1498.748) [-1498.317] * (-1501.117) (-1497.226) (-1499.039) [-1497.822] -- 0:00:36 449000 -- (-1499.586) (-1496.956) [-1497.261] (-1498.776) * (-1498.121) (-1497.594) (-1499.794) [-1498.524] -- 0:00:36 449500 -- [-1499.535] (-1498.394) (-1498.261) (-1500.339) * (-1498.600) (-1499.204) (-1501.610) [-1498.122] -- 0:00:36 450000 -- (-1497.374) [-1499.070] (-1497.010) (-1504.499) * (-1498.776) [-1498.308] (-1499.788) (-1497.816) -- 0:00:36 Average standard deviation of split frequencies: 0.015458 450500 -- [-1498.170] (-1500.170) (-1499.246) (-1502.443) * (-1496.723) (-1498.738) (-1499.774) [-1497.061] -- 0:00:36 451000 -- [-1499.434] (-1497.887) (-1500.107) (-1499.942) * (-1498.397) (-1501.345) (-1501.712) [-1496.901] -- 0:00:36 451500 -- (-1498.463) [-1498.190] (-1498.304) (-1498.843) * (-1499.864) (-1502.596) (-1498.284) [-1498.464] -- 0:00:36 452000 -- (-1498.290) (-1498.794) (-1499.334) [-1497.851] * (-1498.466) [-1499.624] (-1497.839) (-1501.200) -- 0:00:36 452500 -- (-1500.014) [-1498.393] (-1501.749) (-1498.017) * (-1499.463) (-1497.754) (-1499.315) [-1498.362] -- 0:00:37 453000 -- (-1499.000) (-1498.811) [-1497.787] (-1496.693) * (-1498.824) [-1497.182] (-1499.767) (-1500.261) -- 0:00:37 453500 -- [-1499.226] (-1497.655) (-1496.603) (-1497.211) * (-1499.341) [-1496.450] (-1496.843) (-1498.954) -- 0:00:37 454000 -- (-1499.769) (-1501.432) (-1496.603) [-1499.080] * [-1497.797] (-1499.892) (-1499.449) (-1501.074) -- 0:00:37 454500 -- (-1497.936) (-1498.797) (-1496.603) [-1496.955] * [-1499.265] (-1498.861) (-1500.527) (-1498.942) -- 0:00:37 455000 -- (-1498.037) [-1503.585] (-1497.800) (-1498.521) * [-1496.738] (-1497.781) (-1497.288) (-1498.321) -- 0:00:37 Average standard deviation of split frequencies: 0.016024 455500 -- [-1501.078] (-1500.165) (-1499.406) (-1497.016) * [-1497.261] (-1498.167) (-1497.075) (-1497.224) -- 0:00:37 456000 -- (-1498.155) [-1499.479] (-1498.909) (-1497.690) * (-1497.308) (-1497.826) (-1496.561) [-1497.940] -- 0:00:36 456500 -- (-1500.381) (-1503.538) [-1496.809] (-1498.596) * (-1498.529) [-1498.607] (-1499.678) (-1497.559) -- 0:00:36 457000 -- (-1500.563) (-1499.406) [-1497.422] (-1498.002) * [-1499.504] (-1501.474) (-1500.669) (-1497.899) -- 0:00:36 457500 -- [-1498.740] (-1497.759) (-1498.476) (-1497.754) * [-1499.325] (-1499.103) (-1496.781) (-1498.080) -- 0:00:36 458000 -- (-1498.651) [-1496.214] (-1501.967) (-1498.461) * [-1497.292] (-1496.587) (-1500.815) (-1497.531) -- 0:00:36 458500 -- (-1500.161) (-1497.690) [-1498.591] (-1499.019) * (-1497.224) (-1498.191) (-1497.146) [-1497.408] -- 0:00:36 459000 -- (-1497.662) (-1499.342) [-1497.387] (-1501.467) * (-1497.292) (-1498.605) [-1496.740] (-1497.468) -- 0:00:36 459500 -- (-1497.675) [-1496.711] (-1499.873) (-1498.773) * (-1497.922) (-1503.401) (-1498.355) [-1498.105] -- 0:00:36 460000 -- [-1496.481] (-1497.077) (-1499.650) (-1496.955) * (-1498.943) (-1499.263) [-1501.478] (-1497.866) -- 0:00:36 Average standard deviation of split frequencies: 0.016259 460500 -- [-1497.629] (-1497.598) (-1497.256) (-1498.372) * (-1496.923) (-1499.232) [-1500.360] (-1499.770) -- 0:00:36 461000 -- (-1500.528) [-1499.130] (-1498.106) (-1497.588) * (-1497.445) [-1496.809] (-1500.741) (-1499.863) -- 0:00:36 461500 -- (-1499.695) (-1498.478) (-1498.547) [-1501.625] * (-1498.453) (-1497.083) (-1496.831) [-1500.243] -- 0:00:36 462000 -- (-1500.040) (-1498.611) (-1499.032) [-1498.387] * (-1499.892) (-1499.836) [-1499.872] (-1502.296) -- 0:00:36 462500 -- (-1502.488) (-1497.338) [-1500.087] (-1498.074) * [-1500.043] (-1497.293) (-1498.987) (-1509.113) -- 0:00:36 463000 -- [-1501.253] (-1497.237) (-1499.094) (-1498.538) * (-1497.431) [-1497.500] (-1499.540) (-1502.013) -- 0:00:35 463500 -- [-1501.660] (-1498.048) (-1498.909) (-1497.708) * (-1497.060) [-1497.714] (-1500.056) (-1497.620) -- 0:00:35 464000 -- [-1500.108] (-1497.047) (-1497.696) (-1498.416) * (-1500.187) (-1498.736) (-1501.036) [-1497.105] -- 0:00:35 464500 -- (-1500.077) [-1496.472] (-1497.069) (-1502.082) * [-1499.887] (-1498.211) (-1496.905) (-1498.349) -- 0:00:35 465000 -- (-1498.856) [-1498.331] (-1500.762) (-1498.449) * [-1500.758] (-1497.310) (-1497.088) (-1497.680) -- 0:00:35 Average standard deviation of split frequencies: 0.015118 465500 -- (-1499.448) (-1500.403) (-1498.559) [-1498.772] * [-1498.020] (-1499.955) (-1497.817) (-1498.903) -- 0:00:35 466000 -- (-1498.510) (-1499.866) (-1500.768) [-1498.388] * (-1500.321) (-1499.663) (-1499.672) [-1497.871] -- 0:00:35 466500 -- (-1498.318) [-1499.750] (-1501.694) (-1498.648) * (-1499.513) [-1500.621] (-1500.695) (-1497.004) -- 0:00:35 467000 -- (-1498.026) (-1499.967) [-1498.020] (-1499.228) * (-1499.689) (-1498.457) [-1501.050] (-1497.961) -- 0:00:35 467500 -- (-1501.106) (-1504.667) [-1499.217] (-1497.048) * (-1500.028) (-1499.927) [-1498.669] (-1498.414) -- 0:00:35 468000 -- (-1499.016) (-1498.544) (-1498.859) [-1498.014] * (-1500.989) [-1498.790] (-1497.418) (-1498.486) -- 0:00:35 468500 -- (-1501.105) [-1498.291] (-1499.132) (-1497.646) * [-1499.386] (-1499.908) (-1497.389) (-1497.385) -- 0:00:36 469000 -- [-1501.291] (-1498.979) (-1503.943) (-1498.037) * (-1500.171) (-1500.762) [-1496.729] (-1496.746) -- 0:00:36 469500 -- [-1499.175] (-1499.580) (-1498.582) (-1500.346) * [-1501.845] (-1502.829) (-1497.188) (-1499.305) -- 0:00:36 470000 -- [-1499.935] (-1496.951) (-1498.394) (-1503.649) * (-1500.666) (-1504.854) (-1499.899) [-1497.651] -- 0:00:36 Average standard deviation of split frequencies: 0.015524 470500 -- (-1498.058) (-1496.751) (-1497.887) [-1498.198] * [-1500.390] (-1501.827) (-1500.911) (-1498.454) -- 0:00:36 471000 -- (-1499.562) (-1496.518) [-1499.411] (-1500.393) * (-1499.919) [-1502.429] (-1499.306) (-1498.143) -- 0:00:35 471500 -- (-1496.675) (-1498.511) [-1500.283] (-1499.389) * (-1500.383) (-1508.951) [-1499.129] (-1499.331) -- 0:00:35 472000 -- (-1497.035) (-1498.253) (-1497.634) [-1500.666] * (-1499.174) (-1504.393) [-1498.034] (-1498.600) -- 0:00:35 472500 -- (-1498.014) (-1498.652) [-1499.583] (-1499.566) * (-1500.955) [-1500.204] (-1499.044) (-1498.662) -- 0:00:35 473000 -- [-1499.231] (-1499.957) (-1497.281) (-1499.491) * (-1502.722) (-1501.763) (-1503.145) [-1501.105] -- 0:00:35 473500 -- (-1497.071) [-1498.123] (-1499.587) (-1500.715) * (-1501.014) (-1500.924) (-1497.337) [-1498.440] -- 0:00:35 474000 -- (-1499.848) (-1498.116) (-1499.770) [-1497.062] * (-1505.739) (-1499.220) (-1499.317) [-1498.185] -- 0:00:35 474500 -- (-1497.304) (-1498.196) [-1497.420] (-1496.705) * (-1499.836) (-1497.916) (-1497.521) [-1500.199] -- 0:00:35 475000 -- (-1497.781) (-1500.482) [-1501.024] (-1496.474) * (-1500.782) [-1496.679] (-1496.266) (-1498.558) -- 0:00:35 Average standard deviation of split frequencies: 0.015350 475500 -- (-1498.771) [-1499.034] (-1496.863) (-1496.460) * [-1499.106] (-1498.109) (-1501.129) (-1499.932) -- 0:00:35 476000 -- (-1497.343) [-1497.363] (-1498.748) (-1498.446) * (-1500.061) [-1496.652] (-1501.439) (-1498.719) -- 0:00:35 476500 -- (-1497.182) (-1497.635) (-1498.226) [-1505.352] * (-1499.781) [-1501.507] (-1499.076) (-1500.846) -- 0:00:35 477000 -- (-1496.958) (-1498.824) [-1498.302] (-1497.916) * (-1498.214) [-1497.776] (-1498.817) (-1498.074) -- 0:00:35 477500 -- (-1497.400) (-1498.260) [-1496.604] (-1501.567) * (-1498.499) (-1497.040) [-1496.865] (-1502.798) -- 0:00:35 478000 -- [-1497.329] (-1499.679) (-1497.612) (-1498.064) * (-1500.120) [-1496.869] (-1497.611) (-1500.180) -- 0:00:34 478500 -- [-1498.349] (-1497.781) (-149