--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 15:17:23 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/ilvG/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2200.78 -2203.59 2 -2200.77 -2204.70 -------------------------------------- TOTAL -2200.77 -2204.29 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.906250 0.090417 0.379030 1.509456 0.875373 969.22 1214.83 1.000 r(A<->C){all} 0.166851 0.020846 0.000167 0.464270 0.124237 245.52 266.41 1.000 r(A<->G){all} 0.176154 0.020852 0.000021 0.469100 0.140762 232.25 276.29 1.000 r(A<->T){all} 0.164085 0.020475 0.000048 0.457504 0.124951 184.90 218.49 1.003 r(C<->G){all} 0.172264 0.021244 0.000001 0.460649 0.135559 227.80 227.98 1.003 r(C<->T){all} 0.160754 0.018074 0.000002 0.428552 0.126147 228.64 246.62 1.009 r(G<->T){all} 0.159892 0.018989 0.000112 0.437495 0.122270 225.41 244.65 1.000 pi(A){all} 0.152857 0.000077 0.135350 0.169219 0.152715 1177.74 1284.87 1.000 pi(C){all} 0.304234 0.000135 0.280680 0.326066 0.304443 1161.94 1208.60 1.000 pi(G){all} 0.343099 0.000135 0.319804 0.364405 0.342974 1296.38 1307.73 1.000 pi(T){all} 0.199811 0.000096 0.182111 0.219999 0.199767 1232.64 1366.82 1.000 alpha{1,2} 0.426739 0.226033 0.000275 1.390315 0.260436 892.40 1072.60 1.000 alpha{3} 0.459499 0.232838 0.000266 1.422530 0.305887 1014.47 1116.29 1.000 pinvar{all} 0.999127 0.000001 0.997177 0.999998 0.999465 965.56 1022.80 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2132.544888 Model 2: PositiveSelection -2132.544882 Model 0: one-ratio -2132.544911 Model 7: beta -2132.544538 Model 8: beta&w>1 -2132.544538 Model 0 vs 1 4.600000011123484E-5 Model 2 vs 1 1.1999999514955562E-5 Model 8 vs 7 0.0
>C1 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C2 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C3 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C4 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C5 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C6 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=548 C1 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C2 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C3 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C4 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C5 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C6 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR ************************************************** C1 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C2 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C3 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C4 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C5 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C6 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS ************************************************** C1 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C2 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C3 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C4 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C5 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C6 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ************************************************** C1 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C2 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C3 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C4 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C5 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C6 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL ************************************************** C1 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C2 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C3 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C4 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C5 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C6 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV ************************************************** C1 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C2 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C3 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C4 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C5 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C6 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD ************************************************** C1 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C2 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C3 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C4 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C5 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C6 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR ************************************************** C1 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C2 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C3 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C4 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C5 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C6 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS ************************************************** C1 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C2 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C3 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C4 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C5 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C6 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW ************************************************** C1 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C2 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C3 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C4 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C5 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C6 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ************************************************** C1 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C2 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C3 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C4 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C5 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C6 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA ************************************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 548 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 548 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [16440] Library Relaxation: Multi_proc [96] Relaxation Summary: [16440]--->[16440] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.573 Mb, Max= 31.156 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C2 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C3 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C4 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C5 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR C6 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR ************************************************** C1 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C2 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C3 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C4 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C5 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS C6 LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS ************************************************** C1 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C2 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C3 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C4 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C5 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE C6 PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ************************************************** C1 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C2 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C3 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C4 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C5 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL C6 ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL ************************************************** C1 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C2 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C3 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C4 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C5 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV C6 DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV ************************************************** C1 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C2 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C3 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C4 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C5 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD C6 VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD ************************************************** C1 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C2 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C3 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C4 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C5 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR C6 RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR ************************************************** C1 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C2 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C3 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C4 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C5 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS C6 DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS ************************************************** C1 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C2 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C3 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C4 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C5 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW C6 YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW ************************************************** C1 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C2 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C3 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C4 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C5 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR C6 DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ************************************************** C1 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C2 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C3 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C4 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C5 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA C6 ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA ************************************************ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT C2 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT C3 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT C4 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT C5 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT C6 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT ************************************************** C1 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG C2 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG C3 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG C4 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG C5 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG C6 CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG ************************************************** C1 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG C2 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG C3 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG C4 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG C5 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG C6 GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG ************************************************** C1 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG C2 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG C3 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG C4 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG C5 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG C6 CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG ************************************************** C1 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG C2 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG C3 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG C4 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG C5 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG C6 GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG ************************************************** C1 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG C2 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG C3 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG C4 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG C5 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG C6 GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG ************************************************** C1 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG C2 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG C3 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG C4 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG C5 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG C6 CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG ************************************************** C1 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT C2 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT C3 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT C4 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT C5 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT C6 CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT ************************************************** C1 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA C2 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA C3 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA C4 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA C5 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA C6 TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA ************************************************** C1 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT C2 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT C3 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT C4 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT C5 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT C6 GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT ************************************************** C1 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG C2 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG C3 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG C4 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG C5 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG C6 CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG ************************************************** C1 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG C2 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG C3 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG C4 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG C5 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG C6 GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG ************************************************** C1 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC C2 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC C3 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC C4 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC C5 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC C6 GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC ************************************************** C1 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG C2 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG C3 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG C4 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG C5 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG C6 CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG ************************************************** C1 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA C2 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA C3 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA C4 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA C5 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA C6 CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA ************************************************** C1 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT C2 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT C3 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT C4 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT C5 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT C6 GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT ************************************************** C1 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC C2 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC C3 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC C4 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC C5 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC C6 GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC ************************************************** C1 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC C2 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC C3 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC C4 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC C5 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC C6 TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC ************************************************** C1 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA C2 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA C3 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA C4 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA C5 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA C6 CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA ************************************************** C1 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG C2 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG C3 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG C4 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG C5 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG C6 CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ************************************************** C1 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT C2 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT C3 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT C4 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT C5 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT C6 ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT ************************************************** C1 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT C2 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT C3 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT C4 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT C5 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT C6 GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT ************************************************** C1 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG C2 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG C3 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG C4 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG C5 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG C6 GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG ************************************************** C1 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC C2 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC C3 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC C4 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC C5 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC C6 TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC ************************************************** C1 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC C2 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC C3 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC C4 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC C5 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC C6 TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC ************************************************** C1 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG C2 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG C3 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG C4 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG C5 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG C6 GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG ************************************************** C1 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG C2 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG C3 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG C4 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG C5 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG C6 TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG ************************************************** C1 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA C2 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA C3 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA C4 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA C5 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA C6 GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA ************************************************** C1 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT C2 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT C3 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT C4 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT C5 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT C6 CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT ************************************************** C1 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT C2 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT C3 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT C4 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT C5 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT C6 CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT ************************************************** C1 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC C2 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC C3 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC C4 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC C5 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC C6 GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC ************************************************** C1 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC C2 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC C3 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC C4 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC C5 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC C6 TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC ************************************************** C1 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT C2 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT C3 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT C4 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT C5 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT C6 TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT ******************************************** >C1 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C2 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C3 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C4 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C5 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C6 ATGAGCACCGACCCTGTCCTGACCCACAGCATTCACGCCGGCCGGCTCGT CGTACGTCGACTCAAAGCCAGCGGTGTCGACACCGTCTTTACGTTGTCAG GTGGGCATCTATTTTCCATTTACGACGGTTGCCGTAGCGAGAGTATCAGG CTCATAGACACGCGCCACGAGCAGACAGCGGCCTTCGCCGCCGAGGGTTG GTCGAAAGTGACCAGGCAGCCAGGTGTGGCTGTACTAACCGCGGGGCCGG GCGTCACCAACGGTATGAGCGCGATGGCGGCGGCGCAGCAGAACCAGTCG CCGCTGGTAGTGCTCGGCGGCCGAGCACCCGCACTGCGATGGGGTATGGG CTCGTTACAGGAGATTGATCACGTGCCGTTCGTGGCTCCGCTAGCCCGTT TCGCCGCCACCGCACAGTCGGCGGATGCCGCCGGCCGGCTTGTCGACGAA GCATTGCAGGCCGCGGTGGTTGCCCCGTCCGGAGTGGGTTTCGTTGATTT CCCGATGGACTATGTGTTTTCCATGGCTGACGACGTTGGCGGTGGTCCTG GCGCTTTGGCCAACTTGCCTGTGGCTCCCGCTGCCAACCCCGAAGCCCTG GACCGGGCTGCCGGCCTGTTAGCCGCGGCGCACCGGCCGGTGATCATGGC CGGGACCAACGTCTGGTGGGGGCACGCCGAGGCCGCGCTACTACGTCTAG CCGAGGAATGCCAGATCCCTGTGCTGATGAACGGAATGGCACGCGGCGTA GTGCCCGCCGACCACCCGTTGGCTTTCTCGCGGGCGCGGGGAAAAGCATT GGGTGAGGCAGATGTGGCACTGGTTGTTGGGGTGCCGATGGATTTCCGGC TGGGCTTCGGCAAGGTGTTCGGGTCACAAACACAGCTCGTGGTGGCGGAC CGTGCTGAACCCGATCGCGACTATCCGCGACCCGTCGCGGCCGGGCTCTA CGGAGATTTGCCAGCTATTCTCTCGGCGTTGGCTGGAGTCGGTGGGACCG ACAGTCAGGACTGGATCCGCGCGCTGCGGACGGCCGAGACCGCCACGCGT GACCTTGAGAAAGCTGAACTGGACGACGACCGGCTCCCGCTGCACCCGAT GCGGGTGTACGCTGAGCTCGCGTCGCTGCTGGACCGCGACGCGATTGTCG TGATCGACGCCGGTGATTTCGGGTCTTATGCCGGCCGGGTGATCGACAGC TATCTACCGGGTTGCTGGTTGGACAGCGGGCCGTTCGGTTGCCTGGGTTC GGGCCCTGGCTACGCTCTGGCCGCTAAACTCGCCCGGCCCAACCGTCAAG TTGTCCTGCTGCAGGGCGACGGCGCGTTTGGCTTCAGCGGCATGGAATGG GACACTCTGGTTCGGCACAATGTTCCCGTCGTGTCGGTGATCGGCAACAA CGGGATCTGGGGCTTAGAGAAACACCCGATGGAAGCGTTGTACGGCTACT CGGTGGTAGCGGAACTCCGCCCGGGTACTCGCTACGACGAGGTGGTTCGT GCCCTCGGCGGTCACGGCGAGCTGGTGTCGGTGCCCGGTGAGCTTCGGCC TGCACTCGAACGTGCTTTCGTCACCGGTCTGCCGTCGGTCGTGAATGTGC TGACCGATCCGAGTGTCGCCTACCCTCGCCGGTCCAACCTGGCT >C1 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C2 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C3 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C4 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C5 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA >C6 MSTDPVLTHSIHAGRLVVRRLKASGVDTVFTLSGGHLFSIYDGCRSESIR LIDTRHEQTAAFAAEGWSKVTRQPGVAVLTAGPGVTNGMSAMAAAQQNQS PLVVLGGRAPALRWGMGSLQEIDHVPFVAPLARFAATAQSADAAGRLVDE ALQAAVVAPSGVGFVDFPMDYVFSMADDVGGGPGALANLPVAPAANPEAL DRAAGLLAAAHRPVIMAGTNVWWGHAEAALLRLAEECQIPVLMNGMARGV VPADHPLAFSRARGKALGEADVALVVGVPMDFRLGFGKVFGSQTQLVVAD RAEPDRDYPRPVAAGLYGDLPAILSALAGVGGTDSQDWIRALRTAETATR DLEKAELDDDRLPLHPMRVYAELASLLDRDAIVVIDAGDFGSYAGRVIDS YLPGCWLDSGPFGCLGSGPGYALAAKLARPNRQVVLLQGDGAFGFSGMEW DTLVRHNVPVVSVIGNNGIWGLEKHPMEALYGYSVVAELRPGTRYDEVVR ALGGHGELVSVPGELRPALERAFVTGLPSVVNVLTDPSVAYPRRSNLA MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1644 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579792558 Setting output file names to "/data/2res/ilvG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 134475056 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0871805560 Seed = 1862244144 Swapseed = 1579792558 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -3679.350594 -- -24.965149 Chain 2 -- -3679.350807 -- -24.965149 Chain 3 -- -3679.350247 -- -24.965149 Chain 4 -- -3679.350247 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -3679.350807 -- -24.965149 Chain 2 -- -3679.350247 -- -24.965149 Chain 3 -- -3679.350247 -- -24.965149 Chain 4 -- -3679.350807 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-3679.351] (-3679.351) (-3679.350) (-3679.350) * [-3679.351] (-3679.350) (-3679.350) (-3679.351) 500 -- [-2220.887] (-2259.189) (-2277.477) (-2223.796) * [-2225.461] (-2240.044) (-2277.958) (-2255.320) -- 0:00:00 1000 -- (-2217.369) (-2214.114) [-2215.250] (-2207.562) * (-2214.127) (-2215.268) [-2214.913] (-2212.966) -- 0:00:00 1500 -- [-2205.346] (-2216.010) (-2207.832) (-2216.537) * [-2204.469] (-2204.712) (-2213.284) (-2214.095) -- 0:00:00 2000 -- (-2212.613) [-2212.573] (-2208.136) (-2209.485) * (-2210.784) [-2215.074] (-2216.726) (-2215.238) -- 0:00:00 2500 -- (-2217.473) [-2207.487] (-2210.910) (-2210.262) * [-2212.435] (-2213.191) (-2210.737) (-2207.824) -- 0:00:00 3000 -- [-2207.438] (-2211.872) (-2209.883) (-2213.118) * (-2206.286) (-2211.665) (-2212.231) [-2208.579] -- 0:00:00 3500 -- (-2215.160) [-2208.061] (-2213.073) (-2215.784) * (-2210.863) [-2209.900] (-2221.416) (-2210.161) -- 0:00:00 4000 -- (-2210.011) (-2211.070) [-2215.709] (-2208.173) * (-2206.416) (-2210.569) (-2212.063) [-2206.765] -- 0:00:00 4500 -- (-2210.320) (-2213.152) (-2223.594) [-2207.686] * (-2213.326) (-2211.399) [-2216.391] (-2211.926) -- 0:00:00 5000 -- (-2212.678) (-2212.279) (-2213.544) [-2208.676] * (-2210.902) (-2208.787) [-2206.552] (-2212.588) -- 0:03:19 Average standard deviation of split frequencies: 0.102138 5500 -- (-2211.152) (-2214.143) [-2206.334] (-2210.423) * (-2211.084) [-2211.992] (-2212.249) (-2210.050) -- 0:03:00 6000 -- [-2207.792] (-2216.607) (-2208.998) (-2211.137) * (-2214.626) (-2208.355) [-2208.572] (-2214.022) -- 0:02:45 6500 -- [-2206.897] (-2206.361) (-2214.411) (-2214.504) * (-2213.754) [-2207.491] (-2220.513) (-2210.639) -- 0:02:32 7000 -- (-2212.286) (-2201.963) (-2205.411) [-2207.356] * (-2210.095) [-2210.177] (-2207.327) (-2214.031) -- 0:02:21 7500 -- (-2212.656) (-2201.175) [-2206.237] (-2216.109) * (-2211.949) (-2213.682) [-2208.398] (-2213.485) -- 0:02:12 8000 -- (-2208.985) (-2201.915) [-2221.953] (-2209.450) * (-2209.247) (-2210.157) (-2209.623) [-2217.084] -- 0:02:04 8500 -- [-2211.496] (-2202.211) (-2223.275) (-2208.646) * (-2214.045) [-2210.328] (-2206.295) (-2216.568) -- 0:01:56 9000 -- (-2212.045) [-2202.211] (-2211.910) (-2215.557) * (-2213.078) (-2209.926) [-2210.202] (-2220.088) -- 0:01:50 9500 -- (-2208.115) [-2202.452] (-2215.438) (-2209.973) * (-2206.263) (-2217.284) [-2205.434] (-2212.929) -- 0:01:44 10000 -- [-2204.572] (-2203.606) (-2205.797) (-2215.729) * (-2206.276) (-2213.341) [-2207.728] (-2208.023) -- 0:01:39 Average standard deviation of split frequencies: 0.063409 10500 -- (-2214.964) (-2203.787) [-2201.328] (-2214.098) * (-2209.847) (-2218.401) (-2209.040) [-2206.293] -- 0:01:34 11000 -- (-2211.396) (-2205.215) [-2201.068] (-2206.787) * (-2209.191) [-2206.959] (-2204.456) (-2213.141) -- 0:01:29 11500 -- [-2208.934] (-2200.590) (-2203.849) (-2214.710) * [-2211.914] (-2209.546) (-2211.073) (-2215.097) -- 0:01:25 12000 -- (-2214.032) (-2200.297) [-2204.431] (-2211.094) * (-2205.627) [-2204.756] (-2212.037) (-2215.786) -- 0:01:22 12500 -- [-2213.473] (-2201.106) (-2200.409) (-2208.483) * (-2207.223) [-2209.048] (-2211.334) (-2208.919) -- 0:01:19 13000 -- [-2207.848] (-2200.187) (-2200.611) (-2207.506) * [-2207.283] (-2209.417) (-2209.373) (-2217.489) -- 0:01:15 13500 -- (-2210.687) [-2199.569] (-2202.395) (-2208.004) * (-2214.243) (-2207.419) [-2211.147] (-2210.385) -- 0:01:13 14000 -- (-2208.649) (-2201.127) [-2201.902] (-2208.934) * (-2202.628) [-2209.746] (-2212.429) (-2214.409) -- 0:01:10 14500 -- [-2208.989] (-2199.699) (-2199.371) (-2204.413) * (-2203.368) (-2205.661) (-2214.246) [-2206.786] -- 0:01:07 15000 -- (-2217.558) (-2199.967) (-2199.444) [-2205.776] * (-2201.712) [-2210.010] (-2212.146) (-2209.563) -- 0:01:05 Average standard deviation of split frequencies: 0.060399 15500 -- (-2213.988) (-2200.000) [-2199.767] (-2205.022) * (-2200.755) (-2209.226) (-2215.022) [-2217.054] -- 0:01:03 16000 -- (-2203.654) (-2199.779) (-2200.738) [-2208.823] * [-2202.094] (-2204.136) (-2208.037) (-2211.075) -- 0:01:01 16500 -- (-2201.643) (-2200.751) (-2202.336) [-2209.566] * (-2200.690) (-2208.070) (-2214.987) [-2203.704] -- 0:00:59 17000 -- (-2201.318) (-2202.617) [-2199.859] (-2214.694) * (-2201.497) [-2206.460] (-2213.752) (-2210.736) -- 0:00:57 17500 -- (-2201.140) (-2202.494) (-2201.736) [-2211.423] * (-2201.212) (-2206.565) [-2211.495] (-2210.191) -- 0:01:52 18000 -- (-2202.058) (-2200.670) (-2204.010) [-2210.027] * [-2200.451] (-2202.870) (-2213.167) (-2216.053) -- 0:01:49 18500 -- (-2204.169) (-2200.737) (-2205.198) [-2205.685] * (-2200.125) (-2203.241) (-2210.474) [-2209.976] -- 0:01:46 19000 -- (-2200.291) [-2199.703] (-2203.609) (-2206.109) * (-2203.071) (-2207.169) [-2215.419] (-2209.540) -- 0:01:43 19500 -- [-2200.181] (-2199.683) (-2203.378) (-2209.863) * (-2201.222) (-2205.727) [-2200.894] (-2210.352) -- 0:01:40 20000 -- [-2200.226] (-2201.473) (-2203.311) (-2206.160) * (-2202.285) (-2205.275) [-2202.825] (-2205.157) -- 0:01:38 Average standard deviation of split frequencies: 0.050422 20500 -- (-2200.478) (-2200.641) (-2201.676) [-2209.838] * (-2200.743) [-2204.376] (-2199.784) (-2202.780) -- 0:01:35 21000 -- (-2201.239) (-2202.516) (-2201.650) [-2216.608] * [-2200.893] (-2203.051) (-2199.479) (-2203.370) -- 0:01:33 21500 -- (-2200.602) (-2202.408) (-2201.963) [-2212.016] * [-2200.676] (-2202.709) (-2199.505) (-2202.820) -- 0:01:31 22000 -- (-2201.318) (-2202.048) (-2201.102) [-2205.369] * (-2202.379) (-2202.601) [-2199.486] (-2201.988) -- 0:01:28 22500 -- (-2199.510) (-2200.641) [-2203.587] (-2214.245) * (-2203.115) [-2203.054] (-2200.424) (-2202.554) -- 0:01:26 23000 -- [-2199.307] (-2202.427) (-2201.622) (-2209.151) * (-2200.738) (-2202.872) (-2201.841) [-2203.126] -- 0:01:24 23500 -- (-2204.233) (-2203.078) (-2203.704) [-2212.391] * (-2202.618) (-2201.139) [-2200.254] (-2202.698) -- 0:01:23 24000 -- (-2204.562) (-2204.198) (-2202.497) [-2214.567] * (-2203.664) (-2200.175) [-2199.392] (-2201.626) -- 0:01:21 24500 -- (-2203.490) (-2200.897) [-2202.884] (-2218.107) * (-2200.250) (-2200.781) (-2200.149) [-2200.904] -- 0:01:19 25000 -- (-2204.821) (-2200.496) [-2201.818] (-2214.818) * (-2206.618) (-2199.908) [-2200.865] (-2200.093) -- 0:01:18 Average standard deviation of split frequencies: 0.042608 25500 -- [-2201.769] (-2200.854) (-2201.565) (-2206.864) * (-2203.077) (-2200.174) [-2201.113] (-2200.916) -- 0:01:16 26000 -- [-2201.719] (-2200.675) (-2201.629) (-2206.849) * (-2204.576) (-2199.319) (-2200.379) [-2199.281] -- 0:01:14 26500 -- (-2204.637) (-2200.732) [-2202.375] (-2207.022) * (-2209.298) [-2199.578] (-2200.329) (-2199.495) -- 0:01:13 27000 -- [-2200.718] (-2201.587) (-2204.187) (-2206.777) * (-2202.370) (-2199.478) (-2200.583) [-2199.324] -- 0:01:12 27500 -- (-2200.011) [-2201.476] (-2202.132) (-2201.932) * (-2200.547) (-2206.725) (-2199.759) [-2199.569] -- 0:01:10 28000 -- (-2204.980) (-2201.975) [-2201.620] (-2201.265) * (-2200.818) (-2200.973) (-2200.550) [-2200.062] -- 0:01:09 28500 -- (-2204.152) (-2203.280) [-2204.209] (-2199.363) * (-2199.815) (-2200.997) (-2200.542) [-2199.810] -- 0:01:08 29000 -- [-2202.585] (-2202.784) (-2202.495) (-2200.246) * (-2200.639) (-2201.676) [-2200.638] (-2200.987) -- 0:01:06 29500 -- (-2202.720) (-2200.389) [-2200.533] (-2205.625) * [-2199.599] (-2200.859) (-2201.253) (-2201.078) -- 0:01:05 30000 -- [-2199.268] (-2200.837) (-2202.376) (-2202.422) * [-2199.953] (-2200.290) (-2203.409) (-2201.684) -- 0:01:04 Average standard deviation of split frequencies: 0.031512 30500 -- (-2201.165) [-2200.025] (-2202.929) (-2200.033) * (-2200.070) [-2199.877] (-2205.526) (-2206.279) -- 0:01:03 31000 -- (-2200.813) (-2200.321) [-2200.934] (-2199.289) * (-2200.004) [-2201.130] (-2204.148) (-2207.877) -- 0:01:02 31500 -- (-2199.340) (-2200.579) (-2200.792) [-2199.289] * (-2201.469) [-2199.415] (-2201.094) (-2201.476) -- 0:01:01 32000 -- (-2199.366) [-2201.140] (-2202.358) (-2200.620) * [-2199.356] (-2199.992) (-2204.264) (-2202.751) -- 0:01:30 32500 -- (-2201.075) (-2200.802) [-2202.635] (-2200.713) * (-2202.659) (-2201.056) [-2200.354] (-2201.459) -- 0:01:29 33000 -- (-2206.259) (-2200.887) (-2201.897) [-2200.342] * (-2201.450) [-2200.761] (-2200.498) (-2201.515) -- 0:01:27 33500 -- (-2206.664) (-2200.904) [-2201.899] (-2199.530) * [-2201.831] (-2200.884) (-2200.586) (-2202.910) -- 0:01:26 34000 -- (-2202.805) (-2201.354) [-2200.937] (-2199.470) * [-2200.964] (-2199.917) (-2199.916) (-2203.975) -- 0:01:25 34500 -- (-2200.394) (-2202.451) [-2201.007] (-2201.777) * [-2201.763] (-2203.316) (-2201.218) (-2201.121) -- 0:01:23 35000 -- [-2203.463] (-2202.760) (-2201.084) (-2200.982) * (-2201.735) (-2202.555) [-2199.862] (-2200.269) -- 0:01:22 Average standard deviation of split frequencies: 0.032392 35500 -- (-2200.708) (-2202.012) [-2200.592] (-2202.253) * [-2201.115] (-2202.685) (-2199.783) (-2199.905) -- 0:01:21 36000 -- (-2201.390) (-2202.427) [-2204.334] (-2200.800) * (-2200.307) (-2202.284) [-2200.704] (-2199.905) -- 0:01:20 36500 -- (-2202.799) (-2203.079) [-2203.912] (-2203.942) * (-2200.248) (-2203.498) (-2201.999) [-2200.351] -- 0:01:19 37000 -- [-2201.819] (-2203.406) (-2200.900) (-2204.423) * (-2200.169) (-2202.613) (-2202.099) [-2199.977] -- 0:01:18 37500 -- (-2202.585) (-2200.042) [-2200.848] (-2205.038) * (-2203.929) (-2202.387) [-2202.137] (-2201.541) -- 0:01:17 38000 -- (-2201.923) [-2199.424] (-2202.260) (-2202.980) * (-2200.333) (-2204.878) [-2201.721] (-2200.527) -- 0:01:15 38500 -- (-2199.316) (-2202.140) [-2200.826] (-2202.874) * (-2200.765) [-2200.401] (-2203.839) (-2202.641) -- 0:01:14 39000 -- [-2199.316] (-2204.139) (-2203.813) (-2201.423) * [-2200.655] (-2200.972) (-2201.175) (-2199.410) -- 0:01:13 39500 -- [-2199.795] (-2205.135) (-2202.566) (-2201.238) * [-2200.659] (-2201.469) (-2201.638) (-2199.554) -- 0:01:12 40000 -- (-2201.412) (-2205.873) (-2202.144) [-2200.448] * [-2203.147] (-2205.581) (-2200.281) (-2199.295) -- 0:01:12 Average standard deviation of split frequencies: 0.037503 40500 -- (-2203.042) (-2202.182) [-2203.210] (-2200.231) * (-2206.547) (-2201.427) (-2200.562) [-2199.295] -- 0:01:11 41000 -- (-2201.320) [-2202.765] (-2203.646) (-2200.580) * (-2203.217) (-2200.965) [-2201.267] (-2199.295) -- 0:01:10 41500 -- (-2201.068) [-2202.792] (-2204.819) (-2201.216) * (-2203.119) (-2201.341) (-2200.465) [-2199.644] -- 0:01:09 42000 -- (-2199.916) [-2202.236] (-2206.602) (-2200.337) * [-2200.231] (-2200.106) (-2199.898) (-2200.861) -- 0:01:08 42500 -- [-2199.855] (-2204.258) (-2204.672) (-2201.470) * (-2200.680) [-2200.106] (-2200.741) (-2200.599) -- 0:01:07 43000 -- (-2200.004) (-2201.546) (-2201.889) [-2202.272] * (-2200.765) (-2200.936) (-2200.000) [-2200.166] -- 0:01:06 43500 -- (-2200.003) (-2202.173) (-2203.145) [-2203.656] * [-2206.414] (-2205.870) (-2200.224) (-2200.337) -- 0:01:05 44000 -- [-2200.124] (-2202.778) (-2204.839) (-2201.669) * (-2204.162) (-2202.716) [-2200.765] (-2199.291) -- 0:01:05 44500 -- (-2202.159) (-2202.477) (-2204.662) [-2201.970] * (-2203.360) [-2199.947] (-2200.772) (-2201.729) -- 0:01:04 45000 -- (-2200.110) (-2202.607) (-2203.797) [-2205.775] * (-2202.525) [-2200.702] (-2202.395) (-2204.387) -- 0:01:03 Average standard deviation of split frequencies: 0.035598 45500 -- [-2199.864] (-2202.562) (-2199.974) (-2205.347) * (-2201.142) (-2200.505) [-2202.626] (-2199.916) -- 0:01:02 46000 -- (-2202.459) (-2202.157) (-2201.277) [-2203.148] * (-2202.529) (-2200.036) (-2207.238) [-2199.379] -- 0:01:22 46500 -- (-2203.052) (-2202.171) [-2201.279] (-2202.080) * [-2202.086] (-2200.224) (-2200.819) (-2200.162) -- 0:01:22 47000 -- (-2201.987) (-2201.739) [-2201.281] (-2199.208) * [-2201.761] (-2200.507) (-2200.293) (-2200.400) -- 0:01:21 47500 -- (-2200.787) (-2202.993) [-2199.539] (-2199.436) * (-2200.639) (-2202.651) [-2199.768] (-2201.833) -- 0:01:20 48000 -- (-2200.519) (-2210.760) [-2201.712] (-2200.845) * (-2201.648) (-2206.629) [-2200.544] (-2205.433) -- 0:01:19 48500 -- (-2201.345) [-2207.308] (-2205.439) (-2200.780) * (-2201.648) (-2205.614) [-2200.661] (-2203.488) -- 0:01:18 49000 -- (-2200.374) [-2202.564] (-2200.579) (-2202.735) * (-2202.855) (-2204.701) (-2203.402) [-2203.353] -- 0:01:17 49500 -- (-2200.374) (-2200.274) [-2200.579] (-2202.753) * (-2203.264) (-2202.148) (-2203.935) [-2201.139] -- 0:01:16 50000 -- (-2200.891) (-2199.270) (-2200.136) [-2202.549] * (-2202.342) (-2201.868) [-2200.853] (-2201.451) -- 0:01:16 Average standard deviation of split frequencies: 0.035821 50500 -- (-2202.138) (-2199.683) [-2199.480] (-2202.350) * (-2203.038) (-2201.881) (-2200.765) [-2201.706] -- 0:01:15 51000 -- (-2200.131) (-2201.867) (-2201.549) [-2201.113] * (-2203.630) (-2200.075) (-2202.982) [-2201.215] -- 0:01:14 51500 -- (-2200.429) (-2200.294) (-2201.052) [-2201.113] * (-2202.567) (-2201.395) [-2200.860] (-2202.609) -- 0:01:13 52000 -- [-2200.428] (-2203.221) (-2199.970) (-2201.317) * [-2201.389] (-2201.791) (-2200.088) (-2200.896) -- 0:01:12 52500 -- (-2200.433) (-2202.034) [-2201.023] (-2201.987) * (-2204.862) (-2201.103) [-2200.470] (-2200.517) -- 0:01:12 53000 -- [-2201.967] (-2201.477) (-2200.560) (-2201.376) * (-2204.974) (-2202.144) (-2206.700) [-2200.537] -- 0:01:11 53500 -- (-2202.825) (-2200.860) (-2200.846) [-2201.883] * [-2202.047] (-2200.408) (-2207.254) (-2199.737) -- 0:01:10 54000 -- [-2204.097] (-2200.724) (-2200.761) (-2202.751) * (-2201.817) (-2200.032) (-2206.737) [-2199.734] -- 0:01:10 54500 -- (-2199.699) (-2203.741) (-2199.950) [-2203.364] * (-2201.293) [-2200.048] (-2204.914) (-2199.619) -- 0:01:09 55000 -- (-2199.651) [-2204.455] (-2200.528) (-2203.593) * [-2200.904] (-2200.203) (-2206.796) (-2200.180) -- 0:01:08 Average standard deviation of split frequencies: 0.036773 55500 -- (-2200.746) [-2200.639] (-2201.763) (-2202.932) * [-2202.819] (-2200.301) (-2202.396) (-2200.016) -- 0:01:08 56000 -- (-2199.632) [-2203.038] (-2200.408) (-2201.513) * (-2201.058) [-2200.012] (-2203.195) (-2202.011) -- 0:01:07 56500 -- (-2204.970) [-2200.068] (-2204.384) (-2201.402) * [-2201.058] (-2200.004) (-2206.123) (-2203.508) -- 0:01:06 57000 -- (-2208.290) (-2200.155) [-2203.070] (-2204.197) * (-2200.604) (-2200.060) (-2203.999) [-2201.965] -- 0:01:06 57500 -- (-2205.916) (-2206.867) [-2202.081] (-2203.980) * (-2202.192) (-2200.114) [-2201.303] (-2202.265) -- 0:01:05 58000 -- (-2203.359) [-2207.972] (-2202.081) (-2201.739) * (-2204.263) (-2200.887) (-2202.791) [-2201.421] -- 0:01:04 58500 -- (-2201.694) [-2203.051] (-2203.856) (-2202.281) * [-2202.640] (-2204.048) (-2202.262) (-2202.095) -- 0:01:04 59000 -- [-2199.557] (-2201.301) (-2202.071) (-2205.582) * [-2202.737] (-2204.006) (-2201.421) (-2202.298) -- 0:01:03 59500 -- (-2200.460) [-2201.500] (-2202.842) (-2208.285) * (-2202.437) (-2204.075) [-2201.296] (-2200.669) -- 0:01:19 60000 -- (-2200.680) [-2203.064] (-2202.482) (-2205.594) * (-2201.693) (-2200.675) [-2201.166] (-2201.672) -- 0:01:18 Average standard deviation of split frequencies: 0.034281 60500 -- (-2202.055) [-2202.484] (-2201.004) (-2205.188) * (-2205.651) [-2202.438] (-2201.536) (-2202.408) -- 0:01:17 61000 -- [-2203.412] (-2200.774) (-2205.888) (-2201.489) * [-2206.832] (-2205.083) (-2202.456) (-2201.153) -- 0:01:16 61500 -- (-2202.467) (-2200.417) (-2204.122) [-2201.514] * [-2202.419] (-2207.461) (-2200.858) (-2199.877) -- 0:01:16 62000 -- (-2203.109) (-2202.037) (-2200.526) [-2202.550] * [-2200.994] (-2205.617) (-2201.538) (-2200.411) -- 0:01:15 62500 -- (-2200.898) (-2201.767) [-2203.249] (-2203.301) * [-2201.181] (-2201.282) (-2201.529) (-2200.159) -- 0:01:15 63000 -- (-2203.942) [-2202.284] (-2202.908) (-2203.139) * (-2202.558) [-2203.143] (-2202.798) (-2203.246) -- 0:01:14 63500 -- (-2201.360) (-2199.755) [-2201.997] (-2202.172) * [-2203.077] (-2202.584) (-2200.185) (-2201.650) -- 0:01:13 64000 -- [-2202.435] (-2199.488) (-2202.202) (-2204.300) * (-2203.709) (-2202.542) (-2201.227) [-2201.871] -- 0:01:13 64500 -- (-2201.885) (-2199.472) [-2202.850] (-2202.552) * (-2203.927) [-2200.808] (-2200.686) (-2202.241) -- 0:01:12 65000 -- [-2202.566] (-2203.279) (-2202.190) (-2203.164) * (-2200.731) (-2201.527) [-2200.917] (-2202.389) -- 0:01:11 Average standard deviation of split frequencies: 0.030074 65500 -- [-2202.009] (-2201.402) (-2202.018) (-2201.365) * [-2201.318] (-2203.742) (-2201.043) (-2204.150) -- 0:01:11 66000 -- (-2204.152) (-2200.729) (-2201.698) [-2199.918] * (-2203.057) (-2202.201) [-2201.444] (-2201.215) -- 0:01:10 66500 -- (-2203.844) (-2201.718) [-2200.304] (-2200.039) * (-2201.777) (-2201.111) (-2202.154) [-2201.635] -- 0:01:10 67000 -- (-2200.129) [-2202.456] (-2200.609) (-2201.875) * (-2201.325) [-2201.304] (-2200.510) (-2200.414) -- 0:01:09 67500 -- [-2200.142] (-2202.421) (-2200.668) (-2202.108) * (-2201.114) (-2200.162) (-2202.231) [-2200.413] -- 0:01:09 68000 -- (-2200.455) (-2200.264) (-2202.825) [-2203.028] * (-2201.444) (-2202.008) (-2199.936) [-2201.099] -- 0:01:08 68500 -- [-2200.527] (-2200.259) (-2200.463) (-2207.531) * (-2200.797) (-2200.888) (-2202.827) [-2201.417] -- 0:01:07 69000 -- [-2199.899] (-2199.873) (-2202.276) (-2199.691) * (-2201.512) [-2203.437] (-2203.213) (-2200.838) -- 0:01:07 69500 -- (-2200.882) (-2200.984) (-2201.121) [-2199.645] * (-2200.407) (-2204.314) [-2202.119] (-2201.404) -- 0:01:06 70000 -- (-2207.506) (-2199.685) (-2203.034) [-2199.667] * (-2202.889) [-2203.909] (-2203.093) (-2202.019) -- 0:01:06 Average standard deviation of split frequencies: 0.026683 70500 -- (-2205.047) [-2200.270] (-2199.982) (-2201.452) * (-2201.316) (-2201.713) (-2202.810) [-2201.915] -- 0:01:05 71000 -- (-2204.654) (-2200.851) (-2201.745) [-2204.263] * (-2201.036) (-2204.909) [-2205.990] (-2202.173) -- 0:01:05 71500 -- (-2203.389) (-2201.279) [-2202.157] (-2200.065) * (-2202.190) (-2200.985) (-2205.152) [-2202.076] -- 0:01:04 72000 -- (-2202.075) [-2201.483] (-2200.864) (-2202.216) * (-2201.976) (-2207.773) [-2204.772] (-2201.421) -- 0:01:04 72500 -- (-2199.591) (-2203.306) [-2199.825] (-2203.866) * (-2203.581) (-2200.126) (-2205.512) [-2200.852] -- 0:01:03 73000 -- (-2200.978) [-2201.623] (-2199.657) (-2201.753) * (-2202.560) (-2200.801) [-2201.885] (-2200.657) -- 0:01:03 73500 -- (-2202.660) [-2201.623] (-2200.607) (-2199.676) * (-2201.572) [-2200.233] (-2200.402) (-2201.650) -- 0:01:15 74000 -- (-2203.727) (-2202.039) (-2203.904) [-2200.246] * (-2200.603) (-2200.026) (-2199.685) [-2201.538] -- 0:01:15 74500 -- (-2199.934) [-2201.571] (-2201.040) (-2202.066) * [-2200.522] (-2202.643) (-2199.864) (-2203.575) -- 0:01:14 75000 -- (-2199.990) [-2202.069] (-2201.990) (-2199.734) * (-2199.893) (-2202.648) [-2199.426] (-2200.646) -- 0:01:14 Average standard deviation of split frequencies: 0.031634 75500 -- (-2202.156) (-2202.703) [-2203.646] (-2199.532) * (-2204.901) (-2207.229) [-2199.515] (-2200.450) -- 0:01:13 76000 -- (-2200.046) (-2204.204) (-2201.966) [-2199.901] * [-2202.346] (-2205.670) (-2199.558) (-2200.354) -- 0:01:12 76500 -- [-2204.106] (-2205.117) (-2203.259) (-2201.459) * (-2202.335) [-2199.750] (-2205.995) (-2200.013) -- 0:01:12 77000 -- (-2201.102) (-2202.018) [-2203.081] (-2201.245) * (-2202.848) [-2201.761] (-2206.578) (-2203.156) -- 0:01:11 77500 -- [-2203.798] (-2201.082) (-2204.049) (-2203.227) * (-2200.971) [-2202.593] (-2204.046) (-2200.604) -- 0:01:11 78000 -- (-2203.804) (-2200.285) [-2200.813] (-2201.533) * (-2200.063) (-2202.706) [-2204.886] (-2200.151) -- 0:01:10 78500 -- [-2203.813] (-2200.681) (-2200.973) (-2201.385) * (-2202.808) (-2201.855) (-2203.044) [-2201.844] -- 0:01:10 79000 -- (-2205.759) (-2200.110) [-2200.135] (-2201.550) * [-2202.901] (-2203.390) (-2203.567) (-2201.650) -- 0:01:09 79500 -- (-2201.083) [-2200.931] (-2200.692) (-2202.290) * (-2205.434) (-2200.636) (-2202.306) [-2201.127] -- 0:01:09 80000 -- [-2203.713] (-2200.549) (-2201.303) (-2199.634) * [-2200.953] (-2200.853) (-2201.493) (-2205.053) -- 0:01:09 Average standard deviation of split frequencies: 0.028927 80500 -- (-2205.948) (-2201.255) (-2201.486) [-2200.428] * (-2201.166) (-2204.092) (-2200.976) [-2201.662] -- 0:01:08 81000 -- (-2202.031) [-2201.336] (-2201.350) (-2199.903) * (-2201.154) (-2203.929) [-2204.398] (-2202.653) -- 0:01:08 81500 -- (-2199.780) (-2205.752) [-2201.791] (-2200.355) * (-2200.890) (-2205.206) [-2202.710] (-2205.692) -- 0:01:07 82000 -- (-2202.637) [-2202.166] (-2203.795) (-2200.157) * [-2204.587] (-2203.738) (-2201.824) (-2202.109) -- 0:01:07 82500 -- (-2203.270) (-2203.078) (-2200.421) [-2200.157] * (-2203.255) [-2200.752] (-2200.587) (-2205.417) -- 0:01:06 83000 -- (-2203.489) (-2201.725) (-2202.202) [-2201.555] * [-2202.792] (-2203.094) (-2201.367) (-2203.944) -- 0:01:06 83500 -- (-2201.961) (-2201.496) [-2201.726] (-2200.719) * (-2202.077) (-2205.013) [-2201.583] (-2201.599) -- 0:01:05 84000 -- (-2199.335) (-2203.786) [-2200.666] (-2200.638) * (-2200.513) [-2205.069] (-2202.707) (-2202.418) -- 0:01:05 84500 -- (-2199.418) (-2201.859) (-2201.591) [-2201.277] * [-2200.790] (-2204.881) (-2201.198) (-2201.923) -- 0:01:05 85000 -- [-2199.398] (-2202.960) (-2200.681) (-2199.593) * (-2204.529) (-2205.301) (-2202.648) [-2202.813] -- 0:01:04 Average standard deviation of split frequencies: 0.026624 85500 -- [-2200.719] (-2201.528) (-2202.156) (-2200.145) * [-2203.117] (-2202.516) (-2201.221) (-2202.260) -- 0:01:04 86000 -- (-2199.751) (-2203.448) [-2202.603] (-2200.489) * [-2200.724] (-2203.157) (-2204.991) (-2202.496) -- 0:01:03 86500 -- (-2201.613) (-2201.127) (-2200.528) [-2200.709] * [-2203.743] (-2205.178) (-2200.183) (-2202.988) -- 0:01:03 87000 -- (-2201.498) [-2202.668] (-2201.007) (-2202.313) * [-2201.123] (-2205.836) (-2200.215) (-2202.005) -- 0:01:13 87500 -- (-2201.042) (-2204.224) (-2200.927) [-2204.014] * (-2200.608) (-2203.928) [-2201.771] (-2202.602) -- 0:01:13 88000 -- (-2199.630) [-2202.146] (-2199.439) (-2209.094) * (-2200.255) (-2205.815) [-2199.808] (-2204.702) -- 0:01:12 88500 -- [-2199.602] (-2201.719) (-2200.270) (-2207.688) * (-2200.707) (-2203.888) [-2199.951] (-2205.498) -- 0:01:12 89000 -- [-2201.348] (-2200.478) (-2200.308) (-2203.546) * (-2201.308) [-2205.020] (-2200.175) (-2205.372) -- 0:01:11 89500 -- (-2201.656) (-2200.122) (-2200.638) [-2201.112] * (-2201.810) (-2204.060) [-2201.417] (-2200.724) -- 0:01:11 90000 -- (-2199.928) (-2200.584) [-2201.185] (-2203.123) * (-2202.244) [-2201.600] (-2203.613) (-2201.586) -- 0:01:10 Average standard deviation of split frequencies: 0.021317 90500 -- (-2200.088) (-2200.872) [-2202.165] (-2201.520) * (-2202.459) (-2205.776) (-2203.437) [-2200.094] -- 0:01:10 91000 -- (-2201.672) (-2202.131) (-2200.703) [-2200.886] * (-2202.525) (-2206.355) (-2201.143) [-2200.873] -- 0:01:09 91500 -- (-2200.972) (-2201.224) (-2199.907) [-2201.113] * (-2201.493) (-2204.432) [-2201.143] (-2200.593) -- 0:01:09 92000 -- [-2200.789] (-2199.807) (-2203.053) (-2201.011) * [-2202.581] (-2201.987) (-2203.116) (-2203.432) -- 0:01:09 92500 -- (-2201.038) (-2199.532) (-2199.814) [-2199.570] * (-2210.543) [-2202.124] (-2201.834) (-2205.988) -- 0:01:08 93000 -- (-2199.557) [-2202.746] (-2199.962) (-2200.080) * [-2207.341] (-2205.797) (-2204.576) (-2201.376) -- 0:01:08 93500 -- [-2200.840] (-2202.748) (-2200.680) (-2200.680) * (-2206.478) (-2206.662) (-2202.770) [-2200.949] -- 0:01:07 94000 -- (-2200.352) [-2202.192] (-2208.766) (-2202.620) * (-2206.173) (-2205.344) (-2203.130) [-2200.447] -- 0:01:07 94500 -- (-2200.014) [-2202.467] (-2211.440) (-2200.172) * (-2201.784) [-2202.323] (-2201.787) (-2203.824) -- 0:01:07 95000 -- (-2202.128) [-2204.346] (-2206.711) (-2200.469) * (-2203.867) (-2204.315) [-2200.097] (-2203.824) -- 0:01:06 Average standard deviation of split frequencies: 0.021852 95500 -- (-2202.491) (-2201.575) (-2201.794) [-2200.470] * [-2205.522] (-2201.081) (-2199.734) (-2202.600) -- 0:01:06 96000 -- [-2200.285] (-2201.651) (-2201.534) (-2203.601) * (-2203.143) (-2201.983) (-2200.342) [-2204.441] -- 0:01:05 96500 -- (-2201.861) [-2201.753] (-2200.327) (-2200.205) * (-2202.348) [-2201.559] (-2200.326) (-2200.429) -- 0:01:05 97000 -- (-2199.804) (-2204.304) (-2200.515) [-2200.979] * (-2203.229) (-2201.820) (-2200.852) [-2200.452] -- 0:01:05 97500 -- [-2199.508] (-2203.860) (-2202.532) (-2204.377) * (-2203.594) (-2203.473) [-2200.442] (-2200.291) -- 0:01:04 98000 -- (-2200.494) [-2202.617] (-2208.982) (-2200.909) * (-2202.426) (-2200.658) (-2201.379) [-2200.623] -- 0:01:04 98500 -- [-2201.229] (-2202.267) (-2203.563) (-2202.509) * (-2200.959) (-2200.892) [-2201.198] (-2201.213) -- 0:01:04 99000 -- [-2201.229] (-2201.936) (-2203.170) (-2201.953) * (-2200.532) [-2202.348] (-2201.021) (-2201.288) -- 0:01:03 99500 -- (-2200.827) [-2201.774] (-2200.767) (-2200.221) * [-2201.068] (-2201.545) (-2202.249) (-2201.987) -- 0:01:03 100000 -- (-2199.596) (-2200.703) (-2207.613) [-2200.130] * [-2200.882] (-2203.035) (-2200.715) (-2204.674) -- 0:01:02 Average standard deviation of split frequencies: 0.022712 100500 -- [-2200.229] (-2200.808) (-2204.819) (-2200.575) * [-2202.768] (-2200.084) (-2199.778) (-2203.578) -- 0:01:02 101000 -- (-2201.326) (-2201.914) (-2202.719) [-2204.286] * (-2200.834) [-2199.685] (-2201.178) (-2203.278) -- 0:01:02 101500 -- [-2201.054] (-2201.411) (-2201.042) (-2207.799) * (-2199.869) (-2200.771) (-2201.309) [-2201.557] -- 0:01:10 102000 -- (-2202.319) [-2201.160] (-2200.408) (-2203.385) * (-2199.894) (-2199.781) (-2201.475) [-2203.220] -- 0:01:10 102500 -- [-2200.843] (-2204.581) (-2200.889) (-2206.965) * (-2199.925) (-2199.948) (-2202.478) [-2201.832] -- 0:01:10 103000 -- (-2200.436) [-2201.339] (-2203.724) (-2207.587) * (-2200.178) (-2201.828) [-2201.758] (-2204.055) -- 0:01:09 103500 -- (-2199.856) [-2200.515] (-2199.827) (-2202.829) * (-2199.971) [-2201.730] (-2202.252) (-2203.769) -- 0:01:09 104000 -- (-2200.378) (-2201.767) [-2201.606] (-2205.357) * (-2200.232) (-2200.443) [-2206.934] (-2205.274) -- 0:01:08 104500 -- [-2201.219] (-2202.006) (-2201.582) (-2207.987) * [-2199.356] (-2200.523) (-2202.165) (-2202.831) -- 0:01:08 105000 -- (-2202.308) (-2202.509) (-2201.267) [-2203.210] * (-2202.571) (-2203.103) (-2202.749) [-2203.080] -- 0:01:08 Average standard deviation of split frequencies: 0.024354 105500 -- (-2202.930) (-2201.491) [-2200.242] (-2201.129) * (-2201.852) (-2203.112) (-2205.040) [-2201.747] -- 0:01:07 106000 -- (-2200.417) (-2201.921) (-2202.907) [-2203.484] * [-2204.782] (-2202.126) (-2203.446) (-2202.046) -- 0:01:07 106500 -- (-2200.547) [-2199.173] (-2201.153) (-2204.251) * (-2200.310) (-2202.140) [-2202.489] (-2200.233) -- 0:01:07 107000 -- (-2201.794) [-2201.479] (-2200.463) (-2203.449) * (-2201.791) (-2203.729) [-2202.011] (-2200.135) -- 0:01:06 107500 -- (-2201.577) [-2203.248] (-2200.096) (-2200.845) * (-2201.863) [-2200.018] (-2202.980) (-2200.050) -- 0:01:06 108000 -- [-2204.543] (-2204.495) (-2200.228) (-2200.517) * (-2199.623) (-2199.542) (-2203.022) [-2201.181] -- 0:01:06 108500 -- (-2201.094) (-2205.006) (-2200.111) [-2201.274] * [-2199.255] (-2201.030) (-2204.325) (-2202.005) -- 0:01:05 109000 -- (-2202.776) (-2200.478) (-2200.107) [-2202.199] * (-2203.275) [-2201.303] (-2203.316) (-2200.948) -- 0:01:05 109500 -- (-2203.000) (-2201.799) [-2199.885] (-2201.062) * (-2200.513) (-2200.872) [-2202.425] (-2202.846) -- 0:01:05 110000 -- (-2204.433) (-2202.501) (-2200.339) [-2201.293] * [-2200.526] (-2200.210) (-2201.352) (-2202.786) -- 0:01:04 Average standard deviation of split frequencies: 0.024138 110500 -- (-2202.843) (-2202.878) (-2200.372) [-2200.574] * (-2200.698) [-2200.003] (-2200.386) (-2200.896) -- 0:01:04 111000 -- (-2203.067) (-2201.528) [-2201.370] (-2202.827) * [-2200.124] (-2200.748) (-2200.197) (-2200.918) -- 0:01:04 111500 -- (-2201.632) (-2204.608) [-2204.600] (-2202.954) * (-2200.124) (-2200.285) (-2201.961) [-2202.341] -- 0:01:03 112000 -- (-2201.845) [-2202.608] (-2201.842) (-2203.149) * [-2202.017] (-2202.311) (-2199.897) (-2202.251) -- 0:01:03 112500 -- (-2201.326) (-2204.491) (-2201.739) [-2199.624] * [-2202.255] (-2200.705) (-2199.728) (-2202.291) -- 0:01:03 113000 -- [-2201.847] (-2202.624) (-2203.459) (-2199.980) * (-2202.686) [-2200.855] (-2200.544) (-2203.289) -- 0:01:02 113500 -- (-2201.673) [-2201.611] (-2202.158) (-2201.871) * [-2201.962] (-2204.277) (-2204.337) (-2202.324) -- 0:01:02 114000 -- [-2201.374] (-2200.776) (-2200.198) (-2201.897) * (-2202.071) (-2203.631) [-2203.003] (-2201.596) -- 0:01:02 114500 -- (-2201.967) (-2202.335) [-2201.769] (-2202.502) * (-2201.953) (-2203.341) (-2202.430) [-2199.508] -- 0:01:01 115000 -- (-2200.791) [-2202.954] (-2203.002) (-2200.696) * (-2201.863) (-2202.883) [-2200.357] (-2200.481) -- 0:01:01 Average standard deviation of split frequencies: 0.022061 115500 -- (-2202.158) [-2202.327] (-2202.271) (-2201.246) * (-2200.538) (-2202.673) (-2200.893) [-2200.476] -- 0:01:01 116000 -- (-2204.395) (-2202.252) (-2201.926) [-2203.663] * (-2202.293) (-2204.109) (-2200.621) [-2199.512] -- 0:01:00 116500 -- [-2201.075] (-2203.211) (-2201.994) (-2203.364) * [-2201.080] (-2201.306) (-2201.335) (-2199.611) -- 0:01:08 117000 -- [-2202.660] (-2200.913) (-2203.410) (-2200.669) * [-2202.072] (-2202.165) (-2201.721) (-2201.064) -- 0:01:07 117500 -- (-2203.374) (-2204.113) [-2203.917] (-2204.885) * [-2199.958] (-2201.839) (-2202.203) (-2202.908) -- 0:01:07 118000 -- (-2200.646) [-2205.228] (-2202.707) (-2203.789) * (-2199.877) (-2202.565) [-2200.024] (-2205.062) -- 0:01:07 118500 -- [-2200.399] (-2210.309) (-2203.568) (-2201.615) * (-2200.366) [-2204.312] (-2200.715) (-2203.018) -- 0:01:06 119000 -- [-2200.393] (-2201.577) (-2203.844) (-2202.444) * (-2201.033) [-2202.042] (-2200.546) (-2202.176) -- 0:01:06 119500 -- (-2200.584) (-2201.038) (-2203.918) [-2200.009] * (-2202.218) [-2199.885] (-2204.834) (-2204.903) -- 0:01:06 120000 -- (-2200.467) (-2204.617) [-2204.185] (-2199.848) * (-2202.897) (-2200.840) (-2201.596) [-2204.215] -- 0:01:06 Average standard deviation of split frequencies: 0.021096 120500 -- [-2202.879] (-2202.186) (-2200.065) (-2201.101) * (-2201.905) [-2200.840] (-2200.620) (-2203.128) -- 0:01:05 121000 -- (-2200.898) (-2202.684) (-2200.224) [-2203.179] * (-2201.825) (-2200.749) (-2200.798) [-2200.404] -- 0:01:05 121500 -- [-2199.786] (-2200.992) (-2199.449) (-2203.638) * (-2200.244) (-2201.985) (-2201.768) [-2202.387] -- 0:01:05 122000 -- (-2199.465) (-2199.244) [-2200.049] (-2202.143) * [-2202.521] (-2201.645) (-2205.853) (-2203.313) -- 0:01:04 122500 -- (-2201.931) [-2199.359] (-2199.934) (-2201.421) * [-2202.686] (-2201.525) (-2205.928) (-2201.616) -- 0:01:04 123000 -- (-2199.648) [-2200.211] (-2200.009) (-2200.870) * (-2201.348) (-2201.181) (-2200.442) [-2201.512] -- 0:01:04 123500 -- (-2200.477) (-2200.872) (-2202.342) [-2201.138] * (-2201.078) [-2201.229] (-2200.520) (-2201.456) -- 0:01:03 124000 -- (-2199.243) (-2208.856) [-2199.710] (-2203.117) * [-2201.268] (-2199.979) (-2201.010) (-2201.706) -- 0:01:03 124500 -- (-2199.899) (-2202.774) (-2199.290) [-2201.663] * (-2203.185) (-2199.992) (-2199.765) [-2201.429] -- 0:01:03 125000 -- (-2199.169) [-2201.881] (-2200.821) (-2205.595) * (-2202.059) [-2201.167] (-2202.057) (-2201.796) -- 0:01:03 Average standard deviation of split frequencies: 0.018528 125500 -- [-2199.135] (-2203.038) (-2200.515) (-2204.244) * (-2200.633) (-2201.411) [-2200.630] (-2203.088) -- 0:01:02 126000 -- [-2203.468] (-2202.183) (-2199.983) (-2200.176) * (-2201.004) (-2200.996) [-2199.561] (-2202.687) -- 0:01:02 126500 -- (-2200.643) (-2208.905) (-2201.075) [-2200.567] * (-2202.232) [-2200.884] (-2200.091) (-2201.047) -- 0:01:02 127000 -- [-2200.819] (-2201.047) (-2202.698) (-2202.744) * (-2201.222) [-2201.619] (-2202.019) (-2202.698) -- 0:01:01 127500 -- [-2202.408] (-2200.724) (-2199.673) (-2203.022) * (-2200.067) [-2201.464] (-2200.524) (-2203.712) -- 0:01:01 128000 -- (-2203.964) [-2201.016] (-2199.920) (-2201.578) * [-2200.036] (-2200.676) (-2201.667) (-2200.385) -- 0:01:01 128500 -- (-2202.450) (-2201.503) (-2199.280) [-2202.455] * (-2200.910) (-2201.111) (-2202.767) [-2201.277] -- 0:01:01 129000 -- [-2201.257] (-2200.763) (-2203.546) (-2202.451) * (-2202.851) (-2201.739) (-2202.282) [-2199.842] -- 0:01:00 129500 -- [-2201.404] (-2202.807) (-2203.416) (-2202.223) * (-2205.784) (-2204.910) (-2201.494) [-2202.570] -- 0:01:00 130000 -- (-2201.240) (-2202.777) (-2201.326) [-2203.364] * (-2204.199) (-2203.105) (-2199.568) [-2203.534] -- 0:01:00 Average standard deviation of split frequencies: 0.018399 130500 -- (-2203.190) (-2202.162) [-2201.665] (-2204.861) * (-2209.165) (-2201.487) (-2200.843) [-2201.319] -- 0:00:59 131000 -- (-2201.033) [-2201.729] (-2202.276) (-2203.855) * (-2200.008) (-2202.577) (-2202.564) [-2202.870] -- 0:00:59 131500 -- (-2204.124) (-2205.022) [-2200.451] (-2200.413) * (-2200.272) (-2203.565) (-2202.607) [-2199.603] -- 0:01:06 132000 -- (-2201.415) (-2205.716) [-2200.448] (-2203.010) * [-2200.072] (-2201.827) (-2202.080) (-2200.402) -- 0:01:05 132500 -- (-2200.612) [-2204.967] (-2200.100) (-2201.867) * (-2201.722) [-2201.737] (-2201.874) (-2200.897) -- 0:01:05 133000 -- [-2201.683] (-2204.008) (-2200.504) (-2200.853) * [-2200.525] (-2202.660) (-2200.889) (-2200.897) -- 0:01:05 133500 -- [-2204.039] (-2203.978) (-2199.983) (-2199.986) * (-2200.792) (-2200.199) (-2200.646) [-2200.897] -- 0:01:04 134000 -- [-2202.740] (-2204.001) (-2200.083) (-2200.370) * [-2200.251] (-2200.298) (-2201.020) (-2199.842) -- 0:01:04 134500 -- (-2202.036) (-2204.932) [-2202.052] (-2199.929) * (-2200.810) [-2200.773] (-2201.627) (-2200.635) -- 0:01:04 135000 -- (-2202.447) (-2201.747) (-2204.848) [-2199.518] * [-2200.396] (-2200.773) (-2202.679) (-2200.758) -- 0:01:04 Average standard deviation of split frequencies: 0.017149 135500 -- (-2203.071) (-2202.398) [-2205.553] (-2201.861) * (-2200.472) (-2202.420) [-2202.104] (-2202.967) -- 0:01:03 136000 -- (-2202.104) [-2201.960] (-2202.788) (-2202.620) * (-2201.550) (-2204.665) [-2201.052] (-2201.336) -- 0:01:03 136500 -- (-2201.254) [-2204.079] (-2201.764) (-2203.800) * (-2200.192) (-2202.593) (-2201.525) [-2201.234] -- 0:01:03 137000 -- (-2201.762) [-2201.320] (-2202.991) (-2201.447) * (-2199.841) (-2204.368) (-2201.485) [-2200.469] -- 0:01:02 137500 -- (-2202.717) (-2202.452) (-2202.379) [-2203.994] * (-2199.641) (-2204.124) (-2201.006) [-2201.900] -- 0:01:02 138000 -- (-2204.975) (-2200.412) [-2201.193] (-2201.727) * (-2200.875) (-2200.391) (-2201.804) [-2200.648] -- 0:01:02 138500 -- (-2200.999) [-2202.010] (-2201.860) (-2202.414) * (-2203.288) (-2199.817) [-2201.805] (-2203.869) -- 0:01:02 139000 -- (-2200.649) (-2204.289) (-2200.821) [-2201.682] * (-2201.482) (-2199.829) [-2201.082] (-2200.133) -- 0:01:01 139500 -- (-2201.380) (-2203.906) [-2200.832] (-2201.797) * [-2202.105] (-2199.795) (-2200.228) (-2201.860) -- 0:01:01 140000 -- (-2200.160) [-2203.613] (-2203.167) (-2202.978) * (-2201.727) (-2200.359) [-2201.124] (-2204.543) -- 0:01:01 Average standard deviation of split frequencies: 0.017501 140500 -- [-2200.898] (-2200.276) (-2202.088) (-2201.341) * (-2202.332) (-2200.359) (-2200.459) [-2202.508] -- 0:01:01 141000 -- [-2202.782] (-2200.201) (-2201.021) (-2201.153) * (-2202.436) [-2201.450] (-2200.471) (-2202.180) -- 0:01:00 141500 -- (-2201.221) (-2203.890) (-2202.668) [-2200.511] * [-2199.705] (-2199.921) (-2200.838) (-2202.247) -- 0:01:00 142000 -- [-2200.129] (-2203.842) (-2201.428) (-2202.180) * (-2200.548) (-2200.074) (-2202.128) [-2200.306] -- 0:01:00 142500 -- (-2200.536) (-2201.068) (-2199.523) [-2201.866] * (-2201.519) (-2204.236) [-2200.975] (-2199.573) -- 0:01:00 143000 -- (-2200.658) [-2201.069] (-2203.562) (-2201.175) * (-2202.412) (-2203.371) (-2200.748) [-2199.941] -- 0:00:59 143500 -- (-2200.487) (-2200.754) (-2203.756) [-2201.362] * (-2200.099) (-2200.948) (-2201.659) [-2202.817] -- 0:00:59 144000 -- [-2202.793] (-2203.228) (-2205.861) (-2202.643) * (-2200.327) (-2201.792) (-2200.460) [-2200.242] -- 0:00:59 144500 -- (-2203.392) [-2203.438] (-2205.763) (-2203.290) * (-2204.620) (-2206.834) (-2200.845) [-2200.401] -- 0:00:59 145000 -- (-2202.825) [-2200.182] (-2204.648) (-2202.076) * (-2204.633) (-2200.607) [-2201.462] (-2201.137) -- 0:00:58 Average standard deviation of split frequencies: 0.016824 145500 -- (-2202.130) (-2200.057) (-2204.019) [-2199.802] * [-2200.725] (-2200.569) (-2201.740) (-2199.391) -- 0:00:58 146000 -- (-2200.802) (-2200.699) (-2203.006) [-2199.384] * (-2201.282) (-2200.530) [-2201.346] (-2200.748) -- 0:00:58 146500 -- (-2200.605) [-2200.130] (-2200.044) (-2201.392) * [-2201.461] (-2200.932) (-2201.150) (-2200.603) -- 0:01:04 147000 -- (-2200.947) (-2201.796) [-2199.807] (-2208.874) * (-2200.652) [-2202.600] (-2201.622) (-2200.603) -- 0:01:03 147500 -- (-2201.357) [-2200.052] (-2202.857) (-2202.578) * (-2201.804) [-2201.888] (-2200.276) (-2202.845) -- 0:01:03 148000 -- (-2202.139) (-2200.445) (-2210.028) [-2202.358] * (-2202.954) (-2199.862) [-2200.729] (-2204.132) -- 0:01:03 148500 -- (-2202.709) (-2203.234) (-2205.775) [-2202.358] * (-2201.680) [-2200.450] (-2201.470) (-2199.547) -- 0:01:03 149000 -- [-2201.651] (-2203.646) (-2204.110) (-2200.683) * (-2201.560) [-2201.723] (-2201.761) (-2200.595) -- 0:01:02 149500 -- [-2200.328] (-2203.320) (-2204.086) (-2200.869) * [-2200.774] (-2202.196) (-2200.321) (-2200.588) -- 0:01:02 150000 -- (-2199.905) (-2201.221) [-2205.435] (-2202.538) * [-2201.795] (-2201.976) (-2200.557) (-2204.978) -- 0:01:02 Average standard deviation of split frequencies: 0.016303 150500 -- (-2199.905) (-2200.814) [-2199.629] (-2203.075) * [-2201.794] (-2200.698) (-2203.591) (-2201.941) -- 0:01:02 151000 -- (-2199.904) (-2207.088) (-2199.565) [-2203.676] * (-2206.234) (-2201.804) [-2200.444] (-2203.188) -- 0:01:01 151500 -- (-2207.687) [-2201.602] (-2201.659) (-2201.257) * (-2206.244) [-2203.137] (-2200.743) (-2201.226) -- 0:01:01 152000 -- (-2206.581) (-2201.716) [-2201.919] (-2201.515) * (-2204.402) (-2203.341) (-2200.215) [-2201.393] -- 0:01:01 152500 -- (-2203.636) (-2203.788) [-2201.286] (-2202.217) * [-2200.514] (-2200.456) (-2200.098) (-2202.115) -- 0:01:01 153000 -- (-2199.771) (-2207.111) (-2202.981) [-2200.423] * (-2200.196) (-2201.745) [-2200.065] (-2201.597) -- 0:01:00 153500 -- (-2200.530) (-2207.476) [-2201.445] (-2201.544) * (-2199.780) [-2200.248] (-2200.056) (-2202.260) -- 0:01:00 154000 -- (-2200.050) [-2202.592] (-2201.830) (-2202.109) * (-2201.741) [-2200.667] (-2200.071) (-2201.815) -- 0:01:00 154500 -- (-2203.016) (-2201.184) (-2201.545) [-2201.272] * [-2201.263] (-2200.964) (-2199.358) (-2202.386) -- 0:01:00 155000 -- (-2204.241) [-2202.081] (-2201.935) (-2208.697) * (-2202.126) (-2203.961) [-2201.575] (-2202.160) -- 0:00:59 Average standard deviation of split frequencies: 0.015904 155500 -- (-2200.781) (-2201.820) (-2203.554) [-2203.686] * (-2199.768) (-2202.783) [-2200.941] (-2202.207) -- 0:00:59 156000 -- (-2201.610) (-2200.675) [-2200.389] (-2204.346) * (-2200.484) [-2200.279] (-2201.634) (-2199.623) -- 0:00:59 156500 -- (-2202.931) [-2200.231] (-2204.240) (-2203.278) * [-2200.320] (-2200.613) (-2200.861) (-2199.875) -- 0:00:59 157000 -- (-2202.951) (-2200.115) (-2202.072) [-2200.534] * (-2202.869) [-2202.106] (-2200.763) (-2200.512) -- 0:00:59 157500 -- (-2203.166) (-2202.514) [-2201.838] (-2200.499) * (-2202.939) (-2203.373) (-2201.865) [-2203.973] -- 0:00:58 158000 -- [-2200.290] (-2201.340) (-2199.767) (-2200.364) * (-2203.293) [-2201.071] (-2207.328) (-2201.223) -- 0:00:58 158500 -- (-2201.383) (-2202.486) [-2200.566] (-2202.611) * [-2200.962] (-2200.180) (-2209.082) (-2201.225) -- 0:00:58 159000 -- [-2202.252] (-2202.483) (-2199.671) (-2201.516) * (-2203.741) (-2200.057) (-2200.655) [-2201.146] -- 0:00:58 159500 -- (-2202.400) (-2202.721) (-2201.270) [-2204.716] * (-2203.253) (-2203.524) [-2201.334] (-2202.591) -- 0:00:57 160000 -- (-2204.335) (-2201.757) [-2202.684] (-2201.184) * (-2202.670) (-2200.386) (-2203.444) [-2203.085] -- 0:01:02 Average standard deviation of split frequencies: 0.016789 160500 -- [-2200.376] (-2202.158) (-2202.314) (-2201.468) * (-2202.546) [-2201.966] (-2203.719) (-2201.061) -- 0:01:02 161000 -- [-2199.634] (-2202.386) (-2201.346) (-2201.363) * (-2204.565) [-2201.955] (-2202.752) (-2201.051) -- 0:01:02 161500 -- (-2202.969) [-2203.272] (-2200.902) (-2200.883) * (-2202.678) (-2201.556) (-2204.595) [-2202.597] -- 0:01:02 162000 -- (-2204.445) (-2206.038) [-2200.938] (-2199.993) * [-2204.300] (-2202.640) (-2203.859) (-2202.603) -- 0:01:02 162500 -- [-2201.519] (-2202.871) (-2201.509) (-2200.800) * (-2200.672) (-2200.949) (-2204.655) [-2203.195] -- 0:01:01 163000 -- (-2201.369) [-2202.869] (-2203.077) (-2202.968) * [-2200.759] (-2201.099) (-2201.435) (-2200.724) -- 0:01:01 163500 -- (-2203.169) [-2201.089] (-2204.274) (-2201.882) * [-2200.874] (-2203.272) (-2200.033) (-2204.393) -- 0:01:01 164000 -- (-2199.677) [-2204.825] (-2209.312) (-2201.296) * (-2202.286) [-2201.262] (-2199.842) (-2202.630) -- 0:01:01 164500 -- (-2201.794) (-2203.353) [-2203.612] (-2202.585) * (-2199.570) (-2202.813) (-2204.992) [-2202.883] -- 0:01:00 165000 -- [-2202.302] (-2199.643) (-2204.741) (-2202.235) * (-2199.545) [-2203.340] (-2201.356) (-2201.159) -- 0:01:00 Average standard deviation of split frequencies: 0.015461 165500 -- (-2199.636) [-2199.553] (-2207.826) (-2201.561) * (-2200.794) (-2202.763) (-2202.566) [-2199.866] -- 0:01:00 166000 -- (-2199.875) (-2200.573) [-2207.409] (-2201.316) * (-2199.979) (-2200.975) [-2202.340] (-2205.098) -- 0:01:00 166500 -- (-2200.844) (-2200.909) (-2205.784) [-2199.682] * (-2199.838) (-2202.487) (-2202.013) [-2202.596] -- 0:01:00 167000 -- [-2200.703] (-2199.909) (-2203.068) (-2199.681) * (-2202.335) (-2201.338) (-2201.486) [-2201.901] -- 0:00:59 167500 -- [-2200.379] (-2199.874) (-2203.558) (-2201.887) * (-2201.703) (-2203.044) (-2202.673) [-2201.562] -- 0:00:59 168000 -- (-2200.259) [-2200.930] (-2203.184) (-2202.096) * [-2203.024] (-2200.698) (-2202.093) (-2205.889) -- 0:00:59 168500 -- (-2200.320) [-2200.375] (-2203.616) (-2203.515) * (-2199.652) (-2202.911) (-2201.090) [-2202.952] -- 0:00:59 169000 -- (-2204.727) (-2200.123) [-2203.392] (-2200.800) * (-2201.711) (-2203.122) [-2202.641] (-2205.260) -- 0:00:59 169500 -- (-2203.258) (-2200.131) (-2201.507) [-2200.589] * (-2201.799) [-2206.391] (-2202.519) (-2203.008) -- 0:00:58 170000 -- [-2201.022] (-2202.255) (-2200.084) (-2199.576) * (-2202.181) (-2204.082) [-2201.103] (-2202.298) -- 0:00:58 Average standard deviation of split frequencies: 0.013964 170500 -- [-2201.021] (-2202.146) (-2204.821) (-2200.201) * [-2202.287] (-2205.925) (-2200.033) (-2206.106) -- 0:00:58 171000 -- (-2201.026) (-2203.701) [-2202.856] (-2199.692) * [-2199.484] (-2200.732) (-2200.380) (-2206.276) -- 0:00:58 171500 -- (-2200.403) (-2204.737) (-2202.224) [-2202.228] * (-2204.502) (-2200.444) [-2200.868] (-2204.725) -- 0:00:57 172000 -- [-2201.549] (-2203.328) (-2200.839) (-2202.536) * (-2204.955) (-2200.372) [-2202.164] (-2204.390) -- 0:00:57 172500 -- (-2202.463) (-2206.799) [-2202.893] (-2202.400) * (-2200.728) [-2201.844] (-2202.830) (-2207.066) -- 0:00:57 173000 -- (-2202.517) (-2203.351) (-2201.557) [-2201.251] * (-2200.957) (-2201.844) [-2205.166] (-2206.446) -- 0:00:57 173500 -- (-2205.296) (-2203.395) (-2202.278) [-2200.094] * (-2201.931) (-2200.744) (-2203.046) [-2201.285] -- 0:00:57 174000 -- [-2201.732] (-2200.741) (-2202.944) (-2200.454) * (-2201.769) (-2200.689) (-2202.421) [-2201.178] -- 0:01:01 174500 -- [-2200.589] (-2200.611) (-2203.140) (-2200.170) * [-2201.182] (-2200.811) (-2200.228) (-2200.677) -- 0:01:01 175000 -- (-2200.240) (-2200.915) [-2202.468] (-2202.338) * (-2201.658) [-2203.043] (-2201.166) (-2203.998) -- 0:01:01 Average standard deviation of split frequencies: 0.012920 175500 -- (-2199.737) (-2200.236) [-2202.136] (-2200.716) * (-2202.656) (-2202.034) (-2204.013) [-2199.728] -- 0:01:01 176000 -- [-2199.813] (-2200.575) (-2203.046) (-2202.662) * (-2202.106) [-2201.157] (-2204.741) (-2201.376) -- 0:01:00 176500 -- (-2200.204) (-2201.581) [-2203.909] (-2201.774) * [-2202.608] (-2200.873) (-2204.749) (-2199.332) -- 0:01:00 177000 -- (-2200.779) (-2200.838) (-2202.299) [-2201.464] * [-2202.090] (-2204.979) (-2200.826) (-2200.105) -- 0:01:00 177500 -- [-2199.902] (-2200.838) (-2205.184) (-2201.555) * (-2202.086) [-2202.147] (-2200.241) (-2202.363) -- 0:01:00 178000 -- [-2200.077] (-2201.660) (-2206.921) (-2200.280) * (-2200.978) (-2205.498) [-2202.900] (-2202.377) -- 0:01:00 178500 -- (-2199.274) [-2202.638] (-2203.163) (-2201.321) * (-2200.265) (-2201.695) (-2202.601) [-2201.869] -- 0:00:59 179000 -- [-2201.044] (-2202.773) (-2203.051) (-2199.913) * (-2201.821) (-2201.984) (-2202.601) [-2202.480] -- 0:00:59 179500 -- (-2201.309) (-2203.399) (-2203.216) [-2202.307] * [-2201.384] (-2203.207) (-2199.588) (-2201.655) -- 0:00:59 180000 -- (-2202.378) (-2205.451) [-2205.790] (-2200.412) * (-2200.588) (-2203.959) [-2199.633] (-2200.050) -- 0:00:59 Average standard deviation of split frequencies: 0.012586 180500 -- (-2202.532) [-2204.383] (-2202.542) (-2200.548) * [-2201.817] (-2200.897) (-2199.646) (-2200.871) -- 0:00:59 181000 -- (-2205.779) [-2202.070] (-2204.102) (-2202.517) * (-2201.811) (-2202.400) (-2200.129) [-2200.960] -- 0:00:58 181500 -- [-2201.106] (-2201.681) (-2200.545) (-2201.116) * (-2199.589) [-2201.836] (-2205.255) (-2201.033) -- 0:00:58 182000 -- (-2201.043) (-2201.379) [-2200.151] (-2203.362) * (-2199.446) (-2200.696) [-2199.463] (-2201.577) -- 0:00:58 182500 -- [-2206.830] (-2200.293) (-2205.962) (-2204.729) * (-2203.132) (-2202.625) [-2200.137] (-2201.790) -- 0:00:58 183000 -- (-2205.987) [-2199.621] (-2206.214) (-2204.149) * (-2199.599) (-2201.933) (-2200.136) [-2202.349] -- 0:00:58 183500 -- (-2202.739) (-2200.048) [-2203.102] (-2202.827) * [-2205.170] (-2201.287) (-2200.201) (-2202.595) -- 0:00:57 184000 -- [-2203.061] (-2203.345) (-2202.730) (-2203.061) * (-2199.999) [-2200.776] (-2200.287) (-2202.406) -- 0:00:57 184500 -- [-2202.877] (-2205.123) (-2202.803) (-2202.504) * (-2200.552) (-2200.481) [-2200.287] (-2209.620) -- 0:00:57 185000 -- (-2203.950) (-2202.546) [-2202.217] (-2200.993) * (-2202.048) [-2206.256] (-2199.509) (-2211.216) -- 0:00:57 Average standard deviation of split frequencies: 0.010883 185500 -- (-2207.825) [-2201.281] (-2200.439) (-2202.013) * [-2199.709] (-2202.364) (-2200.851) (-2208.398) -- 0:00:57 186000 -- (-2204.313) (-2200.187) [-2199.516] (-2201.774) * (-2199.709) (-2201.665) (-2203.866) [-2202.344] -- 0:01:01 186500 -- [-2201.493] (-2200.067) (-2199.533) (-2201.821) * (-2200.147) (-2199.736) (-2209.516) [-2200.344] -- 0:01:01 187000 -- [-2200.638] (-2201.501) (-2199.291) (-2200.389) * [-2200.974] (-2199.636) (-2208.577) (-2199.965) -- 0:01:00 187500 -- (-2203.483) (-2203.306) [-2201.450] (-2199.667) * [-2199.839] (-2202.020) (-2201.300) (-2202.344) -- 0:01:00 188000 -- (-2199.639) (-2203.323) (-2203.270) [-2201.385] * (-2200.086) [-2203.387] (-2199.946) (-2203.019) -- 0:01:00 188500 -- [-2200.304] (-2203.597) (-2203.262) (-2199.818) * (-2200.426) (-2201.558) [-2199.630] (-2200.218) -- 0:01:00 189000 -- (-2201.542) [-2200.504] (-2199.757) (-2200.568) * (-2202.088) (-2200.804) (-2200.525) [-2200.349] -- 0:01:00 189500 -- (-2200.560) (-2200.346) (-2201.097) [-2199.741] * (-2200.833) (-2201.905) (-2199.867) [-2200.250] -- 0:00:59 190000 -- (-2200.309) (-2200.208) (-2201.097) [-2199.800] * (-2200.160) [-2201.740] (-2200.868) (-2200.007) -- 0:00:59 Average standard deviation of split frequencies: 0.010180 190500 -- (-2203.964) (-2200.347) (-2200.694) [-2201.226] * [-2200.141] (-2199.714) (-2203.842) (-2202.548) -- 0:00:59 191000 -- (-2206.963) [-2199.715] (-2201.692) (-2200.843) * (-2201.340) [-2202.736] (-2206.925) (-2202.737) -- 0:00:59 191500 -- (-2207.823) (-2199.394) [-2201.373] (-2203.245) * (-2202.199) (-2203.583) (-2210.714) [-2202.737] -- 0:00:59 192000 -- [-2203.961] (-2199.582) (-2205.920) (-2202.064) * [-2199.953] (-2200.049) (-2205.611) (-2199.654) -- 0:00:58 192500 -- (-2200.987) [-2201.201] (-2207.421) (-2202.360) * [-2200.116] (-2199.829) (-2205.192) (-2199.654) -- 0:00:58 193000 -- (-2199.839) (-2201.942) [-2201.086] (-2201.326) * (-2200.593) (-2201.719) [-2202.143] (-2202.714) -- 0:00:58 193500 -- (-2200.320) (-2202.026) [-2201.956] (-2202.402) * (-2200.662) (-2200.263) (-2206.706) [-2199.828] -- 0:00:58 194000 -- (-2202.453) (-2199.246) [-2200.247] (-2206.044) * (-2200.679) (-2202.169) (-2205.724) [-2199.918] -- 0:00:58 194500 -- (-2202.620) (-2200.515) (-2202.222) [-2203.760] * (-2202.342) [-2205.651] (-2211.767) (-2200.843) -- 0:00:57 195000 -- (-2201.992) [-2199.452] (-2202.618) (-2201.369) * (-2200.351) [-2204.990] (-2209.319) (-2199.765) -- 0:00:57 Average standard deviation of split frequencies: 0.011758 195500 -- (-2200.230) (-2201.052) (-2200.228) [-2200.759] * (-2202.158) (-2205.027) (-2204.927) [-2200.679] -- 0:00:57 196000 -- (-2201.470) (-2201.582) (-2201.577) [-2199.620] * [-2201.627] (-2202.997) (-2201.001) (-2201.414) -- 0:00:57 196500 -- [-2200.280] (-2200.333) (-2203.610) (-2199.620) * (-2201.639) [-2200.038] (-2203.150) (-2203.362) -- 0:00:57 197000 -- (-2200.434) (-2201.800) (-2203.983) [-2199.620] * (-2200.694) (-2203.209) (-2201.395) [-2201.014] -- 0:00:57 197500 -- (-2200.274) (-2199.407) [-2203.537] (-2201.161) * (-2201.102) [-2203.209] (-2200.415) (-2202.355) -- 0:00:56 198000 -- (-2202.687) [-2200.400] (-2200.492) (-2200.431) * (-2200.503) (-2202.186) [-2199.938] (-2202.001) -- 0:00:56 198500 -- [-2200.834] (-2200.058) (-2200.299) (-2199.530) * (-2201.451) (-2201.242) [-2201.169] (-2201.922) -- 0:01:00 199000 -- (-2202.868) [-2199.690] (-2200.553) (-2202.932) * (-2200.883) [-2201.167] (-2200.807) (-2202.809) -- 0:01:00 199500 -- (-2201.481) (-2199.822) (-2200.689) [-2201.482] * (-2201.270) [-2200.211] (-2200.057) (-2200.938) -- 0:01:00 200000 -- (-2201.539) (-2199.887) (-2200.585) [-2200.136] * (-2204.032) (-2200.346) [-2200.419] (-2201.537) -- 0:00:59 Average standard deviation of split frequencies: 0.011884 200500 -- (-2200.540) (-2200.267) (-2202.599) [-2202.448] * (-2201.622) (-2200.638) [-2202.090] (-2199.385) -- 0:00:59 201000 -- [-2202.718] (-2201.329) (-2204.607) (-2202.424) * (-2201.371) (-2200.778) [-2199.755] (-2201.977) -- 0:00:59 201500 -- [-2204.144] (-2203.131) (-2203.914) (-2201.317) * (-2201.461) [-2200.344] (-2199.738) (-2201.643) -- 0:00:59 202000 -- (-2204.000) (-2201.004) (-2203.467) [-2200.141] * (-2203.002) (-2200.066) (-2199.349) [-2201.654] -- 0:00:59 202500 -- (-2201.944) (-2202.720) [-2201.646] (-2201.661) * (-2201.603) [-2199.519] (-2200.761) (-2202.387) -- 0:00:59 203000 -- (-2201.944) (-2200.793) (-2200.535) [-2201.321] * (-2201.151) (-2201.466) (-2201.227) [-2202.660] -- 0:00:58 203500 -- (-2201.425) [-2203.553] (-2202.230) (-2201.216) * [-2201.180] (-2202.755) (-2200.332) (-2204.048) -- 0:00:58 204000 -- (-2202.128) (-2201.429) (-2202.757) [-2201.165] * (-2203.612) [-2205.403] (-2201.369) (-2203.184) -- 0:00:58 204500 -- (-2200.897) (-2205.281) (-2204.553) [-2200.213] * [-2205.953] (-2204.026) (-2202.254) (-2201.478) -- 0:00:58 205000 -- [-2202.354] (-2203.076) (-2201.585) (-2200.788) * (-2202.067) [-2200.942] (-2202.497) (-2200.401) -- 0:00:58 Average standard deviation of split frequencies: 0.011188 205500 -- [-2202.002] (-2202.389) (-2201.207) (-2201.190) * (-2202.088) [-2203.620] (-2201.973) (-2200.186) -- 0:00:57 206000 -- (-2201.104) [-2203.771] (-2201.111) (-2201.874) * (-2201.389) (-2202.085) [-2201.297] (-2200.216) -- 0:00:57 206500 -- [-2199.923] (-2203.604) (-2200.166) (-2201.219) * [-2201.109] (-2202.769) (-2199.508) (-2201.227) -- 0:00:57 207000 -- [-2200.149] (-2202.473) (-2200.963) (-2200.257) * (-2200.758) [-2201.023] (-2201.132) (-2202.072) -- 0:00:57 207500 -- (-2200.783) (-2200.256) (-2201.983) [-2202.475] * (-2199.897) (-2202.451) [-2201.030] (-2210.175) -- 0:00:57 208000 -- (-2199.202) [-2200.444] (-2200.173) (-2200.949) * (-2201.204) (-2200.462) [-2202.322] (-2202.455) -- 0:00:57 208500 -- (-2201.310) (-2200.099) (-2201.400) [-2199.333] * (-2200.514) (-2201.394) [-2199.346] (-2201.183) -- 0:00:56 209000 -- (-2201.887) [-2200.099] (-2200.879) (-2199.766) * (-2202.339) (-2201.421) [-2199.612] (-2201.968) -- 0:00:56 209500 -- (-2199.722) (-2200.541) (-2200.588) [-2199.689] * (-2203.007) (-2201.181) (-2201.193) [-2200.552] -- 0:00:56 210000 -- [-2202.165] (-2203.719) (-2200.806) (-2199.934) * [-2201.242] (-2201.188) (-2203.074) (-2201.897) -- 0:01:00 Average standard deviation of split frequencies: 0.013426 210500 -- (-2202.165) (-2203.103) (-2201.826) [-2201.950] * (-2203.685) (-2201.611) [-2206.976] (-2201.035) -- 0:01:00 211000 -- [-2200.588] (-2201.243) (-2200.339) (-2203.273) * (-2201.760) (-2205.938) (-2201.036) [-2200.861] -- 0:00:59 211500 -- (-2204.901) (-2202.057) [-2200.324] (-2204.556) * (-2200.603) (-2202.668) [-2201.036] (-2199.923) -- 0:00:59 212000 -- [-2204.923] (-2203.679) (-2202.495) (-2201.570) * (-2200.044) (-2200.976) [-2200.013] (-2202.189) -- 0:00:59 212500 -- [-2200.966] (-2204.448) (-2200.305) (-2201.848) * (-2203.232) (-2204.314) [-2199.164] (-2201.164) -- 0:00:59 213000 -- (-2200.632) (-2203.963) (-2201.545) [-2204.477] * (-2201.240) [-2201.208] (-2199.277) (-2204.778) -- 0:00:59 213500 -- (-2205.167) (-2202.525) (-2202.379) [-2204.940] * (-2201.725) (-2199.703) (-2199.160) [-2202.737] -- 0:00:58 214000 -- (-2201.516) [-2201.739] (-2200.839) (-2204.033) * (-2200.879) [-2201.043] (-2199.160) (-2203.622) -- 0:00:58 214500 -- (-2202.373) [-2202.738] (-2201.190) (-2200.658) * (-2201.236) [-2200.315] (-2201.397) (-2200.564) -- 0:00:58 215000 -- (-2202.030) (-2203.639) [-2200.040] (-2200.989) * [-2202.979] (-2199.831) (-2201.488) (-2199.877) -- 0:00:58 Average standard deviation of split frequencies: 0.013223 215500 -- [-2203.609] (-2201.257) (-2200.362) (-2200.368) * [-2201.033] (-2204.763) (-2202.593) (-2201.514) -- 0:00:58 216000 -- (-2206.214) (-2199.835) [-2202.941] (-2202.128) * [-2199.944] (-2202.634) (-2200.160) (-2199.351) -- 0:00:58 216500 -- (-2206.009) (-2199.855) (-2201.758) [-2199.878] * (-2201.350) (-2200.225) [-2199.908] (-2199.467) -- 0:00:57 217000 -- (-2204.397) (-2199.665) (-2201.553) [-2199.771] * (-2200.960) (-2199.816) (-2200.777) [-2200.990] -- 0:00:57 217500 -- (-2201.318) (-2201.151) [-2201.025] (-2201.471) * (-2199.940) [-2200.458] (-2201.398) (-2200.524) -- 0:00:57 218000 -- (-2199.683) (-2202.933) (-2200.983) [-2203.350] * (-2200.279) (-2200.744) [-2200.225] (-2204.248) -- 0:00:57 218500 -- (-2201.404) (-2202.619) [-2201.181] (-2201.763) * [-2200.258] (-2201.665) (-2202.280) (-2201.657) -- 0:00:57 219000 -- (-2202.523) [-2201.482] (-2200.848) (-2203.043) * [-2199.827] (-2202.456) (-2203.085) (-2201.668) -- 0:00:57 219500 -- [-2200.682] (-2201.358) (-2201.169) (-2204.170) * (-2199.836) (-2202.484) [-2201.558] (-2201.021) -- 0:00:56 220000 -- [-2200.642] (-2201.358) (-2202.416) (-2203.082) * [-2200.595] (-2204.245) (-2203.153) (-2201.344) -- 0:00:56 Average standard deviation of split frequencies: 0.013069 220500 -- [-2200.290] (-2202.547) (-2202.952) (-2202.775) * (-2200.404) (-2203.946) [-2201.502] (-2204.298) -- 0:00:56 221000 -- (-2201.694) (-2203.579) [-2201.821] (-2206.378) * [-2199.795] (-2203.039) (-2201.502) (-2205.937) -- 0:00:56 221500 -- (-2200.159) (-2201.353) (-2209.496) [-2199.841] * (-2200.915) (-2207.565) [-2201.532] (-2204.259) -- 0:00:56 222000 -- (-2200.263) [-2203.656] (-2208.793) (-2199.664) * (-2201.337) (-2202.122) [-2200.431] (-2202.739) -- 0:00:56 222500 -- [-2201.928] (-2202.021) (-2205.482) (-2202.863) * (-2201.517) [-2202.248] (-2200.427) (-2199.893) -- 0:00:55 223000 -- [-2201.568] (-2200.504) (-2203.030) (-2204.263) * (-2202.774) (-2203.927) [-2200.624] (-2200.087) -- 0:00:55 223500 -- [-2200.524] (-2201.323) (-2201.847) (-2202.616) * (-2203.340) (-2204.454) (-2201.850) [-2200.321] -- 0:00:55 224000 -- (-2199.697) (-2200.531) [-2200.496] (-2208.567) * (-2201.487) [-2203.295] (-2200.818) (-2202.092) -- 0:00:55 224500 -- (-2202.912) [-2200.269] (-2202.565) (-2212.548) * (-2203.581) [-2201.964] (-2202.816) (-2201.429) -- 0:00:58 225000 -- (-2203.440) [-2200.738] (-2200.609) (-2208.454) * (-2201.624) (-2201.964) (-2204.490) [-2201.226] -- 0:00:58 Average standard deviation of split frequencies: 0.013374 225500 -- (-2200.256) (-2200.318) (-2200.736) [-2202.944] * (-2199.560) (-2203.178) [-2207.810] (-2201.285) -- 0:00:58 226000 -- (-2200.284) (-2201.050) (-2201.272) [-2200.779] * (-2199.962) (-2204.301) [-2205.700] (-2200.982) -- 0:00:58 226500 -- [-2201.054] (-2203.296) (-2202.316) (-2200.717) * (-2200.395) [-2201.296] (-2204.175) (-2201.988) -- 0:00:58 227000 -- (-2200.676) [-2201.015] (-2200.476) (-2200.592) * (-2200.968) [-2199.936] (-2203.139) (-2201.626) -- 0:00:57 227500 -- (-2200.487) (-2202.823) [-2203.625] (-2201.098) * [-2201.534] (-2199.936) (-2200.973) (-2204.952) -- 0:00:57 228000 -- (-2202.471) [-2204.439] (-2205.233) (-2203.591) * (-2201.892) (-2199.398) (-2201.961) [-2202.211] -- 0:00:57 228500 -- (-2204.420) (-2200.096) (-2201.814) [-2203.313] * (-2201.133) [-2201.518] (-2201.715) (-2203.300) -- 0:00:57 229000 -- (-2204.974) (-2200.239) [-2201.569] (-2206.741) * (-2200.542) [-2200.916] (-2202.551) (-2202.856) -- 0:00:57 229500 -- (-2200.898) (-2200.369) [-2201.415] (-2201.457) * (-2202.466) (-2201.073) [-2201.868] (-2201.620) -- 0:00:57 230000 -- (-2201.419) (-2200.126) [-2202.548] (-2200.067) * (-2204.229) (-2204.143) [-2201.201] (-2201.845) -- 0:00:56 Average standard deviation of split frequencies: 0.013103 230500 -- (-2204.950) [-2203.718] (-2205.021) (-2200.632) * [-2203.795] (-2203.802) (-2203.862) (-2201.629) -- 0:00:56 231000 -- [-2203.282] (-2200.372) (-2200.053) (-2200.639) * (-2204.881) [-2201.859] (-2204.560) (-2201.808) -- 0:00:56 231500 -- (-2203.709) [-2204.224] (-2199.591) (-2200.668) * [-2204.562] (-2200.120) (-2205.281) (-2201.216) -- 0:00:56 232000 -- (-2200.147) (-2203.887) [-2200.080] (-2200.668) * (-2202.451) (-2201.705) (-2206.114) [-2201.615] -- 0:00:56 232500 -- [-2200.882] (-2201.155) (-2208.322) (-2201.258) * (-2202.917) (-2202.677) (-2206.616) [-2202.768] -- 0:00:56 233000 -- (-2201.841) [-2200.817] (-2201.399) (-2200.413) * (-2203.008) (-2203.018) (-2203.678) [-2202.840] -- 0:00:55 233500 -- (-2199.342) (-2200.822) [-2200.834] (-2201.655) * (-2204.058) [-2203.045] (-2201.733) (-2202.509) -- 0:00:55 234000 -- [-2199.175] (-2200.017) (-2203.119) (-2199.419) * (-2206.982) (-2205.992) (-2199.231) [-2200.776] -- 0:00:55 234500 -- (-2201.775) (-2204.554) [-2203.818] (-2199.423) * (-2204.299) (-2200.364) [-2203.483] (-2201.330) -- 0:00:55 235000 -- (-2202.386) (-2209.709) (-2202.186) [-2201.288] * [-2204.132] (-2199.246) (-2205.390) (-2204.176) -- 0:00:55 Average standard deviation of split frequencies: 0.012102 235500 -- (-2199.169) (-2206.537) (-2202.037) [-2199.437] * (-2207.070) (-2199.196) (-2206.868) [-2202.733] -- 0:00:55 236000 -- (-2201.469) (-2207.645) (-2201.584) [-2200.392] * (-2200.860) (-2199.196) (-2208.937) [-2202.250] -- 0:00:55 236500 -- (-2200.804) (-2201.972) (-2201.223) [-2200.392] * [-2200.641] (-2199.894) (-2205.111) (-2199.700) -- 0:00:54 237000 -- (-2200.312) [-2204.727] (-2200.689) (-2199.475) * [-2200.551] (-2200.165) (-2203.163) (-2199.700) -- 0:00:54 237500 -- (-2201.198) (-2203.883) [-2200.749] (-2199.992) * (-2205.398) (-2200.639) (-2200.647) [-2201.847] -- 0:00:54 238000 -- (-2201.505) (-2203.817) (-2200.575) [-2199.380] * (-2206.867) (-2200.789) [-2201.222] (-2200.251) -- 0:00:54 238500 -- (-2199.842) [-2202.033] (-2205.320) (-2200.727) * (-2202.355) [-2204.685] (-2202.526) (-2199.775) -- 0:00:54 239000 -- (-2199.758) (-2204.644) [-2202.627] (-2199.821) * (-2200.686) (-2200.081) (-2201.486) [-2200.303] -- 0:00:54 239500 -- (-2199.976) (-2204.377) [-2202.721] (-2199.820) * (-2202.443) (-2201.355) (-2205.590) [-2200.528] -- 0:00:53 240000 -- (-2203.176) (-2202.277) (-2199.502) [-2201.906] * [-2200.304] (-2202.782) (-2206.997) (-2200.315) -- 0:00:56 Average standard deviation of split frequencies: 0.013135 240500 -- [-2202.113] (-2204.674) (-2200.492) (-2200.528) * (-2206.524) [-2201.309] (-2210.377) (-2199.500) -- 0:00:56 241000 -- (-2201.733) (-2206.430) (-2200.836) [-2200.443] * (-2205.515) (-2199.883) (-2202.443) [-2199.640] -- 0:00:56 241500 -- [-2200.135] (-2210.498) (-2200.699) (-2200.435) * (-2203.366) (-2200.610) [-2200.743] (-2201.487) -- 0:00:56 242000 -- (-2199.481) [-2204.964] (-2199.534) (-2203.824) * (-2202.080) (-2200.460) (-2200.760) [-2199.729] -- 0:00:56 242500 -- (-2201.506) (-2201.849) (-2199.532) [-2201.456] * (-2201.153) (-2202.596) (-2200.413) [-2199.364] -- 0:00:56 243000 -- (-2200.148) [-2201.335] (-2202.062) (-2203.213) * (-2200.017) (-2202.243) (-2199.569) [-2200.011] -- 0:00:56 243500 -- (-2200.451) [-2203.637] (-2202.065) (-2199.831) * [-2200.017] (-2207.821) (-2199.624) (-2201.838) -- 0:00:55 244000 -- (-2199.851) (-2201.809) [-2200.286] (-2200.053) * (-2201.136) (-2203.040) (-2199.598) [-2199.923] -- 0:00:55 244500 -- (-2199.916) (-2201.816) [-2200.225] (-2199.874) * (-2200.977) (-2200.529) (-2199.745) [-2200.420] -- 0:00:55 245000 -- (-2200.093) [-2199.997] (-2199.678) (-2200.281) * (-2202.306) (-2200.041) (-2200.187) [-2202.564] -- 0:00:55 Average standard deviation of split frequencies: 0.013307 245500 -- (-2202.911) (-2201.325) [-2199.678] (-2199.490) * (-2201.814) [-2201.059] (-2203.315) (-2202.182) -- 0:00:55 246000 -- (-2201.037) [-2200.507] (-2200.318) (-2199.489) * (-2204.109) (-2200.265) (-2200.356) [-2201.127] -- 0:00:55 246500 -- (-2199.974) (-2202.459) [-2199.445] (-2200.826) * (-2200.981) [-2201.719] (-2202.809) (-2205.034) -- 0:00:55 247000 -- [-2199.970] (-2201.810) (-2199.519) (-2202.325) * (-2211.880) [-2200.978] (-2206.595) (-2202.442) -- 0:00:54 247500 -- (-2199.535) (-2199.590) (-2199.522) [-2200.846] * (-2205.663) [-2201.385] (-2201.540) (-2200.802) -- 0:00:54 248000 -- (-2199.596) [-2200.142] (-2200.962) (-2202.173) * (-2203.791) (-2202.785) (-2201.058) [-2200.053] -- 0:00:54 248500 -- [-2199.652] (-2200.562) (-2201.713) (-2207.152) * (-2203.061) [-2201.339] (-2202.780) (-2202.581) -- 0:00:54 249000 -- [-2199.504] (-2201.886) (-2203.388) (-2201.296) * [-2200.855] (-2203.162) (-2202.611) (-2203.739) -- 0:00:54 249500 -- (-2199.505) (-2201.651) (-2202.730) [-2204.128] * [-2201.426] (-2202.847) (-2202.886) (-2204.323) -- 0:00:54 250000 -- [-2202.215] (-2201.383) (-2204.058) (-2200.613) * [-2203.821] (-2202.346) (-2202.955) (-2204.385) -- 0:00:54 Average standard deviation of split frequencies: 0.012851 250500 -- (-2200.998) (-2201.383) [-2202.880] (-2200.825) * [-2200.671] (-2202.198) (-2203.286) (-2203.988) -- 0:00:53 251000 -- (-2202.813) (-2201.344) (-2202.822) [-2200.681] * (-2202.822) (-2201.030) [-2203.651] (-2200.028) -- 0:00:53 251500 -- [-2200.365] (-2201.345) (-2201.562) (-2206.263) * [-2200.410] (-2201.055) (-2202.706) (-2199.954) -- 0:00:53 252000 -- [-2199.333] (-2205.023) (-2199.680) (-2204.891) * [-2201.468] (-2202.493) (-2201.557) (-2200.133) -- 0:00:53 252500 -- (-2200.162) (-2201.294) (-2200.247) [-2204.628] * (-2203.094) (-2202.414) (-2203.401) [-2199.892] -- 0:00:56 253000 -- (-2199.464) (-2200.581) (-2208.146) [-2203.569] * (-2201.705) (-2202.316) (-2201.858) [-2201.321] -- 0:00:56 253500 -- (-2199.937) (-2202.112) (-2203.626) [-2202.473] * (-2202.197) (-2203.695) (-2204.138) [-2200.685] -- 0:00:55 254000 -- (-2200.270) (-2201.413) (-2200.799) [-2201.516] * [-2200.340] (-2203.949) (-2204.050) (-2199.835) -- 0:00:55 254500 -- [-2204.428] (-2203.665) (-2201.120) (-2201.829) * (-2200.349) (-2206.000) (-2201.836) [-2200.253] -- 0:00:55 255000 -- (-2204.310) (-2200.887) (-2201.882) [-2201.828] * (-2199.915) [-2205.625] (-2200.945) (-2200.062) -- 0:00:55 Average standard deviation of split frequencies: 0.012673 255500 -- (-2204.254) (-2201.148) [-2201.666] (-2200.676) * (-2201.469) (-2200.195) [-2201.693] (-2200.086) -- 0:00:55 256000 -- (-2204.276) [-2199.882] (-2201.948) (-2199.758) * (-2200.447) [-2199.426] (-2200.607) (-2201.151) -- 0:00:55 256500 -- [-2200.857] (-2199.526) (-2201.285) (-2200.348) * (-2200.164) (-2199.426) (-2200.668) [-2200.907] -- 0:00:55 257000 -- [-2202.456] (-2204.193) (-2200.767) (-2201.196) * (-2201.993) [-2202.860] (-2200.096) (-2200.811) -- 0:00:54 257500 -- (-2203.549) (-2204.202) (-2201.108) [-2200.140] * (-2202.242) [-2200.691] (-2201.557) (-2199.395) -- 0:00:54 258000 -- (-2205.300) (-2202.692) [-2200.533] (-2201.185) * (-2201.197) [-2200.636] (-2201.557) (-2200.766) -- 0:00:54 258500 -- [-2201.186] (-2202.597) (-2204.079) (-2202.149) * [-2200.723] (-2200.562) (-2200.170) (-2199.729) -- 0:00:54 259000 -- (-2203.237) (-2202.535) (-2204.673) [-2203.682] * (-2200.918) (-2204.787) [-2199.971] (-2199.716) -- 0:00:54 259500 -- [-2205.665] (-2203.554) (-2202.222) (-2200.091) * (-2200.470) (-2204.960) [-2199.770] (-2201.147) -- 0:00:54 260000 -- [-2205.582] (-2204.365) (-2201.994) (-2199.473) * [-2200.076] (-2204.237) (-2201.924) (-2203.401) -- 0:00:54 Average standard deviation of split frequencies: 0.012978 260500 -- (-2202.008) [-2205.610] (-2202.000) (-2200.684) * (-2202.819) (-2201.297) [-2201.796] (-2202.739) -- 0:00:53 261000 -- (-2203.739) (-2205.487) (-2200.903) [-2201.054] * [-2202.893] (-2202.893) (-2200.873) (-2202.540) -- 0:00:53 261500 -- (-2200.472) (-2200.935) [-2200.354] (-2202.009) * [-2201.949] (-2203.674) (-2199.438) (-2201.556) -- 0:00:53 262000 -- (-2200.472) (-2201.301) (-2201.515) [-2202.715] * (-2199.900) [-2202.317] (-2199.451) (-2203.309) -- 0:00:53 262500 -- [-2202.453] (-2200.395) (-2200.896) (-2203.145) * (-2200.112) [-2202.159] (-2200.323) (-2199.844) -- 0:00:53 263000 -- (-2200.410) (-2201.121) (-2200.437) [-2201.203] * (-2199.395) [-2200.629] (-2200.806) (-2199.716) -- 0:00:53 263500 -- (-2199.902) [-2201.919] (-2200.436) (-2202.474) * (-2201.715) (-2201.790) (-2203.833) [-2201.839] -- 0:00:53 264000 -- (-2202.041) (-2203.234) (-2199.666) [-2201.739] * (-2203.095) [-2204.060] (-2202.546) (-2200.955) -- 0:00:52 264500 -- [-2203.188] (-2201.346) (-2200.834) (-2200.203) * [-2202.789] (-2205.081) (-2200.011) (-2201.482) -- 0:00:52 265000 -- [-2203.062] (-2203.092) (-2199.871) (-2202.215) * (-2200.353) (-2204.199) [-2203.207] (-2201.376) -- 0:00:52 Average standard deviation of split frequencies: 0.013552 265500 -- (-2204.451) (-2200.805) [-2199.220] (-2202.778) * (-2200.443) (-2203.744) [-2199.376] (-2199.752) -- 0:00:52 266000 -- (-2202.829) (-2204.956) [-2199.541] (-2199.695) * (-2200.443) [-2203.112] (-2200.853) (-2201.289) -- 0:00:52 266500 -- (-2205.871) (-2201.568) [-2199.977] (-2199.476) * (-2200.152) (-2206.731) [-2203.970] (-2206.028) -- 0:00:55 267000 -- (-2208.766) (-2200.926) [-2200.919] (-2199.857) * [-2200.137] (-2203.817) (-2201.041) (-2202.447) -- 0:00:54 267500 -- (-2203.269) (-2200.755) [-2201.299] (-2199.227) * (-2201.493) (-2203.466) [-2199.867] (-2200.604) -- 0:00:54 268000 -- (-2200.051) (-2200.023) [-2202.411] (-2199.653) * (-2201.553) (-2201.592) [-2199.648] (-2209.129) -- 0:00:54 268500 -- (-2200.051) (-2200.466) [-2200.640] (-2200.746) * (-2201.200) (-2200.187) [-2200.966] (-2202.201) -- 0:00:54 269000 -- (-2201.086) [-2200.496] (-2202.319) (-2201.643) * (-2202.748) (-2200.296) (-2201.631) [-2200.047] -- 0:00:54 269500 -- (-2202.443) (-2200.666) [-2200.331] (-2200.258) * (-2202.765) (-2201.515) [-2202.165] (-2201.259) -- 0:00:54 270000 -- (-2203.604) [-2201.506] (-2203.735) (-2201.366) * (-2200.642) (-2200.294) (-2201.940) [-2201.147] -- 0:00:54 Average standard deviation of split frequencies: 0.013421 270500 -- (-2202.868) (-2200.221) (-2201.928) [-2201.451] * (-2200.072) (-2201.439) [-2202.930] (-2200.478) -- 0:00:53 271000 -- [-2202.905] (-2199.889) (-2201.979) (-2201.988) * (-2200.718) (-2203.018) [-2201.172] (-2200.460) -- 0:00:53 271500 -- (-2205.414) (-2199.332) (-2200.295) [-2202.280] * (-2201.937) [-2200.230] (-2200.820) (-2199.969) -- 0:00:53 272000 -- (-2201.175) [-2199.368] (-2199.339) (-2200.694) * [-2202.193] (-2200.213) (-2200.399) (-2201.343) -- 0:00:53 272500 -- [-2200.901] (-2200.461) (-2200.187) (-2202.464) * (-2200.638) [-2201.252] (-2200.360) (-2200.732) -- 0:00:53 273000 -- (-2200.718) (-2200.784) (-2200.174) [-2200.871] * (-2200.312) (-2201.259) (-2201.909) [-2204.194] -- 0:00:53 273500 -- [-2202.242] (-2200.122) (-2200.444) (-2200.498) * [-2199.682] (-2202.120) (-2201.304) (-2205.320) -- 0:00:53 274000 -- (-2204.741) [-2200.385] (-2200.572) (-2201.254) * (-2199.576) (-2204.188) [-2201.355] (-2202.363) -- 0:00:52 274500 -- [-2202.956] (-2199.932) (-2201.030) (-2202.430) * [-2200.043] (-2206.762) (-2203.574) (-2203.576) -- 0:00:52 275000 -- [-2201.896] (-2200.518) (-2200.438) (-2202.179) * [-2200.219] (-2206.149) (-2201.566) (-2200.828) -- 0:00:52 Average standard deviation of split frequencies: 0.012358 275500 -- (-2201.085) (-2201.439) (-2200.614) [-2201.380] * (-2202.585) (-2203.178) (-2201.566) [-2203.831] -- 0:00:52 276000 -- (-2199.990) (-2199.688) (-2199.858) [-2201.466] * (-2207.254) [-2202.858] (-2205.642) (-2202.282) -- 0:00:52 276500 -- [-2200.385] (-2199.418) (-2200.116) (-2202.785) * (-2204.624) [-2205.034] (-2210.806) (-2202.282) -- 0:00:52 277000 -- (-2199.978) (-2201.016) (-2200.763) [-2201.747] * (-2206.985) (-2201.125) (-2204.172) [-2202.389] -- 0:00:52 277500 -- [-2200.119] (-2203.573) (-2201.997) (-2201.136) * [-2201.969] (-2205.304) (-2203.828) (-2200.702) -- 0:00:52 278000 -- (-2200.780) [-2204.290] (-2202.094) (-2202.076) * (-2203.196) (-2201.292) [-2203.128] (-2200.736) -- 0:00:51 278500 -- [-2199.979] (-2201.094) (-2203.430) (-2200.231) * (-2201.611) (-2202.683) (-2202.482) [-2200.088] -- 0:00:51 279000 -- (-2202.203) [-2201.369] (-2205.783) (-2204.667) * [-2201.694] (-2201.679) (-2204.780) (-2202.126) -- 0:00:54 279500 -- (-2202.676) (-2199.988) (-2201.917) [-2203.775] * (-2200.174) (-2201.676) [-2207.476] (-2204.811) -- 0:00:54 280000 -- (-2202.144) [-2200.789] (-2205.133) (-2205.036) * [-2199.982] (-2204.939) (-2200.361) (-2203.911) -- 0:00:53 Average standard deviation of split frequencies: 0.012449 280500 -- (-2203.910) (-2203.650) [-2199.953] (-2205.745) * (-2202.402) (-2200.820) [-2202.020] (-2202.924) -- 0:00:53 281000 -- (-2199.913) (-2203.369) [-2199.403] (-2203.102) * (-2201.638) (-2205.637) (-2203.635) [-2203.654] -- 0:00:53 281500 -- (-2202.048) (-2201.715) [-2200.358] (-2203.392) * [-2202.035] (-2205.293) (-2201.815) (-2205.877) -- 0:00:53 282000 -- (-2207.319) [-2201.407] (-2200.408) (-2206.150) * (-2201.470) (-2202.987) [-2201.777] (-2206.371) -- 0:00:53 282500 -- (-2204.702) (-2199.668) [-2201.949] (-2200.333) * (-2201.252) (-2200.812) (-2200.509) [-2199.965] -- 0:00:53 283000 -- (-2199.758) [-2201.894] (-2206.685) (-2201.533) * (-2199.990) [-2199.673] (-2200.513) (-2200.403) -- 0:00:53 283500 -- [-2200.895] (-2203.864) (-2211.987) (-2202.412) * (-2200.939) [-2199.685] (-2200.550) (-2200.066) -- 0:00:53 284000 -- (-2201.114) (-2201.091) [-2200.893] (-2202.583) * (-2201.917) (-2199.685) (-2200.511) [-2200.383] -- 0:00:52 284500 -- [-2200.958] (-2201.960) (-2201.564) (-2202.271) * (-2203.259) (-2206.159) (-2200.391) [-2199.624] -- 0:00:52 285000 -- [-2200.950] (-2201.162) (-2200.776) (-2203.571) * (-2203.196) (-2201.188) (-2200.329) [-2199.947] -- 0:00:52 Average standard deviation of split frequencies: 0.011829 285500 -- (-2199.907) (-2200.618) [-2200.127] (-2199.550) * [-2204.891] (-2201.944) (-2201.768) (-2201.233) -- 0:00:52 286000 -- [-2199.911] (-2200.313) (-2199.723) (-2201.709) * (-2200.697) (-2201.765) (-2202.216) [-2200.185] -- 0:00:52 286500 -- [-2199.820] (-2200.316) (-2202.945) (-2199.834) * (-2200.010) (-2201.284) (-2204.055) [-2200.250] -- 0:00:52 287000 -- (-2199.799) (-2200.374) (-2201.691) [-2201.937] * [-2201.505] (-2202.163) (-2203.906) (-2203.603) -- 0:00:52 287500 -- (-2200.090) (-2204.143) (-2202.333) [-2199.933] * [-2199.945] (-2204.518) (-2201.944) (-2200.994) -- 0:00:52 288000 -- (-2200.593) [-2200.454] (-2201.317) (-2199.903) * [-2199.417] (-2201.970) (-2204.210) (-2201.035) -- 0:00:51 288500 -- [-2199.727] (-2201.448) (-2200.031) (-2199.878) * (-2199.771) (-2199.932) (-2203.383) [-2201.679] -- 0:00:51 289000 -- (-2202.470) (-2204.043) [-2199.655] (-2199.975) * [-2199.864] (-2199.997) (-2206.620) (-2203.066) -- 0:00:51 289500 -- (-2199.958) (-2203.400) (-2200.980) [-2199.736] * [-2199.867] (-2201.164) (-2202.217) (-2201.877) -- 0:00:51 290000 -- (-2202.499) (-2203.834) (-2199.694) [-2201.318] * (-2199.741) (-2200.852) (-2202.324) [-2203.629] -- 0:00:51 Average standard deviation of split frequencies: 0.011448 290500 -- (-2202.638) (-2203.830) (-2201.193) [-2201.378] * (-2202.231) (-2200.884) [-2199.726] (-2203.411) -- 0:00:53 291000 -- (-2204.571) [-2203.915] (-2202.265) (-2205.001) * (-2201.587) [-2200.886] (-2200.907) (-2203.004) -- 0:00:53 291500 -- [-2200.371] (-2204.112) (-2203.574) (-2204.981) * (-2200.554) [-2200.126] (-2200.574) (-2200.642) -- 0:00:53 292000 -- [-2200.383] (-2202.586) (-2200.814) (-2200.812) * (-2202.390) [-2200.238] (-2200.568) (-2201.772) -- 0:00:53 292500 -- (-2202.330) [-2200.127] (-2203.619) (-2204.501) * (-2199.604) [-2199.895] (-2200.571) (-2200.557) -- 0:00:53 293000 -- (-2206.276) [-2200.289] (-2200.628) (-2201.705) * (-2199.157) [-2202.547] (-2201.098) (-2200.214) -- 0:00:53 293500 -- (-2208.035) (-2200.829) [-2200.375] (-2203.041) * [-2199.149] (-2204.552) (-2202.704) (-2200.238) -- 0:00:52 294000 -- (-2207.151) (-2202.800) (-2200.596) [-2203.988] * [-2199.359] (-2206.082) (-2200.766) (-2200.774) -- 0:00:52 294500 -- (-2207.748) [-2201.224] (-2201.688) (-2204.062) * (-2207.346) [-2201.686] (-2200.814) (-2200.774) -- 0:00:52 295000 -- [-2202.920] (-2201.087) (-2202.438) (-2200.280) * (-2200.904) (-2202.712) (-2199.833) [-2202.086] -- 0:00:52 Average standard deviation of split frequencies: 0.012272 295500 -- (-2201.257) [-2199.771] (-2202.751) (-2200.315) * (-2202.601) [-2201.194] (-2200.020) (-2201.676) -- 0:00:52 296000 -- (-2202.260) (-2200.657) (-2205.678) [-2203.346] * (-2204.800) (-2200.097) [-2203.283] (-2200.597) -- 0:00:52 296500 -- [-2206.547] (-2202.806) (-2206.298) (-2201.494) * (-2200.891) [-2203.015] (-2205.393) (-2201.037) -- 0:00:52 297000 -- [-2201.418] (-2199.617) (-2203.029) (-2201.347) * (-2201.533) [-2201.863] (-2205.362) (-2202.101) -- 0:00:52 297500 -- (-2200.304) (-2199.471) (-2204.636) [-2201.234] * (-2200.670) (-2201.190) (-2199.912) [-2202.817] -- 0:00:51 298000 -- (-2204.403) (-2200.559) [-2204.430] (-2199.758) * [-2201.488] (-2205.375) (-2202.709) (-2201.068) -- 0:00:51 298500 -- (-2201.702) [-2200.885] (-2200.747) (-2202.523) * (-2201.087) (-2201.578) (-2200.248) [-2200.638] -- 0:00:51 299000 -- (-2203.145) (-2201.378) [-2201.079] (-2199.532) * (-2205.805) (-2201.223) (-2200.192) [-2201.039] -- 0:00:51 299500 -- (-2202.329) (-2200.847) [-2201.743] (-2201.168) * [-2203.295] (-2200.496) (-2201.038) (-2200.703) -- 0:00:51 300000 -- [-2201.452] (-2199.941) (-2201.213) (-2200.303) * (-2202.902) (-2200.306) (-2202.883) [-2200.696] -- 0:00:51 Average standard deviation of split frequencies: 0.011713 300500 -- (-2201.300) (-2200.365) (-2201.557) [-2201.135] * (-2200.887) [-2200.309] (-2201.343) (-2200.147) -- 0:00:51 301000 -- (-2200.411) [-2200.135] (-2202.387) (-2200.731) * (-2201.157) (-2201.265) (-2200.952) [-2200.146] -- 0:00:51 301500 -- (-2202.603) [-2199.988] (-2202.753) (-2203.162) * [-2200.609] (-2201.313) (-2204.161) (-2201.453) -- 0:00:50 302000 -- (-2205.164) [-2200.783] (-2200.957) (-2203.339) * (-2200.479) [-2200.156] (-2201.817) (-2202.481) -- 0:00:53 302500 -- (-2204.676) (-2199.510) [-2200.206] (-2201.102) * (-2205.748) [-2200.376] (-2201.133) (-2203.157) -- 0:00:53 303000 -- (-2201.129) (-2199.524) (-2199.751) [-2201.915] * (-2204.423) (-2201.776) [-2201.228] (-2203.296) -- 0:00:52 303500 -- (-2201.460) (-2199.867) (-2200.184) [-2205.188] * [-2201.506] (-2199.179) (-2200.187) (-2199.913) -- 0:00:52 304000 -- (-2201.337) [-2199.840] (-2200.019) (-2204.424) * (-2203.801) (-2201.068) [-2201.506] (-2201.913) -- 0:00:52 304500 -- (-2205.358) (-2202.446) (-2200.067) [-2200.535] * (-2203.679) (-2200.492) [-2200.718] (-2200.925) -- 0:00:52 305000 -- (-2205.981) [-2200.900] (-2202.025) (-2201.096) * [-2204.325] (-2200.489) (-2199.216) (-2199.800) -- 0:00:52 Average standard deviation of split frequencies: 0.012752 305500 -- (-2202.427) (-2202.656) [-2201.387] (-2200.885) * (-2203.189) (-2202.226) (-2202.234) [-2199.863] -- 0:00:52 306000 -- (-2201.225) (-2202.396) (-2202.243) [-2204.698] * [-2199.462] (-2204.031) (-2204.519) (-2200.724) -- 0:00:52 306500 -- (-2204.561) (-2204.016) (-2203.316) [-2203.373] * [-2201.025] (-2203.405) (-2202.883) (-2202.556) -- 0:00:52 307000 -- (-2202.145) [-2201.294] (-2202.062) (-2204.005) * (-2207.143) [-2202.879] (-2201.479) (-2201.865) -- 0:00:51 307500 -- (-2202.026) [-2204.552] (-2201.977) (-2199.451) * (-2206.067) [-2200.883] (-2201.771) (-2205.667) -- 0:00:51 308000 -- (-2200.996) [-2203.776] (-2200.973) (-2201.633) * [-2200.170] (-2204.020) (-2201.844) (-2203.933) -- 0:00:51 308500 -- (-2205.418) (-2201.087) (-2201.984) [-2201.380] * (-2201.083) (-2201.212) [-2202.715] (-2201.366) -- 0:00:51 309000 -- (-2204.280) [-2201.653] (-2201.269) (-2201.380) * (-2203.370) [-2200.339] (-2204.794) (-2201.542) -- 0:00:51 309500 -- (-2208.463) (-2200.173) [-2200.511] (-2200.255) * (-2204.016) [-2200.435] (-2205.370) (-2200.696) -- 0:00:51 310000 -- (-2205.973) [-2202.102] (-2202.904) (-2202.948) * [-2201.668] (-2199.934) (-2202.256) (-2202.835) -- 0:00:51 Average standard deviation of split frequencies: 0.011871 310500 -- (-2201.648) (-2202.795) (-2202.148) [-2203.373] * (-2201.250) (-2205.407) (-2199.726) [-2202.354] -- 0:00:51 311000 -- [-2202.484] (-2201.789) (-2202.274) (-2200.184) * (-2202.296) [-2204.789] (-2200.334) (-2202.672) -- 0:00:50 311500 -- (-2200.990) (-2200.374) [-2200.321] (-2203.972) * [-2205.705] (-2200.262) (-2202.005) (-2199.836) -- 0:00:50 312000 -- [-2200.761] (-2200.191) (-2200.138) (-2200.958) * (-2200.061) [-2200.991] (-2201.630) (-2200.508) -- 0:00:50 312500 -- [-2202.255] (-2200.046) (-2202.331) (-2202.128) * (-2203.485) (-2201.444) [-2201.424] (-2199.982) -- 0:00:50 313000 -- [-2201.607] (-2200.340) (-2202.610) (-2202.893) * [-2199.724] (-2201.381) (-2202.707) (-2201.677) -- 0:00:50 313500 -- (-2201.127) (-2201.914) (-2203.333) [-2199.842] * (-2199.726) (-2200.817) (-2203.931) [-2202.055] -- 0:00:50 314000 -- (-2200.260) (-2202.721) (-2204.064) [-2199.542] * (-2200.208) [-2200.480] (-2202.247) (-2202.663) -- 0:00:50 314500 -- (-2203.413) (-2200.773) (-2202.604) [-2200.032] * (-2200.287) [-2200.987] (-2201.927) (-2201.078) -- 0:00:50 315000 -- (-2203.472) [-2201.958] (-2205.802) (-2200.783) * (-2200.931) (-2201.319) [-2203.372] (-2202.273) -- 0:00:50 Average standard deviation of split frequencies: 0.012724 315500 -- (-2205.218) [-2200.884] (-2201.687) (-2202.671) * (-2202.691) (-2202.079) (-2205.508) [-2200.351] -- 0:00:49 316000 -- (-2203.589) [-2200.443] (-2201.349) (-2203.118) * (-2202.239) (-2201.301) [-2199.362] (-2201.290) -- 0:00:49 316500 -- [-2204.093] (-2201.774) (-2202.232) (-2201.961) * (-2202.943) (-2203.676) [-2199.810] (-2201.366) -- 0:00:49 317000 -- [-2200.879] (-2200.387) (-2204.095) (-2203.307) * (-2203.009) (-2204.368) (-2199.602) [-2206.607] -- 0:00:51 317500 -- (-2199.794) (-2200.648) (-2202.345) [-2200.540] * (-2201.600) (-2204.639) [-2199.175] (-2204.657) -- 0:00:51 318000 -- (-2200.925) (-2199.863) (-2202.760) [-2200.505] * (-2204.078) (-2202.810) [-2202.788] (-2204.673) -- 0:00:51 318500 -- (-2201.538) [-2199.777] (-2202.785) (-2203.319) * (-2205.547) [-2202.246] (-2199.916) (-2201.302) -- 0:00:51 319000 -- (-2200.450) (-2201.329) [-2205.001] (-2199.672) * (-2202.039) (-2201.332) (-2200.763) [-2201.272] -- 0:00:51 319500 -- (-2201.041) [-2199.713] (-2203.520) (-2200.371) * (-2201.915) (-2201.650) [-2199.416] (-2200.673) -- 0:00:51 320000 -- (-2200.436) (-2200.159) (-2200.992) [-2199.848] * (-2200.754) (-2200.599) (-2199.511) [-2200.989] -- 0:00:50 Average standard deviation of split frequencies: 0.012885 320500 -- (-2205.114) [-2199.953] (-2202.346) (-2200.511) * (-2201.917) [-2200.572] (-2202.193) (-2206.007) -- 0:00:50 321000 -- (-2203.791) (-2199.624) [-2200.614] (-2199.786) * (-2202.044) [-2200.572] (-2202.006) (-2203.265) -- 0:00:50 321500 -- (-2205.098) (-2199.624) (-2200.486) [-2200.934] * (-2202.846) (-2201.032) [-2200.174] (-2204.102) -- 0:00:50 322000 -- (-2205.000) (-2201.264) (-2200.956) [-2200.277] * (-2201.828) [-2200.910] (-2203.202) (-2201.363) -- 0:00:50 322500 -- [-2204.014] (-2202.488) (-2200.402) (-2200.897) * (-2199.958) (-2200.708) (-2201.331) [-2200.997] -- 0:00:50 323000 -- (-2200.297) [-2202.712] (-2200.589) (-2201.340) * [-2200.375] (-2200.553) (-2202.247) (-2205.856) -- 0:00:50 323500 -- (-2200.784) (-2201.161) (-2206.452) [-2201.527] * [-2201.477] (-2201.984) (-2201.881) (-2204.698) -- 0:00:50 324000 -- [-2200.980] (-2204.113) (-2204.821) (-2201.426) * (-2202.222) [-2202.903] (-2199.844) (-2204.815) -- 0:00:50 324500 -- (-2201.290) (-2203.173) (-2202.367) [-2202.133] * [-2203.119] (-2204.561) (-2202.385) (-2204.496) -- 0:00:49 325000 -- (-2200.782) (-2204.608) [-2201.750] (-2202.941) * (-2201.703) (-2202.505) [-2201.473] (-2200.463) -- 0:00:49 Average standard deviation of split frequencies: 0.012504 325500 -- (-2200.811) (-2203.601) [-2201.956] (-2201.766) * [-2201.075] (-2200.730) (-2200.427) (-2201.016) -- 0:00:49 326000 -- [-2201.170] (-2205.405) (-2201.147) (-2201.764) * (-2203.689) (-2202.568) (-2200.392) [-2200.429] -- 0:00:49 326500 -- [-2200.965] (-2204.341) (-2200.712) (-2203.265) * (-2203.841) (-2201.170) [-2201.875] (-2200.834) -- 0:00:49 327000 -- [-2200.344] (-2201.919) (-2201.614) (-2201.645) * (-2205.619) (-2201.975) (-2201.826) [-2203.767] -- 0:00:49 327500 -- (-2199.982) (-2201.322) [-2201.175] (-2200.812) * (-2204.851) (-2203.504) (-2201.868) [-2207.609] -- 0:00:49 328000 -- [-2200.675] (-2209.368) (-2201.097) (-2201.304) * (-2200.985) (-2200.478) [-2200.392] (-2202.674) -- 0:00:49 328500 -- (-2202.622) (-2202.123) (-2202.692) [-2202.178] * [-2202.106] (-2199.651) (-2199.678) (-2202.018) -- 0:00:49 329000 -- (-2200.290) [-2201.500] (-2203.653) (-2200.914) * (-2204.440) (-2199.996) (-2201.322) [-2202.315] -- 0:00:48 329500 -- [-2201.819] (-2203.379) (-2202.051) (-2199.491) * (-2202.293) [-2201.539] (-2205.632) (-2200.654) -- 0:00:48 330000 -- (-2203.143) (-2202.858) [-2202.163] (-2199.801) * [-2202.162] (-2202.698) (-2199.460) (-2200.654) -- 0:00:48 Average standard deviation of split frequencies: 0.012244 330500 -- (-2199.727) (-2202.376) [-2202.228] (-2200.825) * (-2200.894) (-2204.913) (-2199.421) [-2204.529] -- 0:00:48 331000 -- (-2201.234) (-2200.918) [-2200.344] (-2203.323) * (-2202.891) (-2201.588) [-2199.582] (-2205.861) -- 0:00:48 331500 -- (-2203.507) [-2202.590] (-2207.179) (-2202.152) * (-2202.174) [-2202.687] (-2199.916) (-2204.440) -- 0:00:48 332000 -- [-2205.241] (-2201.361) (-2203.839) (-2201.188) * (-2202.318) [-2202.687] (-2202.464) (-2203.692) -- 0:00:50 332500 -- (-2205.029) (-2201.547) [-2200.806] (-2202.602) * (-2200.750) (-2204.554) (-2200.056) [-2203.025] -- 0:00:50 333000 -- (-2201.734) (-2202.807) [-2202.897] (-2201.548) * (-2200.134) [-2203.537] (-2200.847) (-2203.409) -- 0:00:50 333500 -- (-2208.517) (-2205.161) (-2201.059) [-2200.959] * (-2201.332) (-2204.797) [-2203.850] (-2209.799) -- 0:00:49 334000 -- (-2201.564) (-2200.519) (-2202.123) [-2200.811] * (-2201.694) (-2199.699) [-2203.611] (-2207.412) -- 0:00:49 334500 -- (-2203.278) [-2200.598] (-2202.237) (-2201.627) * (-2201.470) (-2201.988) [-2202.926] (-2202.467) -- 0:00:49 335000 -- (-2199.147) (-2201.167) [-2206.139] (-2203.386) * [-2203.951] (-2200.698) (-2203.780) (-2202.087) -- 0:00:49 Average standard deviation of split frequencies: 0.012379 335500 -- [-2199.180] (-2201.742) (-2206.238) (-2201.057) * (-2204.383) [-2202.048] (-2203.004) (-2203.085) -- 0:00:49 336000 -- (-2199.553) (-2202.083) [-2206.957] (-2200.670) * (-2207.480) (-2201.960) [-2204.564] (-2205.629) -- 0:00:49 336500 -- (-2207.706) [-2200.097] (-2202.021) (-2204.794) * (-2205.352) [-2201.805] (-2201.269) (-2203.794) -- 0:00:49 337000 -- [-2199.217] (-2200.845) (-2202.776) (-2203.346) * (-2202.812) (-2199.613) (-2206.104) [-2201.909] -- 0:00:49 337500 -- [-2201.380] (-2200.892) (-2203.580) (-2202.026) * [-2210.502] (-2199.772) (-2201.088) (-2201.768) -- 0:00:49 338000 -- (-2202.426) (-2201.242) (-2206.210) [-2199.762] * (-2204.335) (-2201.210) [-2203.908] (-2201.448) -- 0:00:48 338500 -- (-2202.385) (-2201.243) (-2202.098) [-2200.260] * (-2204.005) [-2201.326] (-2200.257) (-2200.713) -- 0:00:48 339000 -- [-2200.729] (-2201.618) (-2203.908) (-2200.346) * (-2201.952) (-2200.275) (-2201.317) [-2200.584] -- 0:00:48 339500 -- (-2201.279) (-2200.840) [-2202.972] (-2201.102) * (-2200.925) (-2201.772) [-2205.121] (-2201.084) -- 0:00:48 340000 -- (-2199.625) (-2199.621) [-2203.260] (-2199.501) * (-2200.095) (-2201.223) (-2204.967) [-2201.781] -- 0:00:48 Average standard deviation of split frequencies: 0.012617 340500 -- (-2202.769) (-2200.975) (-2207.533) [-2199.933] * [-2200.274] (-2199.861) (-2204.893) (-2201.981) -- 0:00:48 341000 -- [-2199.998] (-2207.140) (-2201.430) (-2199.552) * (-2202.336) [-2199.718] (-2204.491) (-2201.876) -- 0:00:48 341500 -- (-2200.132) [-2206.225] (-2200.431) (-2204.170) * [-2201.884] (-2199.720) (-2199.681) (-2201.024) -- 0:00:48 342000 -- (-2202.468) [-2200.768] (-2200.391) (-2199.301) * [-2199.816] (-2199.706) (-2199.887) (-2203.400) -- 0:00:48 342500 -- (-2200.177) [-2200.658] (-2201.233) (-2202.078) * [-2200.602] (-2201.847) (-2199.594) (-2201.918) -- 0:00:47 343000 -- [-2201.174] (-2202.951) (-2201.521) (-2204.350) * [-2199.671] (-2203.861) (-2199.728) (-2202.113) -- 0:00:47 343500 -- (-2200.940) (-2206.498) [-2201.916] (-2204.457) * (-2202.000) [-2203.404] (-2201.835) (-2200.919) -- 0:00:47 344000 -- (-2200.050) (-2203.260) [-2205.351] (-2203.169) * (-2204.090) [-2200.825] (-2200.977) (-2200.957) -- 0:00:47 344500 -- [-2199.575] (-2201.707) (-2204.247) (-2205.725) * (-2203.436) (-2200.961) (-2200.597) [-2201.806] -- 0:00:47 345000 -- (-2202.069) (-2201.425) (-2203.822) [-2201.562] * (-2201.748) [-2203.954] (-2202.868) (-2203.884) -- 0:00:47 Average standard deviation of split frequencies: 0.011701 345500 -- (-2201.918) (-2203.789) [-2201.656] (-2201.346) * (-2202.920) (-2202.660) [-2205.779] (-2201.488) -- 0:00:47 346000 -- [-2202.185] (-2203.524) (-2200.113) (-2201.346) * (-2201.747) (-2201.013) [-2199.714] (-2201.187) -- 0:00:47 346500 -- (-2201.499) (-2202.037) [-2200.112] (-2203.622) * (-2203.951) [-2201.533] (-2201.267) (-2199.732) -- 0:00:49 347000 -- (-2201.987) (-2201.282) [-2199.889] (-2204.552) * [-2199.518] (-2201.487) (-2203.951) (-2200.839) -- 0:00:48 347500 -- (-2202.960) [-2199.557] (-2200.552) (-2200.012) * (-2199.321) [-2200.603] (-2202.804) (-2200.747) -- 0:00:48 348000 -- (-2203.536) (-2201.903) (-2200.668) [-2199.874] * (-2200.038) [-2202.104] (-2205.855) (-2202.373) -- 0:00:48 348500 -- [-2203.038] (-2200.799) (-2202.242) (-2202.125) * (-2200.064) (-2203.654) (-2209.948) [-2200.835] -- 0:00:48 349000 -- [-2203.371] (-2200.557) (-2200.290) (-2201.230) * (-2201.599) (-2202.843) [-2201.501] (-2200.708) -- 0:00:48 349500 -- (-2201.345) (-2199.996) [-2202.253] (-2200.202) * [-2200.139] (-2206.213) (-2201.986) (-2200.884) -- 0:00:48 350000 -- (-2202.641) (-2200.534) (-2200.768) [-2202.378] * [-2200.224] (-2202.335) (-2200.934) (-2203.421) -- 0:00:48 Average standard deviation of split frequencies: 0.010675 350500 -- (-2206.927) (-2204.144) (-2201.364) [-2201.221] * [-2201.200] (-2201.664) (-2202.387) (-2203.055) -- 0:00:48 351000 -- [-2201.612] (-2208.784) (-2202.179) (-2200.336) * [-2200.011] (-2200.383) (-2200.799) (-2199.655) -- 0:00:48 351500 -- (-2200.638) (-2203.526) (-2200.783) [-2202.050] * (-2202.497) (-2201.903) (-2200.277) [-2199.909] -- 0:00:47 352000 -- (-2200.739) [-2200.299] (-2201.315) (-2200.939) * (-2201.855) (-2202.940) (-2202.133) [-2200.211] -- 0:00:47 352500 -- (-2199.699) [-2201.389] (-2205.059) (-2201.747) * (-2202.562) (-2201.825) (-2200.036) [-2199.691] -- 0:00:47 353000 -- (-2200.501) (-2200.307) (-2205.477) [-2200.629] * (-2200.407) [-2203.294] (-2200.133) (-2201.353) -- 0:00:47 353500 -- (-2200.197) [-2200.184] (-2204.297) (-2204.759) * [-2204.922] (-2200.101) (-2200.125) (-2201.057) -- 0:00:47 354000 -- (-2200.802) [-2200.021] (-2201.065) (-2200.853) * (-2204.142) [-2201.266] (-2200.144) (-2201.630) -- 0:00:47 354500 -- [-2201.381] (-2201.639) (-2199.653) (-2199.395) * [-2202.049] (-2199.995) (-2200.777) (-2200.417) -- 0:00:47 355000 -- [-2203.241] (-2202.654) (-2204.202) (-2200.085) * (-2201.159) (-2201.620) (-2200.617) [-2202.662] -- 0:00:47 Average standard deviation of split frequencies: 0.011450 355500 -- (-2203.705) (-2204.065) [-2200.683] (-2204.266) * (-2200.180) (-2199.879) [-2201.886] (-2201.602) -- 0:00:47 356000 -- (-2202.669) [-2199.265] (-2200.446) (-2203.072) * (-2202.771) [-2199.879] (-2203.199) (-2202.456) -- 0:00:47 356500 -- (-2202.991) (-2201.477) [-2206.210] (-2202.266) * (-2204.207) [-2199.989] (-2205.706) (-2203.516) -- 0:00:46 357000 -- (-2203.490) (-2211.640) [-2203.486] (-2203.139) * (-2205.704) [-2206.816] (-2201.816) (-2206.314) -- 0:00:46 357500 -- [-2200.990] (-2205.798) (-2202.459) (-2204.372) * (-2201.137) (-2202.582) (-2201.637) [-2207.015] -- 0:00:46 358000 -- [-2200.944] (-2201.742) (-2201.920) (-2206.311) * (-2201.873) (-2199.515) (-2200.906) [-2200.999] -- 0:00:46 358500 -- (-2200.075) (-2201.260) (-2199.928) [-2202.393] * (-2203.272) [-2200.538] (-2202.076) (-2200.675) -- 0:00:46 359000 -- (-2199.789) (-2203.327) (-2201.301) [-2201.113] * (-2201.076) (-2202.938) (-2202.976) [-2202.208] -- 0:00:46 359500 -- (-2201.363) [-2201.017] (-2205.090) (-2201.597) * (-2202.282) (-2202.463) (-2200.771) [-2202.385] -- 0:00:46 360000 -- (-2206.153) [-2200.663] (-2206.001) (-2201.346) * (-2203.180) [-2201.728] (-2203.929) (-2202.950) -- 0:00:46 Average standard deviation of split frequencies: 0.011763 360500 -- (-2204.183) (-2200.147) [-2205.486] (-2203.017) * (-2200.812) (-2202.010) (-2203.126) [-2202.209] -- 0:00:46 361000 -- (-2200.